BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780295|ref|YP_003064708.1| tRNA pseudouridine synthase A
[Candidatus Liberibacter asiaticus str. psy62]
         (247 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|154505512|ref|ZP_02042250.1| hypothetical protein RUMGNA_03049 [Ruminococcus gnavus ATCC 29149]
 gi|153794170|gb|EDN76590.1| hypothetical protein RUMGNA_03049 [Ruminococcus gnavus ATCC 29149]
          Length = 246

 Score =  211 bits (537), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +++  + +A+  +TGE + V GA RTDSGVHAL  
Sbjct: 1   MKRLKLTVAYDGTNYCGWQIQPNGITVEEVLNRALRKLTGEEITVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P  +  ALN  L   D I ++    V   +H R+   +++Y Y I+  +
Sbjct: 61  VAVFDSETSIPPERISYALNQRL--PDDIVVIRSEEVSADWHPRYCNSKKTYEYHILNAK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +   + +   LD E M+ AAQ+LVG HDF +F ++       +RTI   D+   
Sbjct: 119 IPDPTRRLTRYFVSFDLDIEKMKKAAQYLVGTHDFVSFCNVRTDVEDTVRTIYSLDILPV 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I IR+    FL+  +R  VG+L  VG G +T   +++ L+A++RK  G  APP+GL+
Sbjct: 179 GDEITIRIQGNGFLYNMVRIIVGTLVRVGRGFYTPEQVQEILEAKNRKAAGVTAPPQGLF 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LVGIEY 244


>gi|125975420|ref|YP_001039330.1| tRNA pseudouridine synthase A [Clostridium thermocellum ATCC 27405]
 gi|256005284|ref|ZP_05430250.1| tRNA pseudouridine synthase A [Clostridium thermocellum DSM 2360]
 gi|281419381|ref|ZP_06250396.1| tRNA pseudouridine synthase A [Clostridium thermocellum JW20]
 gi|166991160|sp|A3DJK8|TRUA_CLOTH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|125715645|gb|ABN54137.1| tRNA pseudouridine synthase A [Clostridium thermocellum ATCC 27405]
 gi|255990720|gb|EEU00836.1| tRNA pseudouridine synthase A [Clostridium thermocellum DSM 2360]
 gi|281407001|gb|EFB37264.1| tRNA pseudouridine synthase A [Clostridium thermocellum JW20]
 gi|316939545|gb|ADU73579.1| tRNA pseudouridine synthase A [Clostridium thermocellum DSM 1313]
          Length = 244

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 96/246 (39%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQ+QKN  ++Q +IE+AI  +TGE V + GA RTD GVHAL Q
Sbjct: 1   MRNVKLIIEYDGTNYHGWQKQKNAKTVQDTIERAIKGLTGEKVDLIGASRTDFGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN  L   D I I     VD  FHAR+ A  + Y Y I   Q
Sbjct: 61  VANFITNSGIPGDRFSYALNRML--PDDIVIKESQEVDMDFHARYKAKGKRYRYLIYNSQ 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P AL + R + +   LD E+M+ AA + +G HDF+ FRS    A + +RTI    +   
Sbjct: 119 FPSALLRHRTYHVSHKLDFESMQRAASYFLGTHDFSAFRSSGSSAKTSVRTITDVSLERE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
             +++  +    FL+  +R  VG+L  VG GK  + ++ + ++++ RK  G  AP EGLY
Sbjct: 179 DKIVKFEIAGDGFLYNMVRIIVGTLMEVGIGKIRADEIPQIIESRKRKRAGRTAPAEGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVEVYY 244


>gi|210618029|ref|ZP_03291864.1| hypothetical protein CLONEX_04097 [Clostridium nexile DSM 1787]
 gi|210149022|gb|EEA80031.1| hypothetical protein CLONEX_04097 [Clostridium nexile DSM 1787]
          Length = 245

 Score =  210 bits (534), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I Y+G+ Y GWQ Q NG +++  + KA+  +TGE + V GA RTDSGVHAL  
Sbjct: 1   MKRIKLTIAYDGTNYCGWQVQPNGITVEEVVNKALKKLTGEDIQVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P  +  ALN  L   + I I+    V + FH R+    ++Y Y I+  +
Sbjct: 61  VAVFDTHTTIPPERISYALNQRL--PEDIVIVKSEEVAEDFHPRYCDCSKTYEYHILNMR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  ++   + +   LD E MR AA +L+G HDF +F ++       +RT+   ++   
Sbjct: 119 IPIPTKRLTNYFVSYDLDVEKMRKAAGYLIGEHDFVSFCNVRTDVEDTVRTVTELEILKD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I IR+    FL+  +R  VG+L  VG G +    +++ L+A+DRK  G  APP GL 
Sbjct: 179 GEEITIRISGNGFLYNMVRIIVGTLIRVGRGFYEPEKVKEILEAKDRKAAGVTAPPHGLI 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LAEIRY 244


>gi|331091743|ref|ZP_08340575.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330402642|gb|EGG82209.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 245

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 86/247 (34%), Positives = 133/247 (53%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I Y+G+ Y GWQ Q NG +I+  + KA+  +TGE +VV GA RTDSGVHA+  
Sbjct: 1   MRRVKLTIAYDGTNYCGWQIQPNGITIEEIVNKALSKLTGEKIVVIGASRTDSGVHAMGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P  +  A+N  L   + I ++    V   FH R+    ++Y Y I+  +
Sbjct: 61  VAVFDTETTIPPERVAMAVNRIL--PEDIVVVKSEEVPLDFHPRYCDCEKTYEYHIVNTR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  ++   + +   LD + MR  A +L+G HDF +F +I     S +RT+   ++   
Sbjct: 119 IPIPTKRLTNYFVSYELDLDKMREGASYLIGEHDFASFCNIKTDVESTVRTVKELEILEN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I IR+    FL+  +R  VG+L  VG G +    +++ L+A++RK  G  APP GL 
Sbjct: 179 GEEITIRISGNGFLYNMVRIIVGTLIRVGRGFYEPVQVKEILEAKNRKAAGVTAPPHGLM 238

Query: 241 FDSVEYS 247
              + Y+
Sbjct: 239 LMEIRYN 245


>gi|83309340|ref|YP_419604.1| pseudouridylate synthase [Magnetospirillum magneticum AMB-1]
 gi|123768092|sp|Q2WAT0|TRUA_MAGSA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|82944181|dbj|BAE49045.1| Pseudouridylate synthase [Magnetospirillum magneticum AMB-1]
          Length = 256

