HHsearch alignment for GI: 254780290 and conserved domain: PRK08278

>PRK08278 short chain dehydrogenase; Provisional.
Probab=95.23  E-value=0.0013  Score=43.06  Aligned_cols=77  Identities=30%  Similarity=0.362  Sum_probs=48.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----------CCCCCCCCCC---CCCCCCCCCC----CCC
Q ss_conf             222222113444443222221222222221112232211-----------1111223322---2222222111----122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-----------LACLKLGAKH---AINYLKEDFL----EIL  206 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-----------~~~~~lGa~~---vi~~~~~~~~----~~i  206 (332)
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~l~~~~~~~a~e~~~~g~~~~~~~~Dv~~~~~v~~~v~~~   84 (273)
T PRK08278          5 SGKTLFITGASRGIGLAIALRAARDGANIVIAAKTAEPHPKLPGTIHTAAAEIEAAGGQALPLVGDVRDEDQVAAAVAKT   84 (273)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             99989994876599999999999879989999677222133454899999999974990899971179999999999999


Q ss_pred             CCCCCCCCCCCCCCCCC
Q ss_conf             22222221112222111
Q gi|254780290|r  207 QKETQGRGIDIILDMVG  223 (332)
Q Consensus       207 ~~~t~g~g~Divid~~G  223 (332)
T Consensus        85 ~~~~-G-~iDiLVNNAG   99 (273)
T PRK08278         85 VERF-G-GIDICVNNAS   99 (273)
T ss_pred             HHHH-C-CCCEEEECCC
T ss_conf             9985-9-9629998786