HHsearch results for GI: 254780291 and protein with PDBid: 2qfp_A

>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A*
Probab=99.10  E-value=2.4e-09  Score=80.02  Aligned_cols=159  Identities=12%  Similarity=0.183  Sum_probs=96.3

Q ss_pred             HHCCCEEEEEEECCCCC-----CCCHHHHHHHHHHH---CCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             61165678976051001-----21267788888672---65575130245544478887667454550000036888999
Q gi|254780291|r  185 KSSKNIILGILTGDMTQ-----SSTTKELKRFYNIY---SLKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGCAFIAIND  256 (475)
Q Consensus       185 ~~~~~~~~gIINGDLTe-----FG~q~qL~eFr~Vw---nl~iPv~lGLGNHDYqNN~dC~~P~~~d~s~n~CA~sav~~  256 (475)
                      ....+..|-+..||+..     ...+.+.++|.+..   .-.+|++..+|||||..+..-...+.+      -       
T Consensus       143 ~~~~~pdfvl~~GD~~y~d~~~~~~~~~wd~~~~~~~~~~~~iP~~~~~GNHE~~~~~~~~~~~~~------~-------  209 (424)
T 2qfp_A          143 LSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPF------K-------  209 (424)
T ss_dssp             TCSSCCCEEEECSCCSCGGGSGGGCTHHHHHHHHHHHHHHTTSCEEECCCHHHHCCBGGGTBCSTT------H-------
T ss_pred             HCCCCCCEEEEECCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCC------E-------
T ss_conf             655687659980437650555663036888999888788722965870676532257655667464------0-------


Q ss_pred             HHHHHHHHHHHHHHHHHHCCHHHCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEEECCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             99999877655566654210010013444565521037775443343027335554036410367516753001222210
Q gi|254780291|r  257 ISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVP  336 (475)
Q Consensus       257 M~s~I~dy~~q~s~i~efN~Ds~~y~~~~~~~~~~~vei~GSLSYSWd~gdvHfVQ~NYpsy~~V~~n~~~~~af~Iqv~  336 (475)
                            .|...      |+.-.     +..       .-.+..-||.++|++||+.++--..    +..           
T Consensus       210 ------~~~~~------f~~p~-----~~~-------~~~~~~yYsfd~G~v~fi~lds~~~----~~~-----------  250 (424)
T 2qfp_A          210 ------PFSYR------YHVPY-----EAS-------QSTSPFWYSIKRASAHIIVLSSYSA----YGR-----------  250 (424)
T ss_dssp             ------HHHHH------CCCCG-----GGG-------TCSSTTSEEEEETTEEEEECCTTSC----CST-----------
T ss_pred             ------EEECC------CCCCC-----CCC-------CCCCCCEEEEEECCEEEEECCCCCC----CCC-----------
T ss_conf             ------44211------35776-----666-------7888756999878888996147446----775-----------


Q ss_pred             HCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCC-EEEEECCCC---CCC----HHHHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             0025651134320565577887888884034795-799950047---720----03899999999998589617999864
Q gi|254780291|r  337 EHISKQDLPSHVSNGSEISQWIRDDVFQAQREGK-YIILFADDI---DRF----SSIDQKRMFEKFLTQSKISTIFTTRF  408 (475)
Q Consensus       337 n~Id~q~l~s~Vn~~~~iskWL~~DL~~A~~~gK-~IILN~HD~---~~~----sSi~~KrmFks~itk~nV~AIF~aH~  408 (475)
                                    +.+--+||++||.++++... -+|+.+|.-   ..-    .....+..|+.++.+++|..||.||.
T Consensus       251 --------------~~~Q~~WL~~dL~~~~r~~~~w~iv~~H~P~ys~~~~~~~~~~~~r~~~~~lf~ky~Vdlvl~GH~  316 (424)
T 2qfp_A          251 --------------GTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHV  316 (424)
T ss_dssp             --------------TSHHHHHHHHHHHHCCTTTCCEEEEECSSCSSCCBSTTTTTTHHHHHHHHHHHHHTTCSEEEECSS
T ss_pred             --------------CCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             --------------459999999998753125798699996888654587887666789999999999719759996985


Q ss_pred             E
Q ss_conf             2
Q gi|254780291|r  409 T  409 (475)
Q Consensus       409 H  409 (475)
                      |
T Consensus       317 H  317 (424)
T 2qfp_A          317 H  317 (424)
T ss_dssp             S
T ss_pred             C
T ss_conf             6