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 123/247 (49%), Positives = 170/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G+ + GWQRQ  G S+QG +EKA+  + G    +H AGRTD+GVHA  Q
Sbjct: 1   MPRYRLLVEYDGTPFNGWQRQDKGLSVQGILEKAVEKLCGVPCTLHAAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R++    +  ALN ++K    ++++   +VD+ FHARFSA+ R+YLYRI+ R+
Sbjct: 61  VAHVDLPRDYPADTVRDALNYHMK-PKPVAVVAAELVDEDFHARFSAVGRAYLYRIVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLAL++ RAW +P +LD E M   A+ L+G HDF+TFR+  CQA SP++T+D  DV   
Sbjct: 120 APLALDQHRAWWVPVALDAEAMAEGARRLLGHHDFSTFRASECQAKSPMKTLDVLDVTRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I I   ARSFLH Q+R+ VG+LKLVG+GKW+  D+ K L+A+DR + GP AP  GL 
Sbjct: 180 GEEIRIVAEARSFLHHQVRNMVGTLKLVGEGKWSPDDMAKVLEARDRTKGGPTAPAAGLV 239

Query: 241 FDSVEYS 247
              V YS
Sbjct: 240 LTGVSYS 246


>gi|304315974|ref|YP_003851119.1| tRNA pseudouridine synthase A [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777476|gb|ADL68035.1| tRNA pseudouridine synthase A [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 248

 Score =  208 bits (528), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    ++IEY+G+ Y GWQ QKN  +IQ +I KAI  +T E V + G+ RTD+GVHAL Q
Sbjct: 5   MRNIVLVIEYDGTNYHGWQIQKNVVTIQETITKAIKKITNEDVDLIGSSRTDAGVHALHQ 64

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F          +  ALN+ L     I I +    D  FH+R+SA  + Y Y I  R+
Sbjct: 65  VANFKTCTNIPTSKIPNALNSVL--PADIVIKDAFEADMDFHSRYSAKGKRYKYIIYNRR 122

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               + K  +W I KSLD E MR + ++L G HDF+ F++      SP+RT+    +   
Sbjct: 123 FSSPILKNYSWHISKSLDVEKMRESLKYLEGTHDFSAFKASGSSVKSPVRTVRDISLKKN 182

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  +E  + A  FL+  +R  VG++  VG GK    D+++ L +++R   G  APP+GL+
Sbjct: 183 GFNVEFEIEADGFLYNMVRIIVGTIVDVGLGKINPIDVKEILDSKNRCMAGKTAPPQGLF 242

Query: 241 FDSVEY 246
              + Y
Sbjct: 243 LTKIYY 248


>gi|15964174|ref|NP_384527.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti 1021]
 gi|307301319|ref|ZP_07581081.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti BL225C]
 gi|30913403|sp|Q92SH4|TRUA_RHIME RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|15073350|emb|CAC41858.1| Probable tRNA pseudouridine synthase A [Sinorhizobium meliloti
           1021]
 gi|306903775|gb|EFN34362.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti BL225C]
          Length = 247

 Score =  208 bits (528), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 155/247 (62%), Positives = 185/247 (74%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+GS Y GWQRQ NG S+QG+IEKA+  +T E V + GAGRTDSGVHA  Q
Sbjct: 1   MPRYRLTVEYDGSDYVGWQRQDNGPSVQGAIEKAVLSLTRETVSIRGAGRTDSGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL REW    L  ALNA+L    + +SIL+++     F ARFSAIRR YLYRII+R
Sbjct: 61  VAHLDLTREWKSYTLQNALNAHLALAGERVSILDVAEAPGDFDARFSAIRRHYLYRIISR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++PLALE  RAW +PK LD + M  AAQ LVG HDFTTFRS HCQA+SP+RT+D  DV  
Sbjct: 121 RSPLALEARRAWWVPKPLDHDAMHEAAQRLVGHHDFTTFRSAHCQATSPLRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF GSLKLVG+GKWT  DL+ AL+A+DRK CGP+APP+GL
Sbjct: 181 AGELIEIRATAQSFLHNQIRSFAGSLKLVGEGKWTPDDLQAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMRVDY 247


>gi|260589149|ref|ZP_05855062.1| tRNA pseudouridine synthase A [Blautia hansenii DSM 20583]
 gi|331082565|ref|ZP_08331690.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540569|gb|EEX21138.1| tRNA pseudouridine synthase A [Blautia hansenii DSM 20583]
 gi|330400543|gb|EGG80173.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 245

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG ++Q  + + +   TGE +   GA RTD+GVHAL  
Sbjct: 1   MKRVKLTVAYDGTNYCGWQVQPNGITVQEVLNQCLSEFTGENIETIGASRTDAGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN  L   + I I     VD  FH R+   +++Y YRI+  +
Sbjct: 61  VAVFDTEMRMPGDKFSFALNQRL--PEDIRIQKSEEVDADFHPRYVKSQKTYEYRILNCR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  E+  +      LD + M+ AA +L+G HDF +F     Q  + +RT+    +   
Sbjct: 119 FPIPTERFYSHFTYIPLDVDKMKEAASYLIGEHDFKSFCGTGAQVKTTVRTVKEIQIEKS 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I IR+    FL+  +R   G+L  +G G +    +++ L+A+DRK+ GP AP  GL 
Sbjct: 179 GDRITIRITGEGFLYNMVRIIAGTLMDIGGGLYPPEKMKEILEAKDRKKAGPTAPARGLT 238

Query: 241 FDSVEY 246
              ++Y
Sbjct: 239 LMKIQY 244


>gi|307317990|ref|ZP_07597427.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti AK83]
 gi|306896392|gb|EFN27141.1| tRNA pseudouridine synthase A [Sinorhizobium meliloti AK83]
          Length = 247

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 155/247 (62%), Positives = 185/247 (74%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+GS Y GWQRQ NG S+QG+IEKA+  +T E V + GAGRTDSGVHA  Q
Sbjct: 1   MPRYRLTVEYDGSDYVGWQRQDNGPSVQGAIEKAVLSLTRETVSIRGAGRTDSGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL REW    L  ALNA+L    + +SIL+++     F ARFSAIRR YLYRII+R
Sbjct: 61  VAHLDLTREWKSYTLQNALNAHLALAGERVSILDVAEAPGDFDARFSAIRRHYLYRIISR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++PLALE  RAW +PK LD + M  AAQ LVG HDFTTFRS HCQA+SP+RT+D  DV  
Sbjct: 121 RSPLALEARRAWWVPKPLDHDAMHEAAQRLVGHHDFTTFRSAHCQATSPLRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF GSLKLVG+GKWT  DL+ AL+A+DRK CGP+APP+GL
Sbjct: 181 AGELIEIRATAQSFLHNQIRSFAGSLKLVGEGKWTPDDLQAALKARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMRVDY 247


>gi|254780295|ref|YP_003064708.1| tRNA pseudouridine synthase A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254039972|gb|ACT56768.1| tRNA pseudouridine synthase A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 247

 Score =  207 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 247/247 (100%), Positives = 247/247 (100%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ
Sbjct: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ
Sbjct: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF
Sbjct: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY
Sbjct: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240

