BLAST/PSIBLAST alignment of GI: 254780295 and GI: 86356072 at iteration 1
>gi|86356072|ref|YP_467964.1| tRNA pseudouridine synthase A [Rhizobium etli CFN 42] Length = 267
>gi|86280174|gb|ABC89237.1| tRNA pseudouridine synthase A protein [Rhizobium etli CFN 42] Length = 267
 Score =  332 bits (850), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 193/247 (78%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V V GAGRTDSGVHA+ Q
Sbjct: 1   MPRYRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSVRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKIS-DTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL +EW P  L  ALNA+L+++ + +SIL+++ V + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKEWSPYQLQNALNAHLRLAGERVSILDVAAVPEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK+LD E M  AAQ LVGRHDF+TFRS HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKTLDDEVMHAAAQRLVGRHDFSTFRSAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 SGALIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFLQVDY 247