>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are bacterial MDHs, and plant MDHs localized to the choloroplasts. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

Probab=96.86 E-value=0.0047 Score=38.13 Aligned_cols=56 Identities=16% Similarity=0.241 Sum_probs=37.7 Q ss_pred CEEEEECCCCHHHHHHHHHHHCC------CCEEEEEEECCCCC----CCCCC------------------HHHHCCCCEE Q ss_conf 07999758867899999998629------97289999653007----86006------------------6774799899 Q gi|254780294|r 2 YKIFIDGEHGTTGLKIRSRIVQR------KDLCLLSIPCEERH----NLRYR------------------EDLLNAADVS 53 (311) Q Consensus 2 ~kVaIvGATG~vG~~li~lL~~h------p~~~l~~l~s~~~a----g~~~~------------------~~~~~~~Div 53 (311) T Consensus 3 ~KV~IiGAaG~IG~~la~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~amDl~~~a~~~~~~v~~~~~~~~a~~~aDvV 82 (322) T cd01338 3 VRVAVTGAAGQIGYSLLFRIASGEMFGPDQPVILQLLELPQALKALEGVAMELEDCAFPLLAEIVITDDPNVAFKDADWA 82 (322) T ss_pred EEEEEECCCCHHHHHHHHHHHHCHHCCCCCEEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEEECCHHHHHCCCCEE T ss_conf 09999899968999999999711130799726999975757566676577445326765458779748878983788789 Q ss_pred EECC Q ss_conf 9938 Q gi|254780294|r 54 ILCL 57 (311) Q Consensus 54 f~a~ 57 (311) T Consensus 83 vita 86 (322) T cd01338 83 LLVG 86 (322) T ss_pred EEEC T ss_conf 9936

HHsearch alignment for GI: 254780294 and conserved domain: cd01338