Query: 241 FDSVEYS 247
           FDSVEYS
Sbjct: 241 FDSVEYS 247


>gi|154483152|ref|ZP_02025600.1| hypothetical protein EUBVEN_00853 [Eubacterium ventriosum ATCC
           27560]
 gi|149735960|gb|EDM51846.1| hypothetical protein EUBVEN_00853 [Eubacterium ventriosum ATCC
           27560]
          Length = 246

 Score =  205 bits (522), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 133/247 (53%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +II Y+G+ Y GWQ Q NG +++  + KA+  +  E + V GA RTDSGVHA+  
Sbjct: 1   MKRVRLIIAYDGTNYCGWQVQINGITVEEVLNKALKDLLNEEIAVIGASRTDSGVHAMGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  ALN  L   + I I     V   +H R+    ++Y Y+I+ R+
Sbjct: 61  VAVFDTETRIPAEKISFALNQRL--PNDIRIQKSDEVPLDWHPRYRDSTKTYEYKILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  L++     +   LD + M+ AA+++VG HDF +F S   Q  S +RT+    VN  
Sbjct: 119 FPDPLQRFYTHFMYMPLDEQKMKEAAEYIVGEHDFASFCSAGSQVDSTVRTVYSLSVNKR 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            ++I IR+    FL+  +R  VG+L  VG G +    +++ ++A+DR   GP AP  GL 
Sbjct: 179 DDVISIRITGNGFLYNMVRIIVGTLIKVGLGVYPPEHVKEIIEAKDRYVAGPKAPACGLT 238

Query: 241 FDSVEYS 247
              +EYS
Sbjct: 239 LVGIEYS 245


>gi|71280165|ref|YP_270466.1| tRNA pseudouridine synthase A [Colwellia psychrerythraea 34H]
 gi|123760979|sp|Q47XK4|TRUA_COLP3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|71145905|gb|AAZ26378.1| tRNA pseudouridine synthase A [Colwellia psychrerythraea 34H]
          Length = 259

 Score =  205 bits (521), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 142/245 (57%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY + IEY+G  Y GWQRQ N  ++Q  +EKA+  +  E + V  AGRTD+GV+A  QV
Sbjct: 1   MRYALGIEYDGKNYCGWQRQNNVITVQEKLEKALSKIADEKIEVVCAGRTDTGVNATNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD  ++         +N +L     +++  +  VD  FHARFSA  R+Y Y I  +  
Sbjct: 61  IHFDTEKKRKDTAWTLGVNTHL--PSDVAVAWVKKVDDDFHARFSATARNYRYIIYNKPL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+          +LD   M+  A +L+G+HDFT+FR++HCQ+ S +RTI H  V   G
Sbjct: 119 RSAILSHGISHCHFALDENLMQQGADYLLGKHDFTSFRTVHCQSHSAVRTIKHCRVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + + + A +FLH  +R+ VGSL  VG  + T   +++ L A++R   G  APPEGLYF
Sbjct: 179 DYLVVDIKANAFLHHMVRNVVGSLMRVGQSQETPHWMKEVLLAKNRCVAGVTAPPEGLYF 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|325662523|ref|ZP_08151126.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471219|gb|EGC74444.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 249

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  + I Y+G+ Y GWQ Q NG +++  I KA+  +TGE + V GA RTDSGVHAL  V
Sbjct: 4   KRIKLTIAYDGTNYCGWQVQPNGITVEEVINKALCKLTGEDIAVIGASRTDSGVHALGNV 63

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A FD      P  +  ALN  L   D I I+    V   FH R+    ++Y Y II  + 
Sbjct: 64  AVFDSATSIPPERIAMALNQRL--PDDIVIVKSEEVAPDFHPRYCDCEKTYEYHIINTRT 121

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P+  ++   + +   LD E M+ AA +LVG HDF +F ++  Q    +RT+   +V   G
Sbjct: 122 PIPTKRLTNYFVSYDLDVERMQQAADYLVGEHDFVSFCNVRTQVEDTVRTVTELEVLREG 181

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I IR+    FL+  +R  VG+L  VG G +T   +++ L+A+DRK  G  AP  GL  
Sbjct: 182 EEITIRISGNGFLYNMVRIIVGTLVRVGRGFYTPEKVKEILEAKDRKAAGVTAPAHGLML 241

Query: 242 DSVEY 246
             + Y
Sbjct: 242 VEIRY 246


>gi|145299467|ref|YP_001142308.1| tRNA pseudouridine synthase A [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166228677|sp|A4SNT8|TRUA_AERS4 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|142852239|gb|ABO90560.1| tRNA pseudouridine synthase A [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 269

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ+   S+Q  +EKA+  +    V +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSRYFGWQRQREVISVQAELEKALSRIANHPVSIQCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             LN+ L     I++  +  VD+ FHARFSA  R Y Y I     
Sbjct: 61  IHFDTHAIRSESAWTLGLNSNL--PPDIAVRWVKEVDETFHARFSATARRYRYVIYNHNY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         +++D   M +A Q L+G  DFT+FR+I CQ+ +P R + H  V+  G
Sbjct: 119 RPAILGSGVSHYHETIDAALMHLAGQCLLGEQDFTSFRAIGCQSKTPWRNVTHLCVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+  GSL LVG G      + + L A+DR + GP A   GLY 
Sbjct: 179 PYIVLDIRANAFLHHMVRNITGSLLLVGQGLKPVEWIAELLAAKDRNQAGPTAKAGGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|296131870|ref|YP_003639117.1| tRNA pseudouridine synthase A [Thermincola sp. JR]
 gi|296030448|gb|ADG81216.1| tRNA pseudouridine synthase A [Thermincola potens JR]
          Length = 246

 Score =  205 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 92/248 (37%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQ--KNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    M IEY+G+ Y G+Q+Q  +N  +IQ ++EKA+  +TGE + V GAGRTD+GVHAL
Sbjct: 1   MRNIKMTIEYDGTSYHGFQKQADQNLPTIQEALEKALRKLTGEEISVTGAGRTDAGVHAL 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            QV +F            +ALN+ L   + I   +       FHA+F A +++Y Y I  
Sbjct: 61  GQVINFYTESSIPTGNFVRALNSVL--PEDIVAKDAVEAPGDFHAQFWAKKKTYRYTIFN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P    +  +  +P  L+ +NMR AA  LVG+HDF+ FR+    A S IRT+   +V 
Sbjct: 119 DTVPSVFYRRYSLFVPCKLNVDNMRKAASFLVGQHDFSAFRAAGSTARSSIRTMYRAEVE 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G LI + + A  FL+  +R   G+L  +G GK    +++  + + DR   GP  PP+G
Sbjct: 179 QEGELIHVYLEANGFLYNMVRIITGTLLYIGQGKLRVEEMKDIIASGDRTLAGPTVPPQG 238

