BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780292|ref|YP_003064705.1| 50S ribosomal protein L13 [Candidatus Liberibacter asiaticus str. psy62] (155 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780292|ref|YP_003064705.1| 50S ribosomal protein L13 [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 320 bits (821), Expect = 6e-90, Method: Compositional matrix adjust. Identities = 155/155 (100%), Positives = 155/155 (100%) Query: 1 MIPTFFQKSSEVEKKWILVDAKGLIVGRLASQIALRLRGKNKPTYTPSADDGDHVVIINA 60 MIPTFFQKSSEVEKKWILVDAKGLIVGRLASQIALRLRGKNKPTYTPSADDGDHVVIINA Sbjct: 1 MIPTFFQKSSEVEKKWILVDAKGLIVGRLASQIALRLRGKNKPTYTPSADDGDHVVIINA 60 Query: 61 SKVAFSGKKYDQKTYYRHTGYPGGIKKTTAKEILAGASPTNILKKAIARMLPRGPLARKQ 120 SKVAFSGKKYDQKTYYRHTGYPGGIKKTTAKEILAGASPTNILKKAIARMLPRGPLARKQ Sbjct: 61 SKVAFSGKKYDQKTYYRHTGYPGGIKKTTAKEILAGASPTNILKKAIARMLPRGPLARKQ 120 Query: 121 MKNLHIYAEDHHPHEAQKPVFMDIAKMNPKNSRRT 155 MKNLHIYAEDHHPHEAQKPVFMDIAKMNPKNSRRT Sbjct: 121 MKNLHIYAEDHHPHEAQKPVFMDIAKMNPKNSRRT 155 >gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 225 Score = 22.7 bits (47), Expect = 2.8, Method: Compositional matrix adjust. Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 134 HEAQKPVFMDIAKMNP 149 HE ++ +F+DIA+ P Sbjct: 170 HEKRRQIFLDIARNQP 185 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.133 0.386 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,865 Number of Sequences: 1233 Number of extensions: 3771 Number of successful extensions: 4 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 155 length of database: 328,796 effective HSP length: 67 effective length of query: 88 effective length of database: 246,185 effective search space: 21664280 effective search space used: 21664280 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)