HHsearch alignment for GI: 254780295 and conserved domain: COG0101

>COG0101 TruA Pseudouridylate synthase [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=0  Score=568.67  Aligned_cols=244  Identities=46%  Similarity=0.722  Sum_probs=239.5

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCCCHHHHHHHH
Q ss_conf             92299999971668720048753877889999999997099569997112138612223468864063211046899999
Q gi|254780295|r    1 MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALN   80 (247)
Q Consensus         1 M~r~~~~i~YdGt~y~G~q~Q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~f~~~~~~~~~~~~~~lN   80 (247)
T Consensus         1 m~ri~l~iaYdGt~f~G~Q~Qp~~~TVQ~~le~aL~~i~~~~~~i~~AGRTD~GVHA~gqv~hfd~~~~~~~~~~~~~lN   80 (266)
T COG0101           1 MKRIALKIAYDGTRFHGWQRQPNVRTVQGELEKALSKIGGESVRVIGAGRTDAGVHALGQVVHFDTPADRPLEKLVRALN   80 (266)
T ss_pred             CCEEEEEEEECCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             93299999985872002502899998899999999996287641688667875766255579997677655899999998


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCEECCCCEEEEEEEEECCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHEEEECC
Q ss_conf             86188876543443226777550002100223556852443202333210244333335665565676520011001024
Q gi|254780295|r   81 AYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRS  160 (247)
Q Consensus        81 ~~L~~p~~Irv~~~~~v~~~FhaR~~a~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~lD~~~l~~a~~~l~G~HdF~~F~~  160 (247)
T Consensus        81 ~~L--p~dI~V~~~~~v~~~FhaRfsa~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~ld~~~m~~aa~~l~G~HDF~sF~~  158 (266)
T COG0101          81 ALL--PPDIRVLDVAEVPDDFHARFSAKSRTYRYIIYNAPLRPPFLANYVWHVPYPLDLDAMREAAKLLLGTHDFTSFRK  158 (266)
T ss_pred             HCC--CCCCEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             319--988489998877999887504262689999757667886661322014676789999999987234445311025


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             56553332110331111233320011315888899999999999999976899888999998358821166636989847
Q gi|254780295|r  161 IHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY  240 (247)
Q Consensus       161 ~~~~~~~~~R~I~~~~v~~~~~~i~i~i~g~~FL~~mVR~mVG~li~v~~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (247)
T Consensus       159 ~~~~~~s~vRti~~~~v~~~~~~i~i~i~g~sFL~~mVR~iVg~l~~vg~g~~~~~~i~~ll~~~~r~~~~~~Apa~GL~  238 (266)
T COG0101         159 AGCQSKSPVRTIYRIDVSRDGDLIVIDISGNSFLWHMVRNIVGALLLVGRGKRPVEWIKELLEAKDRKLAGPTAPAEGLY  238 (266)
T ss_pred             CCCCCCCCEEEEEEEEEEECCCEEEEEEEECHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
T ss_conf             78846897699999999963998999999575589999999999999858999999999987523844477888987308


Q ss_pred             EEEEEE
Q ss_conf             633043
Q gi|254780295|r  241 FDSVEY  246 (247)
Q Consensus       241 L~~V~Y  246 (247)
T Consensus       239 L~~v~Y  244 (266)
T COG0101         239 LVRVDY  244 (266)
T ss_pred             EEEECC
T ss_conf             974204