Query: 239 LYFDSVEY 246
           L    VEY
Sbjct: 239 LCLMRVEY 246


>gi|331086292|ref|ZP_08335372.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406058|gb|EGG85581.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 249

 Score =  205 bits (520), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  + I Y+G+ Y GWQ Q NG +++  I KA+  +TGE + V GA RTDSGVHAL  V
Sbjct: 4   KRIKLTIAYDGTNYCGWQVQPNGITVEEVINKALCKLTGEDIAVIGASRTDSGVHALGNV 63

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A FD      P  +  ALN  L   D I I+    V   FH R+    ++Y Y II  + 
Sbjct: 64  AVFDSATSIPPERIAMALNQRL--PDDIVIVKSEEVATDFHPRYCDCEKTYEYHIINTRT 121

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P+  ++   + +   LD E M+ AA +LVG HDF +F ++  Q    +RT+   +V   G
Sbjct: 122 PIPTKRLTNYFVSYDLDVERMQQAADYLVGEHDFVSFCNVRTQVEDTVRTVTELEVLREG 181

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I IR+    FL+  +R  VG+L  VG G +T   +++ L+A+DRK  G  AP  GL  
Sbjct: 182 EEITIRISGNGFLYNMVRIIVGTLVRVGRGFYTPEKVKEILEAKDRKAAGVTAPAHGLML 241

Query: 242 DSVEY 246
             + Y
Sbjct: 242 VEIRY 246


>gi|254228474|ref|ZP_04921900.1| tRNA pseudouridine synthase A [Vibrio sp. Ex25]
 gi|262393647|ref|YP_003285501.1| tRNA pseudouridine synthase A [Vibrio sp. Ex25]
 gi|151939062|gb|EDN57894.1| tRNA pseudouridine synthase A [Vibrio sp. Ex25]
 gi|262337241|gb|ACY51036.1| tRNA pseudouridine synthase A [Vibrio sp. Ex25]
          Length = 264

 Score =  205 bits (520), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+   S+Q  +EKA+ ++    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTNYFGWQRQREVKSVQEELEKALSVIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA   +   I++     V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVTRKMVAWTMGANAN--MPSDIAVRWAKEVPDDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DFT+FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDEKKMHEAGQYLLGENDFTSFRAAHCQSRSPFRNLMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + I + A +F+H  +R+  GSL  VG G+ +   ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 NYVVIDIKANAFVHHMVRNITGSLIKVGRGEESPEWIKWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|295109363|emb|CBL23316.1| pseudouridylate synthase I [Ruminococcus obeum A2-162]
          Length = 246

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 133/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q NG +IQG +  A+  + GE + + GA RTD+GVHAL  
Sbjct: 1   MKRVGLVVAYDGTNYSGWQIQPNGITIQGVLNDALSDLLGEKIEIMGASRTDAGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  ALN  L   + I I     V+  FH R+    ++Y YRI+ R+
Sbjct: 61  VAVFDTNTRIPGEKISYALNQRL--PEDIRIQLSEEVEPDFHPRYCDSEKTYEYRILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  E+  ++     LD E MR A  +L+GRHDF +F     Q  S +RTI   DV   
Sbjct: 119 FPVPTERLYSYFYHYKLDIEKMREATSYLIGRHDFASFCGTGAQVKSTVRTITGIDVWRD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+++ IRV    FL+  +R   G+L  VG+G++    ++K L A DR   GP AP  GL 
Sbjct: 179 GDIVTIRVKGEGFLYNMVRIIAGTLIQVGNGQYPPERVKKILDACDRSVSGPTAPAHGLT 238

Query: 241 FDSVEY 246
              +E+
Sbjct: 239 LMGIEF 244


>gi|146296772|ref|YP_001180543.1| tRNA pseudouridine synthase A [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|166228689|sp|A4XKB7|TRUA_CALS8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|145410348|gb|ABP67352.1| tRNA pseudouridine synthase A [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 244

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ YFGWQ+Q N  ++QG IE AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTNYFGWQKQPNKKTVQGVIEDAIKKITGEDVNLVGSGRTDRGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L   + ISI + + V   F AR+SA +++Y Y I   +
Sbjct: 61  KANFKTESKIPTEKFPLALNSVL--PNDISIKDAAEVSLDFSARYSAKQKTYKYLIYNHK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+     +  P  LD  +M+ + ++ +G +DF++F S   + +S +R I    +   
Sbjct: 119 FRPAILCNYVYHFPYELDLVSMQKSCEYFIGEYDFSSFCSSGSETNSKVRRIFDCYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I I + A  FL+   R   G++  VG G++  TD+   ++++DR + G   PP GLY
Sbjct: 179 NDCIAIYITANGFLYNMARIIAGTILDVGVGRFKPTDIPLIIESKDRTKAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|91223605|ref|ZP_01258870.1| tRNA pseudouridine synthase A [Vibrio alginolyticus 12G01]
 gi|269966027|ref|ZP_06180119.1| tRNA pseudouridine synthase A [Vibrio alginolyticus 40B]
 gi|91191691|gb|EAS77955.1| tRNA pseudouridine synthase A [Vibrio alginolyticus 12G01]
 gi|269829423|gb|EEZ83665.1| tRNA pseudouridine synthase A [Vibrio alginolyticus 40B]
          Length = 264

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+   S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTNYFGWQRQREVKSVQEELEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA   +   I++     V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVTRKMVAWTMGANAN--MPSDIAVRWAKEVSDDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q L+G +DFT+FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDEKKMHEAGQFLLGENDFTSFRAAHCQSRSPFRNLMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + I + A +F+H  +R+  GSL  VG G+ +   ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 NYVVIDIKANAFVHHMVRNITGSLIKVGRGEESPEWIKWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|325265188|ref|ZP_08131914.1| tRNA pseudouridine synthase A [Clostridium sp. D5]
 gi|324029592|gb|EGB90881.1| tRNA pseudouridine synthase A [Clostridium sp. D5]
          Length = 263

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +I+  + K +  +TGE + V GA RTDSGVHAL  
Sbjct: 1   MKRIKLTVAYDGTNYCGWQIQPNGITIEEILNKKLSRLTGEEIRVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P  L  ALN   ++ + I I+    V   +H R+    ++Y Y I+  +
Sbjct: 61  VAVFDTETTIPPDRLAYALNQ--RMPEDIVIVKSEEVPADWHPRYCDTVKTYEYLILNAK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +   + +   LD + MR AA +L G HDF +F ++       +RTI   D+   
Sbjct: 119 IPDPTRRLTTYFVSYDLDLQKMRRAAGYLSGEHDFASFCNVRTNVEDTVRTIYELDILEN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I IR+    FL+  +R  VG+L  VG G +T   ++  L+A+DR+  G  APP GL 
Sbjct: 179 GEEITIRIRGNGFLYNMVRIIVGTLLRVGRGFYTPEQVKDILEAKDRQAAGVTAPPHGLR 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LIGIEY 244


