BLAST/PSIBLAST alignment of GI: 254780291 and GI: 315122852 at iteration 1
>gi|315122852|ref|YP_004063341.1| hypothetical protein CKC_05540 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 494
>gi|313496254|gb|ADR52853.1| hypothetical protein CKC_05540 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 494
 Score =  232 bits (592), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 155/488 (31%), Positives = 258/488 (52%), Gaps = 37/488 (7%)

Query: 3   KTKHLKKTIFLSKKGNITILTAIIIPLIITLITISTTCANILYHRASIEASADEALNHGI 62
           K     K +F SKKGN  +++AI+IP +  L+ I    +N L H+ S+E++++EAL+HG+
Sbjct: 22  KIHFFNKLLFFSKKGNFAMISAIMIPSLALLLGIVLVTSNYLLHKYSVESASEEALSHGM 81

Query: 63  VLLCKDSDLTPQDITPPVLKDLETSLIKNDFSIKEAAQIKKESSINYQGKIPLS---QGT 119
            L+C  +D+   ++   +L DL  SL KN+F+ +EA  + K S I+    I  S   +  
Sbjct: 82  SLICYQNDIERDNLAKIILNDLIVSLKKNNFTKQEADLVAKNSKIDITTLINDSTNVKSY 141

Query: 120 YLNLHAVYHVPLNSLERILLPHKQNMDIVVDVNKILNCHHKGIAVIADP---WYKADTPM 176
           +  + +VY +PLN + +I  P  +++ IV +VNKI+ C +    ++++P    + +D  +
Sbjct: 142 HFYIKSVYKMPLNKITKIFYP--KDLTIVTNVNKIVPCPYTSYVMLSNPRARQFNSDWDL 199

Query: 177 F----VEAINSLKSSKNIILGILTGDMTQSS----TTKELKRFYNIYS-LKFPFFRGLGS 227
                V AINS+ + KNI   I+ G MT        T E+K+F N+Y  L  P FR +G+
Sbjct: 200 IHRRTVNAINSIITDKNIKYMIINGSMTNFDPSHYYTAEVKQFNNVYRHLNVPIFRSIGT 259

Query: 228 QEYIGNRP-CRDPYTLTP-SIYGCAFIAINDISQQINDHYPQIKSIKEFNGDSQRYRNRS 285
           ++Y+ N   CRD   LT  S Y CAF A+ND+S +I + Y     + E N D +R+ +  
Sbjct: 260 RDYVDNNGICRDGDVLTNFSTYSCAFAALNDLSWRIINEYKY--KLPEINYDVKRWIDYC 317

Query: 286 WHGETYSISISGSQSYSWNIDNVHFIQANYSMFHSVYFNDEWSNIFTVAVP-EHISKQDL 344
           +    +   I GS +Y+WN  N+HF+Q N S+F+S +F            P  H    ++
Sbjct: 318 FFQTIH--HIRGSLAYTWNDKNIHFVQLNNSLFYSSHF-----------YPITHEFDCEI 364

Query: 345 PSHVSNGSEISQWIRDDVFQAQREGKYIILFADDIDRFSSIDQKRMFEKFLTQSKISTIF 404
              +  G   + W+  D+ +A++E K IILF D +  F S  Q + F+  L + KI+ +F
Sbjct: 365 EPTMHPGELTASWLEQDLRKARKENKTIILFVDQLHDFYSSSQLQAFKDLLIRHKIAAVF 424

Query: 405 TTRFTSSPESYIKDSTGRPVRVYN--INKNSKNEFILLEMTPHYINVTAYERRGKVPHIT 462
           +       E ++ D+     + YN  +       F+LLE   H ++V  Y    ++  + 
Sbjct: 425 SGLEPGKEEEFVYDNNNHVTKFYNTGVAIPRYGHFMLLENRGHSLDVLIYNTSNRIATLA 484

Query: 463 RKMSPIDL 470
           +KMS I L
Sbjct: 485 KKMSSITL 492