BLAST/PSIBLAST alignment of GI: 254780291 and GI: 257484869 at iteration 2
>gi|257484869|ref|ZP_05638910.1| VOMI family protein [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 545
>gi|331011105|gb|EGH91161.1| VOMI family protein [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 545
 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 62/347 (17%), Positives = 123/347 (35%), Gaps = 63/347 (18%)

Query: 139 LPHKQNMDIVVDVNKILNCHHKGIAVIADPWYKADTPMFVEAINSLKSSKNIILG----- 193
           LPH+Q+ D+++     +N               +   +     ++++  +   +G     
Sbjct: 70  LPHRQSQDVLLQSRSSVN-------------EVSTEDLIRNQYSAIQKWRAGAMGGTGNN 116

Query: 194 --ILTGDMTQSSTTKELKRFYNIYS--LKFPFFRGLGSQEYIGNRPCRDPYTLTPSIYGC 249
             I+ GDMT     +E    Y      L   ++ GLG+ +Y  N    +         GC
Sbjct: 117 PVIINGDMTAFGHGEERAFLYGTLDSILSTNWYFGLGNHDYKNNIDSCE-------NNGC 169

Query: 250 AFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRSWHGETYSISISGSQSYSWNIDNVH 309
           A  ++ D++ ++              G+   Y          +   SGS +Y  +   V 
Sbjct: 170 ARDSMEDLAGRM-------------GGNRMDYSVNESGFIHTTKKYSGSFAYFKDFGRVR 216

Query: 310 FIQANYSMFHSVYFNDEWSNIFTVAVPEHISKQDLPSHVSNGSEISQWIRDDVFQAQREG 369
           +IQ N    ++      W     V         D+ S V NG     W+ + + QA+  G
Sbjct: 217 YIQLNLDPSYT-----NWFYSSGVWTTNEF---DILSPVENG-----WLENLLIQARDNG 263

Query: 370 KYIILFADDIDRFS------SIDQKRMFEKFLTQSKISTIFTTRFTSSPESYIKDSTGRP 423
            ++I+   D + ++      +      F K L +  +S IF   F     + I  S    
Sbjct: 264 TFVIIGMHDAEEWTRTSDPRTQAILTKFRKLLKEYDVSAIFAGHF--HTAAGIYPSPYEG 321

Query: 424 VRVYNINKNSKNEFILLEMTPHYINVTAYERRGKVPHITRKMSPIDL 470
           V V+     ++  F++ ++      ++ +  R   P   + +    L
Sbjct: 322 VPVFLSGSATEETFLIADIDESSRKISVWLVRNNTPETAQHLGVFPL 368