>gi|23016535|ref|ZP_00056290.1| COG0101: Pseudouridylate synthase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 256

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 123/246 (50%), Positives = 164/246 (66%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G+ + GWQRQ  G S+QG +E+A+  +TG    ++ AGRTD+GVHA  Q
Sbjct: 1   MPRYRLLVEYDGTPFNGWQRQDKGLSVQGVLEQAVEKLTGSPCTINAAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R++    +  ALN ++K      +    + D  FHARFSA+ RSYLYRI+ R+
Sbjct: 61  VAHVDLPRDYPADTVRDALNYHMKPKPVAVVAAELVGD-DFHARFSAVGRSYLYRIVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLAL++ RAW +P SLD E M   A+ L+G HDFTTFR+  CQA SP++T+D  DV   
Sbjct: 120 APLALDQHRAWWVPVSLDAEAMAEGARRLLGHHDFTTFRASECQAKSPMKTLDVLDVTRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I I   ARSFLH Q+R+ VG+LKLVG+GKW+  D+ +AL A DR + GP AP  GL 
Sbjct: 180 GEEIRIIAEARSFLHHQVRNMVGTLKLVGEGKWSPDDMARALAACDRTKGGPTAPAAGLC 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LTGVSY 245


>gi|117619854|ref|YP_857188.1| tRNA pseudouridine synthase A [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166228676|sp|A0KLN7|TRUA_AERHH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|117561261|gb|ABK38209.1| tRNA pseudouridine synthase A [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 269

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 133/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ+   S+Q  +EKA+  +    V +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSRYFGWQRQREVISVQEELEKALSRIANHPVSIQCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             LN+ L     I++  +  VD+ FHARFSA  R Y Y I     
Sbjct: 61  IHFDTDANRAEGAWTLGLNSNL--PPDIAVRWVKQVDEGFHARFSATARRYRYVIYNHNY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         +++D + M  A Q L+G HDF+TFR++ CQ+++P R + H  V+  G
Sbjct: 119 RPAILGSGVSHYHETIDADLMHQAGQSLLGEHDFSTFRAVACQSNTPWRNVTHLCVSRSG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+  GSL LVG G      + + L A+DR   GP A   GLY 
Sbjct: 179 PYIVLDIKANAFLHHMVRNITGSLLLVGQGLQPVEWIAEVLAARDRNLAGPTAKAGGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|153816265|ref|ZP_01968933.1| hypothetical protein RUMTOR_02514 [Ruminococcus torques ATCC 27756]
 gi|317501758|ref|ZP_07959944.1| pseudouridylate synthase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088721|ref|ZP_08337631.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846448|gb|EDK23366.1| hypothetical protein RUMTOR_02514 [Ruminococcus torques ATCC 27756]
 gi|316896791|gb|EFV18876.1| pseudouridylate synthase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330407244|gb|EGG86747.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 271

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +++  + KA+  +T E V V GA RTD+GVHA   
Sbjct: 1   MRRIKLTVAYDGTDYCGWQIQPNGITVEEVLNKALSDLTKETVKVIGASRTDAGVHARGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P  +  A+NA L   D I ++    V   +H R+    ++Y Y I+ R+
Sbjct: 61  VAVFDTKSPIPPERIAYAVNALL--PDDIVVVRSEEVGCDWHPRYQNSIKTYEYTIVNRE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  L +  +W +   LD ++M+ AA++ +G HDF TF S+H    + +R ID  DV   
Sbjct: 119 MPDPLRRRDSWFVSFPLDIDDMKKAARYFIGEHDFKTFCSVHTGVKTTVRRIDSLDVEKK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I+IR+    FL+  +R   G+L  VG G +  +++++ L+ ++R   G  APP+GL 
Sbjct: 179 GERIKIRISGNGFLYNMVRIIAGTLVEVGRGAFAPSEVKEMLEQKERGRAGATAPPQGLV 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LLGIVY 244


>gi|20808627|ref|NP_623798.1| tRNA pseudouridine synthase A [Thermoanaerobacter tengcongensis
           MB4]
 gi|24212532|sp|Q8R7Y7|TRUA_THETN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|20517260|gb|AAM25402.1| Pseudouridylate synthase (tRNA psi55) [Thermoanaerobacter
           tengcongensis MB4]
          Length = 240

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 144/241 (59%), Gaps = 2/241 (0%)

Query: 6   MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFD 65
           +IIEY+G+ Y GWQ QKN  ++Q  +EKAI  VTGE V + G+ RTD+GVHAL QVA+F 
Sbjct: 2   LIIEYDGTNYHGWQYQKNAITVQEVLEKAIEKVTGEKVNLIGSSRTDTGVHALYQVANFK 61

Query: 66  LVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLAL 125
              +  P  L  ALNA L   D + ++    VDK FHAR+SA  + Y Y I+ RQ P+  
Sbjct: 62  TKTKIPPEKLPYALNAVL--PDDVVVVKAKEVDKSFHARYSARSKRYRYLILNRQFPMPT 119

Query: 126 EKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIE 185
            +   W +P  LD E M+ AA    G HDF+ F++   +  +P++TI    V   G+LI+
Sbjct: 120 MRNYCWHVPYPLDVEAMKKAAFFFRGTHDFSAFKASGNKKVNPVKTIFDLTVEKEGDLIK 179

Query: 186 IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVE 245
           I V A  FL+  +R  VG+L  VG GK  + ++   ++++DR + G  APP+GLY   + 
Sbjct: 180 IEVEADGFLYNMVRIIVGTLVYVGLGKIKAGEIPAIIESKDRTKAGITAPPQGLYLVRIV 239

Query: 246 Y 246
           Y
Sbjct: 240 Y 240


>gi|153813476|ref|ZP_01966144.1| hypothetical protein RUMOBE_03896 [Ruminococcus obeum ATCC 29174]
 gi|149830420|gb|EDM85512.1| hypothetical protein RUMOBE_03896 [Ruminococcus obeum ATCC 29174]
          Length = 250

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q NG +IQG +  A+  + GE + + GA RTD+GVHAL  
Sbjct: 5   MKRVGLVVAYDGTNYSGWQIQPNGITIQGVLNDALTDLLGEKIEIMGASRTDAGVHALGN 64

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  ALN  L   + I I     V+  FH R+    ++Y YRI+ R+
Sbjct: 65  VAVFDTNTRIPGEKISYALNQRL--PEDIRIQLSEEVEPDFHPRYCDSEKTYEYRILNRK 122

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  E+  ++     LD + MR A  +L+GRHDF +F     Q  S +RT+   D+   
Sbjct: 123 FPVPTERLYSYFYHYKLDVDKMREATSYLIGRHDFASFCGTGAQVKSTVRTLTGIDIWRD 182

