RPSBLAST alignment for GI: 254780290 and conserved domain: cd08258

>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 306
 Score =  115 bits (289), Expect = 2e-26
 Identities = 89/302 (29%), Positives = 137/302 (45%), Gaps = 39/302 (12%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +G G  NV  L E P P+P   E+LIKV A G+   D+   KG Y P +    +
Sbjct: 1   MKALVKTGPGPGNVE-LREVPEPEPGPGEVLIKVAAAGICGSDLHIYKGDYDPVE-TPVV 58

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEV-----------CALVN-----------------GG 98
           LG E +G IV++G +   W +GD V           C                      G
Sbjct: 59  LGHEFSGTIVEVGPDVEGWKVGDRVVSETTFSTCGRCPYCRRGDYNLCPHRKGIGTQADG 118

Query: 99  GYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGI 158
           G+AEY L  +     +P+  +   AA L E        + + + +R G TV++  G   I
Sbjct: 119 GFAEYVLVPEESLHELPENLSLEAAA-LTEPLAVAVHAVAERSGIRPGDTVVVF-GPGPI 176

Query: 159 GTTAIQLASYFGATVY---TTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI 215
           G  A Q+A   GATV    T        +A  +LGA   +N  +ED  E++ + T G G 
Sbjct: 177 GLLAAQVAKLQGATVVVVGTEKDEVRLDVA-KELGADA-VNGGEEDLAELVNEITDGDGA 234

Query: 216 DIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
           D++++  GA   L Q L LL K G+++ +  + G +A  I++  II K +++ GS     
Sbjct: 235 DVVIECSGAVPALEQALELLRKGGRIVQVG-IFGPLAASIDVERIIQKELSVIGSRSSTP 293

Query: 275 TD 276
             
Sbjct: 294 AS 295