BLAST/PSIBLAST alignment of GI: 254780291 and GI: 17228824 at iteration 1
>gi|17228824|ref|NP_485372.1| hypothetical protein alr1329 [Nostoc sp. PCC 7120] Length = 470
>gi|17130676|dbj|BAB73286.1| alr1329 [Nostoc sp. PCC 7120] Length = 470
 Score = 51.6 bits (122), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 100/243 (41%), Gaps = 43/243 (17%)

Query: 178 VEAINSL-KSSKNIILGILTGDMTQSSTTKELKRFYNIY-SLKFPFFRGLGSQEYIGNRP 235
           V ++NSL +   N+   IL GD+T    + +L ++  I+  L  P + GLG+ +Y  N  
Sbjct: 81  VNSVNSLVQQVGNVRGTILNGDITAFGHSWQLDKYKEIWKQLSVPVYPGLGNHDYANN-- 138

Query: 236 CRDPYTLTPSIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYR-NRSWHGETYSIS 294
             D Y        CA   +    + + D      +IK+ N  S  YR + S+        
Sbjct: 139 VDDCYANN-----CAIGMV----EYVRD------AIKKLNPRSFDYRESNSYKFPELRTE 183

Query: 295 ISGSQSYSWNIDNVHFIQA-NYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSE 353
             GS +YSW++ N+HF+Q  NY ++   +              E          +     
Sbjct: 184 YIGSLAYSWDVGNIHFVQMHNYPIYERKF--------------EGFDASAAKRKIVQIKH 229

Query: 354 ISQWIRDDVFQAQREGKYIILFADDIDRF-------SSIDQ-KRMFEKFLTQSKISTIFT 405
              W+  D+ QA+ EGK IIL   D D         ++ +Q K  F   L +  +S +F 
Sbjct: 230 SLDWLEKDLTQARNEGKAIILNYHDSDNNWKNNYAPATYEQLKARFSDILKKYNVSAVFA 289

Query: 406 TRF 408
             +
Sbjct: 290 GHY 292