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+++ IRV    FL+  +R   G+L  VG+G++    ++K L A DR   GP AP  GL 
Sbjct: 183 GDIVTIRVKGEGFLYNMVRIIAGTLIQVGNGQYPPERVKKILDACDRSVSGPTAPAHGLT 242

Query: 241 FDSVEY 246
              +E+
Sbjct: 243 LMGIEF 248


>gi|27365335|ref|NP_760863.1| tRNA pseudouridine synthase A [Vibrio vulnificus CMCP6]
 gi|37680609|ref|NP_935218.1| tRNA pseudouridine synthase A [Vibrio vulnificus YJ016]
 gi|320155720|ref|YP_004188099.1| tRNA pseudouridine synthase A [Vibrio vulnificus MO6-24/O]
 gi|31340462|sp|Q8CWK3|TRUA_VIBVU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|42559737|sp|Q7M7J4|TRUA_VIBVY RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|27361482|gb|AAO10390.1| tRNA pseudouridine synthase A [Vibrio vulnificus CMCP6]
 gi|37199357|dbj|BAC95189.1| tRNA pseudouridine synthase A [Vibrio vulnificus YJ016]
 gi|319931032|gb|ADV85896.1| tRNA pseudouridine synthase A [Vibrio vulnificus MO6-24/O]
          Length = 264

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+  +S+Q  +EKA+  V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTDYFGWQRQREVASVQEKLEKALSKVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVERKMVAWTMGANANL--PKDIAVRWAKAVPDEFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DFT+FR++ CQ+ SP R + H +V   G
Sbjct: 119 RPGILGSGVSHYHGELDEKKMHEAGQYLLGENDFTSFRAVQCQSLSPFRNMIHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL +VG G+     ++  L+A+DRK  GP A  EGLY 
Sbjct: 179 HYVVIDIKANAFVHHMVRNITGSLIMVGRGEQDPEWIKWLLEAKDRKLAGPTAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|307943162|ref|ZP_07658507.1| tRNA pseudouridine synthase A [Roseibium sp. TrichSKD4]
 gi|307773958|gb|EFO33174.1| tRNA pseudouridine synthase A [Roseibium sp. TrichSKD4]
          Length = 271

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 127/246 (51%), Positives = 161/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  + GWQRQ NG S QG IE+AI   +GE V + GAGRTD+GVHAL Q
Sbjct: 1   MPRYKLTVEYDGRPFCGWQRQSNGPSAQGVIERAIKAFSGEDVTIGGAGRTDTGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL  +W    +  ALN +    D + IL        F ARFSAIRRSY YRI  R 
Sbjct: 61  VAHADLSEDWPEKTVMGALNFH-CQPDPVVILACEKKHDGFDARFSAIRRSYRYRIHNRL 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL  E G AW +   LD + M  AAQ  VG HDFTTFR   CQA SP++T+++F V   
Sbjct: 120 PPLTHELGLAWHVKHELDADAMNEAAQEFVGHHDFTTFRHSRCQAKSPVKTLENFTVRRE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G +I     +RSFLH Q+RS VG+L+LVG+G+WT++D+ +AL A+DRK CGP+AP +GLY
Sbjct: 180 GEIILAECSSRSFLHNQVRSMVGTLRLVGEGRWTASDVGEALAARDRKACGPVAPADGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTRVDY 245


>gi|160881752|ref|YP_001560720.1| tRNA pseudouridine synthase A [Clostridium phytofermentans ISDg]
 gi|160430418|gb|ABX43981.1| tRNA pseudouridine synthase A [Clostridium phytofermentans ISDg]
          Length = 245

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 126/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q N  +I+G + + +  +  E +V+ GA RTD+GVHA   
Sbjct: 1   MKRVLLKVAYDGTNYCGWQVQPNAKTIEGVLNECLTKLLKEEIVIIGASRTDAGVHAYGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         L  ALNA+L   + I I     V+  FH R+   R++Y YRI    
Sbjct: 61  VAVFDTNSRIPAEKLSYALNAHL--PEDIVIQASMEVESDFHPRYCDTRKTYEYRIYNAT 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL   +  A  +   LD E MR AA +L+G HDF +F S + Q     RTI    +   
Sbjct: 119 FPLPTNRRYAHFVYYDLDLEAMRKAASYLIGEHDFVSFCSANTQVKDTTRTIYDIQIEKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
             LI IR+    FL+  +R   G+L  VG  +W    + +AL  +DR+  GP AP +GL 
Sbjct: 179 RELIVIRIKGNGFLYNMVRIIAGTLIQVGTHQWEPERVLEALTKKDRQAAGPTAPAKGLT 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LVEIEY 244


>gi|269962161|ref|ZP_06176515.1| tRNA pseudouridine synthase A [Vibrio harveyi 1DA3]
 gi|269833245|gb|EEZ87350.1| tRNA pseudouridine synthase A [Vibrio harveyi 1DA3]
          Length = 264

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ++  S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTNYFGWQRQRDVKSVQEELEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA   +   I++     V+  FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVSRKMVAWTMGANAN--MPSDIAVRWAVEVNDDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DF++FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDEKKMHEAGQYLLGENDFSSFRAAHCQSLSPFRNLMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG G+     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 DYIVIDIKANAFVHHMVRNITGSLIKVGRGEEKPEWIKWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|153834426|ref|ZP_01987093.1| tRNA pseudouridine synthase A [Vibrio harveyi HY01]
 gi|156975370|ref|YP_001446277.1| tRNA pseudouridine synthase A [Vibrio harveyi ATCC BAA-1116]
 gi|166229849|sp|A7MS76|TRUA_VIBHB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|148869197|gb|EDL68225.1| tRNA pseudouridine synthase A [Vibrio harveyi HY01]
 gi|156526964|gb|ABU72050.1| hypothetical protein VIBHAR_03101 [Vibrio harveyi ATCC BAA-1116]
          Length = 264

 Score =  202 bits (513), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+   S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTNYFGWQRQREVKSVQEELEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA   +   I++     V+  FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVSRKMVAWTMGANAN--MPSDIAVRWAVEVNDDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DF++FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDEKKMHEAGQYLLGENDFSSFRAAHCQSLSPCRNMMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG G+     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 DYIVIDIKANAFVHHMVRNITGSLIKVGRGEEKPEWIKSLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|260769069|ref|ZP_05878003.1| tRNA pseudouridine synthase A [Vibrio furnissii CIP 102972]
 gi|260617099|gb|EEX42284.1| tRNA pseudouridine synthase A [Vibrio furnissii CIP 102972]
 gi|315180810|gb|ADT87724.1| tRNA pseudouridine synthase A [Vibrio furnissii NCTC 11218]
          Length = 264

