>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine. It catalyses the the reduced pyridine nucleotide-dependent reduction of the alpha,beta-unsaturated cyclic imine, dihydrodipicolinate, to generate tetrahydrodipicolinate as shown below : 2,3-dihydrodipicolinate + NAD(P)H = 2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) As this enzyme is not found in mammals it is a potential target for the development of novel antibacterial and herbicidal compounds. The structures of the Escherichia coli (P04036 from SWISSPROT) and Mycobacterium tuberculosis (P72024 from SWISSPROT) enzymes have been determined , . The enzyme is a homotetramer where each monomer is composed of two domains, an N-terminal NAD(P)H-binding domain which forms a Rossman fold, and a C-terminal substrate-binding domain that forms an open, mixed alpha-beta sandwich.Tetramerisation occurs exclusively through interactions between C-terminal domain residues. Both enzymes show relatively little preference for either NADH or NADPH as cofactor. Conformational changes upon substrate binding bring the cofactor and substrate into close proximity and allow catalysis to occur. ; GO: 0008839 dihydrodipicolinate reductase activity, 0009089 lysine biosynthetic process via diaminopimelate, 0005737 cytoplasm.

Probab=94.26 E-value=0.4 Score=26.16 Aligned_cols=124 Identities=18% Similarity=0.254 Sum_probs=74.4 Q ss_pred CCEEEEECCCCHHHHHHHHHHHCC-CCEEEEEEEC---CCCCCCCC-------------CHH-------H--HCCCCEE- Q ss_conf 907999758867899999998629-9728999965---30078600-------------667-------7--4799899- Q gi|254780294|r 1 MYKIFIDGEHGTTGLKIRSRIVQR-KDLCLLSIPC---EERHNLRY-------------RED-------L--LNAADVS- 53 (311) Q Consensus 1 M~kVaIvGATG~vG~~li~lL~~h-p~~~l~~l~s---~~~ag~~~-------------~~~-------~--~~~~Div- 53 (311) T Consensus 1 ~ikvav~GA~GRMG~~~ik~~~~~ye~l~Lv~A~~~~~~~~~G~D~GEl~g~g~~gv~v~~~~~~~~~l~~~~~~~DVli 80 (281) T TIGR00036 1 LIKVAVAGAAGRMGRELIKAVLQAYEGLKLVAAFERHGSSLQGTDIGELAGIGKVGVPVTDDLEAVLVLAFTETKPDVLI 80 (281) T ss_pred CCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEE T ss_conf 98358847887346999999997489816788886168885665420242255478410005788999874023686478 Q ss_pred EECCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCCHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHC Q ss_conf 99389837899999986125848982276303555431100210004776520496077258421133112478888850 Q gi|254780294|r 54 ILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCYATGAIAILRPLRKAK 133 (311) Q Consensus 54 f~a~p~~~s~~~~~~~~~~g~~~~vid~ss~~R~~~~vpl~vPEvN~~~~~~~~~~~iIanPnC~~t~~~laL~PL~~~~ 133 (311) T Consensus 81 DFT~p~g~~-~~~~~a~~~Gv~-~V~GTTG-f~e~~~-----~~~~~--~a~~~~~~~v~A~NF-a~GV~~~~K~~~~aA 149 (281) T TIGR00036 81 DFTTPEGVV-ENVKIALENGVR-LVVGTTG-FSEEDL-----QELRD--LAEKKGVAAVIAPNF-AIGVNLMFKLLEKAA 149 (281) T ss_pred ECCCCHHHH-HHHHHHHHCCCE-EEECCCC-CCHHHH-----HHHHH--HHHHCCCCEEEECCC-HHHHHHHHHHHHHHH T ss_conf 738605678-999999966885-5771668-998999-----99999--998649978984650-689999999999998 Q ss_pred CC Q ss_conf 34 Q gi|254780294|r 134 LL 135 (311) Q Consensus 134 ~i 135 (311) T Consensus 150 ~~ 151 (281) T TIGR00036 150 KY 151 (281) T ss_pred HH T ss_conf 76

HHsearch alignment for GI: 254780294 and conserved domain: TIGR00036