HHsearch alignment for GI: 254780294 and conserved domain: PRK11559

>PRK11559 garR tartronate semialdehyde reductase; Provisional.
Probab=95.88  E-value=0.027  Score=33.44  Aligned_cols=79  Identities=19%  Similarity=0.242  Sum_probs=53.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCC-------CC---HHHHCCCCEEEECCCCHHHHH-HHH---
Q ss_conf             0799975886789999999862997289999653007860-------06---677479989999389837899-999---
Q gi|254780294|r    2 YKIFIDGEHGTTGLKIRSRIVQRKDLCLLSIPCEERHNLR-------YR---EDLLNAADVSILCLPDVASLE-IIQ---   67 (311)
Q Consensus         2 ~kVaIvGATG~vG~~li~lL~~hp~~~l~~l~s~~~ag~~-------~~---~~~~~~~Divf~a~p~~~s~~-~~~---   67 (311)
T Consensus         2 MkIgfIGl-G~MG~~ma~~L~~~-G~~v~v~dr~~~~~~~l~~~Ga~~~~s~~e~~~~~dvvi~~l~~~~~v~~v~~g~~   79 (295)
T PRK11559          2 MKVGFIGL-GIMGKPMSKNLLKA-GYSLVVYDRNPEAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGEN   79 (295)
T ss_pred             CEEEEECC-HHHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHCCCCCCCCHHHHHHCCCEEEEECCCCCCHHHHHHCCC
T ss_conf             78999840-57699999999978-99589992999999999985992039999998438878996689810776630776


Q ss_pred             ---HHHHCCCCEEEECCCCC
Q ss_conf             ---98612584898227630
Q gi|254780294|r   68 ---LIKKNGINSRIIDTSTA   84 (311)
Q Consensus        68 ---~~~~~g~~~~vid~ss~   84 (311)
T Consensus        80 gi~~~~~~g--~iiid~sT~   97 (295)
T PRK11559         80 GIIEGAKPG--TVLIDMSSI   97 (295)
T ss_pred             CCHHCCCCC--CEEEECCCC
T ss_conf             601138999--889989999