 Score =  202 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+  +S+Q  +EKA+ ++    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTQYYGWQRQREVNSVQEELEKALSVIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       +      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTATRKMIAWTMGANANL--PKNIAVRWAKEVPDEFHARFSATARRYRYVIYNHMF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD   M  A Q L+G +DFT+FR++HCQ+ SP R I H +V    
Sbjct: 119 RPGILATGVSHYHGELDVARMHQAGQFLLGENDFTSFRAVHCQSRSPWRNIMHLNVTRHE 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQEPEWIQWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|56418673|ref|YP_145991.1| tRNA pseudouridine synthase A [Geobacillus kaustophilus HTA426]
 gi|62901182|sp|Q5L3Q7|TRUA_GEOKA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|56378515|dbj|BAD74423.1| pseudouridylate synthaseI [Geobacillus kaustophilus HTA426]
          Length = 258

 Score =  202 bits (512), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 123/246 (50%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            R   II Y+G+ + G+Q Q    ++QG  E+ +  +  G  V V  +GRTD+GVHA  Q
Sbjct: 3   QRIKCIIAYDGTHFSGYQIQPGKRTVQGEFEEVLRRMHKGTKVRVAASGRTDAGVHAYGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD           KALNA L   D I +  +   D  FHARFSA  + Y Y++ T  
Sbjct: 63  VIHFDTPLSLSSEQWKKALNAQL--PDDIVVRFVQEADADFHARFSAKAKEYRYKVWTAA 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +      P SL    M  A + L G HDFT+F S        +RT+   +V + 
Sbjct: 121 ERDVFRRHYCAWHPYSLHISAMNEALRLLHGTHDFTSFCSAKTSIEDRVRTMYRAEVKAD 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G ++E R V   FL+  +R  VG++  +G GK +  D+   L A+DR+  GP AP EGLY
Sbjct: 181 GPMLEFRFVGSGFLYNMVRIIVGTVLEIGQGKRSPADISTLLAAKDRRLAGPTAPAEGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LWRVYY 246


>gi|150395284|ref|YP_001325751.1| tRNA pseudouridine synthase A [Sinorhizobium medicae WSM419]
 gi|166229839|sp|A6U5I6|TRUA_SINMW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|150026799|gb|ABR58916.1| tRNA pseudouridine synthase A [Sinorhizobium medicae WSM419]
          Length = 247

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 152/247 (61%), Positives = 186/247 (75%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ +I+EY+G+ Y GWQRQ NG S+QG+IEKA+  +TGE V V GAGRTDSGVHA  Q
Sbjct: 1   MPRFRLIVEYDGTDYVGWQRQDNGPSVQGAIEKAVLSLTGETVRVRGAGRTDSGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL R W P  L  ALNA+L    + +SIL +      F ARFSAIRR YLYRII+R
Sbjct: 61  VAHLDLTRAWKPYTLQNALNAHLSLAGERVSILEVEEAAADFDARFSAIRRHYLYRIISR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++PLALE  RAW +PK+LD + M  AAQ L+G HDFTTFRS +CQA+SP+RT+D  DV  
Sbjct: 121 RSPLALEARRAWWVPKALDHDAMHEAAQRLLGHHDFTTFRSANCQATSPMRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+LIEIR  A+SFLH QIRSF GSLKLVG+ KWT  +L+ AL+A+DRK CGP+APP+GL
Sbjct: 181 TGDLIEIRASAQSFLHNQIRSFAGSLKLVGESKWTPDNLQAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMRVDY 247


>gi|209886648|ref|YP_002290505.1| tRNA pseudouridine synthase A [Oligotropha carboxidovorans OM5]
 gi|229557998|sp|B6JJP6|TRUA_OLICO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|209874844|gb|ACI94640.1| tRNA pseudouridine synthase A [Oligotropha carboxidovorans OM5]
          Length = 245

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 131/246 (53%), Positives = 169/246 (68%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY ++IEY+G+ + GWQ Q NG S+QG++E A+  + G  V VHGAGRTD+GVHAL Q
Sbjct: 1   MPRYKLLIEYDGTPFCGWQYQDNGPSVQGALEDAVAALAGTHVRVHGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL + +    +  ALNA+L+    I +L+  IV + F +RFSA++R Y+YRI  R+
Sbjct: 61  VAHIDLEKSYRTDQVRDALNAHLR-PHPIGVLSAEIVPETFESRFSAVKRHYIYRISNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A LAL+  RAW I ++LD   M  AAQ LVGRHDFTTFR   CQA SP +T+D  DV   
Sbjct: 120 ANLALDLHRAWRIARTLDVAAMHEAAQVLVGRHDFTTFRDTECQAKSPEKTLDQLDVTRE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + I   ARSFLH+Q+RS VGSL  VG G+WT  D+  AL A+DR  CGP+APPEGLY
Sbjct: 180 GDAVSIVTSARSFLHSQVRSMVGSLVWVGHGRWTIADMRNALAARDRTACGPVAPPEGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LVRVDY 245


>gi|291549528|emb|CBL25790.1| pseudouridylate synthase I [Ruminococcus torques L2-14]
          Length = 256

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 126/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q    +I+G + +AI  +T E ++V GA RTD+GVHA   
Sbjct: 1   MRRIRLRVAYDGTAYCGWQVQPEVPTIEGELNQAISRLTKEEIIVIGASRTDAGVHAKGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN  L   + I ++    V+  +H R     ++Y Y+I+  +
Sbjct: 61  VAVFDTESTIPADRFAYALNPLL--PEDIVVVASDEVEADWHPRHCDTEKTYEYKILNSK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  + +   + +   L+ E MR AA++L G HDF +F ++H Q    +RTI   +V   
Sbjct: 119 FPDPMRRRDTYHVSFDLNLEKMREAAEYLKGEHDFKSFCNVHTQVEDTVRTIYDLEVEKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
             LI IRV    FL+  +R   G+L  VG G      +   L+A+DR+  G   PP+GL 
Sbjct: 179 EELITIRVRGNGFLYNMVRILAGTLIGVGRGAIAPEQIPAILEAKDRQAAGMTVPPQGLT 238

Query: 241 FDSVEY 246
              ++Y
Sbjct: 239 LVKIDY 244


>gi|312135434|ref|YP_004002772.1| tRNA pseudouridine synthase a [Caldicellulosiruptor owensensis OL]
 gi|311775485|gb|ADQ04972.1| tRNA pseudouridine synthase A [Caldicellulosiruptor owensensis OL]
          Length = 244

