HHsearch alignment of GI: 254780291 and MMDB domain: 2qfp_A_115-424

>2qfp_A (A:115-424) Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris}
Probab=98.67  E-value=7.6e-07  Score=64.59  Aligned_cols=232  Identities=13%  Similarity=0.117  Sum_probs=131.5

Q ss_pred             EEEEECCCEECCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCC-----HHHHHHHHHHH---CCCCCEEECCCCCCCCCC
Q ss_conf             1555133100463146889998861165678976051001212-----67788888672---655751302455444788
Q gi|254780291|r  162 IAVIADPWYKADTPMFVEAINSLKSSKNIILGILTGDMTQSST-----TKELKRFYNIY---SLKFPFFRGLGSQEYIGN  233 (475)
Q Consensus       162 ~~~~~~pw~k~~~~~~vesinsl~~~~~~~~gIINGDLTeFG~-----q~qL~eFr~Vw---nl~iPv~lGLGNHDYqNN  233 (475)
                      |++++|.-+..+  ...+.+.......+..|-|+.|||++.|.     +.++++|.+..   ..++|+|.-+|||||.+.
T Consensus         8 i~~isD~H~~~~--~~~~~~~~~~~~~~~d~vi~~GDl~~~~~~~~~~~~~~~~~~~~l~~~~~~~p~~~v~GNHD~~~~   85 (310)
T 2qfp_A            8 FGLIGDLGQSFD--SNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFA   85 (310)
T ss_dssp             EEEECSCTTBHH--HHHHHHHHHTCSSCCCEEEECSCCSCGGGSGGGCTHHHHHHHHHHHHHHTTSCEEECCCHHHHCCB
T ss_pred             EEEECCCCCCCC--HHHHHHHHHHCCCCCCEEEEECCEECCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             899744345764--056788897555688779993215015888542105678899888888713876993676521357


Q ss_pred             -CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEE
Q ss_conf             -8766745455000003688899999999877655566654210010013444565521037775443343027335554
Q gi|254780291|r  234 -RPCRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQ  312 (475)
Q Consensus       234 -~dC~~P~~~d~s~n~CA~sav~~M~s~I~dy~~q~s~i~efN~Ds~~y~~~~~~~~~~~vei~GSLSYSWd~gdvHfVQ  312 (475)
                       .... ....      ...         . ...      .........               .+...+....+..++..
T Consensus        86 ~~~~~-~~~~------~~~---------~-~~~------~~~~~~~~~---------------~~~~~~~~~~~~~~~~~  127 (310)
T 2qfp_A           86 PEINE-TEPF------KPF---------S-YRY------HVPYEASQS---------------TSPFWYSIKRASAHIIV  127 (310)
T ss_dssp             GGGTB-CSTT------HHH---------H-HHC------CCCGGGGTC---------------SSTTSEEEEETTEEEEE
T ss_pred             CCCCC-CCCC------CCH---------H-HHC------CCCCCCCCC---------------CCCCEEEEEECCEEEEE
T ss_conf             66554-3355------422---------3-323------454567788---------------87622887448888998


Q ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHCCCC-CCEEEEECCCCCC-------CHH
Q ss_conf             03641036751675300122221000256511343205655778878888840347-9579995004772-------003
Q gi|254780291|r  313 ANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQRE-GKYIILFADDIDR-------FSS  384 (475)
Q Consensus       313 ~NYpsy~~V~~n~~~~~af~Iqv~n~Id~q~l~s~Vn~~~~iskWL~~DL~~A~~~-gK~IILN~HD~~~-------~sS  384 (475)
                      ........                             ...+-.+||++.|..+... .+++|+..|.-..       ...
T Consensus       128 ~~~~~~~~-----------------------------~~~~q~~wl~~~l~~~~~~~~~~~i~~~H~p~~~~~~~~~~~~  178 (310)
T 2qfp_A          128 LSSYSAYG-----------------------------RGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEG  178 (310)
T ss_dssp             CCTTSCCS-----------------------------TTSHHHHHHHHHHHHCCTTTCCEEEEECSSCSSCCBSTTTTTT
T ss_pred             ECCCCCCC-----------------------------CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             34755777-----------------------------7529999999999875513688699951766411477787654


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCC-------------CC---------------CCEE--------EEEE
Q ss_conf             8999999999985896179998642367652465-------------55---------------3101--------3897
Q gi|254780291|r  385 IDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKD-------------ST---------------GRPV--------RVYN  428 (475)
Q Consensus       385 i~~KrmFks~itk~nV~AIF~aH~Hqshe~~lec-------------~~---------------GykV--------Pvy~  428 (475)
                      ......+...+.++++..+|.+|-|.-.......             ..               +++.        +.+.
T Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~hgH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~  258 (310)
T 2qfp_A          179 EAMRTKFEAWFVKYKVDVVFAGHVHAYERSERVSNIAYKITNGLCTPVKDQSAPVYITIGDAGNYGVIDSNMIQPQPEYS  258 (310)
T ss_dssp             HHHHHHHHHHHHHTTCSEEEECSSSSEEEECSEECCCCCSSSCCCSCEECTTSCEEEEECCSCTTSCCCCCBCSSCCTTE
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCEE
T ss_conf             67899999999975955999825631575103447742235875555479998799997547586644545578898746


Q ss_pred             ECCCCCCCEEEEEECC-CEEEEEEEECCCCCHHHH
Q ss_conf             0456467189999648-859999985167636787
Q gi|254780291|r  429 INKNSKNEFILLEMTP-HYINVTAYERRGKVPHIT  462 (475)
Q Consensus       429 iGSvpkNrF~~lem~~-~~atITgY~~Rd~tPhi~  462 (475)
                      ........|..+++.. ...+++.|...++.+...
T Consensus       259 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (310)
T 2qfp_A          259 AFREASFGHGMFDIKNRTHAHFSWNRNQDGVAVEA  293 (310)
T ss_dssp             EEEECCCEEEEEEECSSSEEEEEEEETTSCTTCCS
T ss_pred             EEEECCCCEEEEEEECCCEEEEEEEECCCCCEEEE
T ss_conf             89826699899999848869999998899988750