HHsearch alignment of GI: 254780295 and MMDB domain: 1dj0_A_

>1dj0_A (A:) Pseudouridine synthase I; alpha/beta fold, RNA-binding motif, RNA-modifying enzyme, lyase; 1.50A {Escherichia coli}
Probab=100.00  E-value=0  Score=539.25  Aligned_cols=245  Identities=37%  Similarity=0.573  Sum_probs=241.3

Q ss_pred             CCEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEEEECCCCCCHHHHHHHH
Q ss_conf             92299999971668720048753877889999999997099569997112138612223468864063211046899999
Q gi|254780295|r    1 MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFDLVREWVPVILCKALN   80 (247)
Q Consensus         1 M~r~~~~i~YdGt~y~G~q~Q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~f~~~~~~~~~~~~~~lN   80 (247)
                      |+||++.|+||||+|+|||+||+.+|||++||+||.++.++++.+.+|||||+||||++|++||+++.++++..+...||
T Consensus         3 ~~~~~l~i~Y~Gt~f~G~q~q~~~~TVq~~le~aL~~~~~~~~~~~~a~RTD~GVhA~~qv~~~~~~~~~~~~~~~~~lN   82 (264)
T 1dj0_A            3 VYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVN   82 (264)
T ss_dssp             CEEEEEEEEECCTTSSCSCCTTCSSCHHHHHHHHHHHHHTSCCCEEESSCCCTTCEEEEEEEEEEESCCCCHHHHHHHHH
T ss_pred             CEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             57999999997997014727889989999999999996399807997055667815555379986265457499999998


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCEECCCCEEEEEEEEECCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHEEEECC
Q ss_conf             86188876543443226777550002100223556852443202333210244333335665565676520011001024
Q gi|254780295|r   81 AYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRS  160 (247)
Q Consensus        81 ~~L~~p~~Irv~~~~~v~~~FhaR~~a~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~lD~~~l~~a~~~l~G~HdF~~F~~  160 (247)
                      +.|  |+||+|+++.+|+++||||++|++|+|+|+++.+..++++.+++.|+....+|+++|++||+.|+|+|||++||+
T Consensus        83 ~~L--p~dI~v~~~~~v~~~F~aR~~~~~R~Y~Y~i~~~~~~~~~~~~~~~~~~~~ld~~~m~~a~~~~~G~HDF~~F~~  160 (264)
T 1dj0_A           83 ANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRA  160 (264)
T ss_dssp             HTS--CTTEEEEEEEECCTTCCTTTTCCEEEEEEEEECSSSCCCTTTTSSEECCSCCCHHHHHHHHGGGCEEEECGGGCC
T ss_pred             HCC--CCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCHHHCCCEEEECCCCCHHHHHHHHHHCCCCCCCEEEEC
T ss_conf             239--977289489988987776434760599999767877985672844675366799999999987538666378853


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             56553332110331111233320011315888899999999999999976899888999998358821166636989847
Q gi|254780295|r  161 IHCQASSPIRTIDHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY  240 (247)
Q Consensus       161 ~~~~~~~~~R~I~~~~v~~~~~~i~i~i~g~~FL~~mVR~mVG~li~v~~g~~~~~~i~~~L~~~~r~~~~~~APa~GL~  240 (247)
                      .+.+.++++|+|.++++.+..+.+.|+|+|+||||||||+|||+++++|+|++++++|.++|+++++...+++|||+||+
T Consensus       161 ~~~~~~~~~r~i~~~~~~~~~~~~~~~i~g~sFL~~qVR~mvg~li~vg~g~~~~~~i~~~L~~~~~~~~~~~APa~GL~  240 (264)
T 1dj0_A          161 VQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLY  240 (264)
T ss_dssp             TTCCCSCCEEEEEEEEEEEETTEEEEEEEESCCCTTHHHHHHHHHHHHHTTSSCTTHHHHHHHHCCGGGSCCCCCSTTEE
T ss_pred             CCCCCCCCEEEEEEEEEEEECCEEEEEEEECHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCE
T ss_conf             69999997699999999951999999999765889999999999999987999999999998568866687767898767


Q ss_pred             EEEEEEC
Q ss_conf             6330439
Q gi|254780295|r  241 FDSVEYS  247 (247)
Q Consensus       241 L~~V~Y~  247 (247)
                      |++|.|.
T Consensus       241 L~~v~y~  247 (264)
T 1dj0_A          241 LVAVDYP  247 (264)
T ss_dssp             EEEEECC
T ss_pred             EEECCCC
T ss_conf             8001479