HHsearch results for GI: 254780291 and protein with PDBid: 2q8u_A

>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8}
Probab=97.11  E-value=0.002  Score=41.01  Aligned_cols=196  Identities=11%  Similarity=0.119  Sum_probs=97.4

Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCCC---HHHHHHHHHHH---CCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             6889998861165678976051001212---67788888672---65575130245544478887667454550000036
Q gi|254780291|r  177 FVEAINSLKSSKNIILGILTGDMTQSST---TKELKRFYNIY---SLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCA  250 (475)
Q Consensus       177 ~vesinsl~~~~~~~~gIINGDLTeFG~---q~qL~eFr~Vw---nl~iPv~lGLGNHDYqNN~dC~~P~~~d~s~n~CA  250 (475)
                      +.+.+-..-...++-+=++.|||++.+.   ...+..+....   +-++|+|.=.||||+.+...               
T Consensus        49 ~l~~i~~~a~~~~~D~vliaGDlf~~~~~~~~~~~~~~~~~~~~l~~~~~v~~i~GNHD~~~~~~---------------  113 (336)
T 2q8u_A           49 ALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKL---------------  113 (336)
T ss_dssp             HHHHHHHHHHHHTCSEEEEESCSBSCSSCCCHHHHHHHHHHHHHHHHHSCEEECCC------CHH---------------
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHC---------------
T ss_conf             99999999997499999989877779998889999999999998742897899457646410001---------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEEECCCCEEEEECCCCCCHH
Q ss_conf             88899999999877655566654210010013444565521037775443343027335554036410367516753001
Q gi|254780291|r  251 FIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNI  330 (475)
Q Consensus       251 ~sav~~M~s~I~dy~~q~s~i~efN~Ds~~y~~~~~~~~~~~vei~GSLSYSWd~gdvHfVQ~NYpsy~~V~~n~~~~~a  330 (475)
                            .......          +..........-      .+.+     +....+.++++-..|+....+..       
T Consensus       114 ------~~~~~~~----------~~~~~~~~~~~~------~~~~-----~~~~~~~v~~~~~~~~~~~~~~~-------  159 (336)
T 2q8u_A          114 ------FGNFVTS----------ISSDITFVMSFE------PVDV-----EAKRGQKVRILPFPYPDESEALR-------  159 (336)
T ss_dssp             ------HHHHHHH----------HCSSEEECCSSS------CEEE-----ECTTSCEEEEEEECCC--------------
T ss_pred             ------CHHHHHH----------CCCCCEECCCCC------CEEE-----ECCCCCEEEEECCCCCCCCCCCC-------
T ss_conf             ------1002221----------045500114556------5688-----70279669994366643000123-------


Q ss_pred             HHHHHHHCCCCCCEEEEEECCCCHH----HHHHHHHHHCCCCCCEEEEECCCC-CCCHHHHHHH-----HHHHHHHHCCC
Q ss_conf             2222100025651134320565577----887888884034795799950047-7200389999-----99999985896
Q gi|254780291|r  331 FTVAVPEHISKQDLPSHVSNGSEIS----QWIRDDVFQAQREGKYIILFADDI-DRFSSIDQKR-----MFEKFLTQSKI  400 (475)
Q Consensus       331 f~Iqv~n~Id~q~l~s~Vn~~~~is----kWL~~DL~~A~~~gK~IILN~HD~-~~~sSi~~Kr-----mFks~itk~nV  400 (475)
                                        ....+..    +++++-+..+...+.+.|+-+|.. ..+.......     .+...+...++
T Consensus       160 ------------------~~~~~~~~~~~~~l~~~~~~~~~~~~~~I~~~H~~v~~~~~~~~~~~~~~~~~~~~~~~~~~  221 (336)
T 2q8u_A          160 ------------------KNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVV  221 (336)
T ss_dssp             ------------------CCSSHHHHHHHHHHHHHHHHHHTCSSEEEEEEESEETTCC--------CCCEECGGGSCTTS
T ss_pred             ------------------CCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHCCC
T ss_conf             ------------------33067889999999999987326466539987542157666675223765455166631386


Q ss_pred             CEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCC---------CCEEEEEECCC
Q ss_conf             1799986423676524655531013897045646---------71899996488
Q gi|254780291|r  401 STIFTTRFTSSPESYIKDSTGRPVRVYNINKNSK---------NEFILLEMTPH  445 (475)
Q Consensus       401 ~AIF~aH~Hqshe~~lec~~GykVPvy~iGSvpk---------NrF~~lem~~~  445 (475)
                      ..|+-||.|.....-      .+-.++|.||...         .-|.++|+++.
T Consensus       222 d~v~~GH~H~~~~~~------~~~~i~y~Gs~~~~~~~E~~~~kg~~lvdi~~~  269 (336)
T 2q8u_A          222 DYAALGHIHSFREIQ------KQPLTIYPGSLIRIDFGEEADEKGAVFVELKRG  269 (336)
T ss_dssp             SEEEEESCSSCEEEE------ETTEEEECCCSSCCSGGGTTCCCEEEEEEEETT
T ss_pred             CEEEECCCCCCEEEC------CCCCEEECCCCCCCCCCCCCCCCEEEEEEECCC
T ss_conf             289927775755877------999889738962677251479987999998289