>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family; InterPro: IPR014331 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes. With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognized by the major sigma factors , . This entry of sigma factors are members of the sigma-70 family and are abundantly found in the species Rhodopirellula baltica, and Verrucomicrobium spinosum and to a lesser extent in Gemmata obscuriglobus.; GO: 0003677 DNA binding, 0003700 transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, 0006355 regulation of transcription DNA-dependent.

Probab=92.42 E-value=0.92 Score=24.98 Aligned_cols=135 Identities=19% Similarity=0.252 Sum_probs=77.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 67778875443679999887438545731201028989999999997228704614205889899999999987760889 Q gi|254780289|r 467 GLQFLDLIQEGNIGLMKAAEKFDWCLGYKFSTYAMWWVKQAITRSIADQSCTIRIPVHMRDKIHKVVRTARRMSNKIKRE 546 (682) Q Consensus 467 ~~~~~~~~~~~~~~l~~a~~~~~~~~g~~f~tya~~~i~~~i~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~ 546 (682) T Consensus 25 ~~dadDv~QEt~v~~~~k~~~f~~~~~F------~aWa~~-----iA---------------rn~vl~----~~r~~~R~ 74 (163) T TIGR02989 25 RDDADDVLQETFVTAWRKFDEFDPGTDF------GAWARG-----IA---------------RNKVLN----HRRKLGRD 74 (163) T ss_pred CCCHHHHHHHHHHHHHHHHHHHCCCCCC------HHHHHH-----HH---------------HHHHHH----HHHHCCCC T ss_conf 5658889999999998607751789897------678999-----99---------------999999----98730244 Q ss_pred CCHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHH Q ss_conf 99789998709998999999986089875536358899860475623898899899999999999999997329988999 Q gi|254780289|r 547 PTPEEIAKKLAMPVEGVRKVLKITKEPISLETPIGDEDTSHLGDFIEDKNAVSPLDSAIQANLRETTTRVLASLTPREER 626 (682) Q Consensus 547 ~~~~~~a~~~~~~~~~~~~~~~~~~~~~sl~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~l~~l~~re~~ 626 (682) T Consensus 75 ~~~------l~~f~D~l~e~lA~-----~~~~~~~~~~---------------------~~~~~~AL~~C~~~L~~~~R~ 122 (163) T TIGR02989 75 RER------LVVFDDELLEALAA-----ELEEAEEADR---------------------SEDELQALEGCLEKLPERQRE 122 (163) T ss_pred CHH------HHHHHHHHHHHHHH-----HHHHHHCCCC---------------------CHHHHHHHHHHHHHCCHHHHH T ss_conf 127------77625999999999-----8755522788---------------------178999999878635978899 Q ss_pred HHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHH Q ss_conf 99998187986746889998996678999999999999983 Q gi|254780289|r 627 VLRMRFGIGMNTDHTLEEVGKQFCVTRERIRQIEAKAIRKL 667 (682) Q Consensus 627 v~~~r~g~~~~~~~tl~e~~~~~~~~~er~rqi~~~a~~~l 667 (682) T Consensus 123 Ll~~rY~~----G~~~~~~A~~~g~~~~A~~~~L~R~R~~L 159 (163) T TIGR02989 123 LLQLRYQR----GVSLEALAEQLGRTVNAVYKALSRLRVRL 159 (163) T ss_pred HHHHHHCC----CCCHHHHHHHHCCHHHHHHHHHHHHHHHH T ss_conf 99998227----97878999884713899999999999997

HHsearch alignment for GI: 254780289 and conserved domain: TIGR02989