RPSBLAST alignment for GI: 254780290 and conserved domain: TIGR00692

>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase. E. coli His-90 modulates substrate specificity and is believed part of the active site. Length = 340
 Score = 88.4 bits (219), Expect = 3e-18
 Identities = 95/347 (27%), Positives = 147/347 (42%), Gaps = 56/347 (16%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDV-------MQRKGLYPPPKNANPILGLEVAGKI 75
           L E P+P+P   E+LIKV A  +   DV         +  + PP      ++G EVAG++
Sbjct: 13  LTEVPVPEPGPGEVLIKVLATSICGTDVHIYNWDEWAQSRIKPP-----QVVGHEVAGEV 67

Query: 76  VDLGENTTHWNIGDEVCA---LVNGGGYAEYCLSHQGHTLPIPKG-----------YNAI 121
           V +G       +GD V     +V G  YA  C   Q H     K            Y  +
Sbjct: 68  VGIGPGVEGIKVGDYVSVETHIVCGKCYA--CRRGQYHVCQNTKIFGVDTDGCFAEYAVV 125

Query: 122 QA-------ASLPESFFTV---WANLFQT--ANLRSGQTVLIHGGSSGIGTTAIQLASYF 169
            A        S+P  + T+     N   T  A   SG++VL+ G    IG  AI +A   
Sbjct: 126 PAQNIWKNPKSIPPEYATIQEPLGNAVHTVLAGPISGKSVLVTGAGP-IGLMAIAVAKAS 184

Query: 170 GAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA-EYL 227
           GA  V  +  +E +     K+GA + +N  KED ++ +   T G G+D+ L+M GA + L
Sbjct: 185 GAYPVIVSDPNEYRLELAKKMGATYVVNPFKEDVVKEVADLTDGEGVDVFLEMSGAPKAL 244

Query: 228 NQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQ 287
            Q L  ++  G++ ++    G +  +   N +I K +TI G T R   +      R    
Sbjct: 245 EQGLQAVTPGGRVSLLGLPPGKVTIDFT-NKVIFKGLTIYGITGRHMFETWYTVSR---- 299

Query: 288 LKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
                L+ S  +   P+I       K     ++M +S   GK+IL  
Sbjct: 300 -----LIQSGKLDLDPIITHKFKFDKFEKGFELM-RSGQTGKVILSL 340