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+GYFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTGYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     IS+ +   V   F AR+SA +++Y Y I  ++
Sbjct: 61  KANFKTSSKIPTDKFPLALNSVL--PGDISVKDAVEVPLDFSARYSAKQKTYKYLIYNKK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+ A ++ +G +DF +F S   +A + IR I +  +   
Sbjct: 119 SRPALLRNYAYYYPYELDVDAMQRACEYFIGEYDFKSFCSADSEAKTTIRHIYNAYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR   G   PP GLY
Sbjct: 179 NECIAIYITANGFLYNMARIIAGTILDVGAGKLKPMDIPLIIESKDRTLAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|28898964|ref|NP_798569.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260365288|ref|ZP_05777845.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus K5030]
 gi|260878838|ref|ZP_05891193.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus AN-5034]
 gi|260896240|ref|ZP_05904736.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus Peru-466]
 gi|260899991|ref|ZP_05908386.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus AQ4037]
 gi|31340461|sp|Q87MP1|TRUA_VIBPA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|28807183|dbj|BAC60453.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308088841|gb|EFO38536.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus Peru-466]
 gi|308094227|gb|EFO43922.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus AN-5034]
 gi|308107376|gb|EFO44916.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus AQ4037]
 gi|308115414|gb|EFO52954.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus K5030]
 gi|328474496|gb|EGF45301.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus 10329]
          Length = 264

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+   S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTNYFGWQRQREVKSVQEELEKALSIVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA   +   I++     V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVNRKMVAWTMGANAN--MPSDIAVRWAKEVPDDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DF++FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDEKKMHEAGQYLLGENDFSSFRAAHCQSLSPCRNLMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 DYVVIDIKANAFVHHMVRNITGSLIKVGRGEEKPEWIKWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|312793879|ref|YP_004026802.1| tRNA pseudouridine synthase a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181019|gb|ADQ41189.1| tRNA pseudouridine synthase A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 244

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+GYFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTGYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     ISI +   V   F AR+SA +++Y Y I  ++
Sbjct: 61  KANFKTNSKIPTDKFPLALNSVL--PGDISIKDAVEVPLDFSARYSAKQKTYKYLIYNKK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+ A ++ +G +DF +F S   +A + IR + +  +   
Sbjct: 119 SRPALLRNYAYHYPYELDVDAMQRACEYFIGEYDFKSFCSADSEAKTTIRRVYNAYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR + G   PP GLY
Sbjct: 179 NECIAIYITANGFLYNMARIIAGTILDVGAGKLKPMDIPLVIESKDRTKAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|294497016|ref|YP_003560716.1| tRNA pseudouridine synthase A [Bacillus megaterium QM B1551]
 gi|295702381|ref|YP_003595456.1| tRNA pseudouridine synthase A [Bacillus megaterium DSM 319]
 gi|294346953|gb|ADE67282.1| tRNA pseudouridine synthase A [Bacillus megaterium QM B1551]
 gi|294800040|gb|ADF37106.1| tRNA pseudouridine synthase A [Bacillus megaterium DSM 319]
          Length = 246

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 123/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R   I+ Y+G+ + G+Q Q N  ++Q  IE  +  +  + V ++ +GRTD+ VHA  Q
Sbjct: 1   MKRLKCIVAYDGTHFSGYQVQPNKRTVQLEIEAVLEKMHNKKVPIYASGRTDTNVHAQGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD           KALN+ L   D I + N+  VD  FHAR+    + Y Y I+  +
Sbjct: 61  VIHFDTNLNIPCDKWKKALNSML--PDDIVMKNVCEVDAHFHARYDVTSKEYRYHILRGE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +  A+  P  LD   M+ A  +L+G HDFT+F S   +    IRTI   D+   
Sbjct: 119 DRNPFTRSYAYHYPYPLDYSKMKKAITYLLGTHDFTSFCSARTEVEDKIRTIYKIDMYEE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + +  R V   FL+  +R  VG+L  VG G+     ++  L+++ R   G  AP +GLY
Sbjct: 179 NSQLVFRFVGSGFLYNMVRILVGTLLEVGQGRIEPDAIKDILESKSRPRAGKTAPSQGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LWRVFY 244


>gi|330829261|ref|YP_004392213.1| tRNA pseudouridine synthase A [Aeromonas veronii B565]
 gi|328804397|gb|AEB49596.1| tRNA pseudouridine synthase A [Aeromonas veronii B565]
          Length = 269

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ+   S+Q  +E A+  +    V +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSRYFGWQRQREVISVQAELETALSRIANHPVSIQCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             LN+ L     I++  +  VD+ FHARFSA  R Y Y I     
Sbjct: 61  IHFDTEANRAEGAWTLGLNSNL--PPDIAVRWVKQVDESFHARFSATARRYRYVIYNHNY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         ++++ E M  A Q L+G HDF+TFR++ CQ+++P R + H  V+  G
Sbjct: 119 RPAILGSGVSHYHETINAELMHQAGQSLLGEHDFSTFRAVACQSNTPWRNVTHLCVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+  GSL LVG G      + + L A+DR   GP A   GLY 
Sbjct: 179 PYIVLDIRANAFLHHMVRNITGSLLLVGQGLKPVEWIAEVLAAKDRNLAGPTAKAGGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|222147430|ref|YP_002548387.1| tRNA pseudouridine synthase A [Agrobacterium vitis S4]
 gi|254789600|sp|B9JQX0|TRUA_AGRVS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|221734420|gb|ACM35383.1| tRNA pseudouridine synthase A [Agrobacterium vitis S4]
          Length = 259

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 141/247 (57%), Positives = 179/247 (72%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ Y GWQRQ NG S+QG++E A+  +TGE V + GAGRTDSGVHA  Q
Sbjct: 1   MPRYKLTVEYDGTPYVGWQRQDNGPSVQGALEAAVLGLTGETVAIRGAGRTDSGVHASGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQ-FHARFSAIRRSYLYRIITR 119
           VAH DL+R+W+P  L  ALNA+L  +     +  +      F ARFSA++R YLYRI++R
Sbjct: 61  VAHVDLLRQWIPYKLRNALNAHLAQAGQAISILAAEAVPDAFDARFSALKRHYLYRIMSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
            + LALE  RAW + K LD E M  AAQ LVG HDFTTFRS+HCQA SP+RT+D  DV+ 
Sbjct: 121 PSRLALEANRAWWVSKPLDHEAMHAAAQMLVGNHDFTTFRSVHCQAISPVRTLDRLDVSR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+LIEIR  A+SFLH QIRSF G+LK+ G+GK T  D+  AL+A+DRK CGP+APP+GL
Sbjct: 181 NGDLIEIRASAQSFLHNQIRSFAGTLKMAGEGKMTPEDVRAALEARDRKACGPVAPPQGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFLQVDY 247


>gi|222529670|ref|YP_002573552.1| tRNA pseudouridine synthase A [Caldicellulosiruptor bescii DSM
           6725]
 gi|254789602|sp|B9MKC1|TRUA_ANATD RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|222456517|gb|ACM60779.1| tRNA pseudouridine synthase A [Caldicellulosiruptor bescii DSM
           6725]
          Length = 244

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+GYFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTGYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     ISI +       F AR+SA +++Y Y I  ++
Sbjct: 61  KANFKTSSKIPTDKFPLALNSVL--PGDISIKDAVEAPLDFSARYSARQKTYKYLIYNKK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+ A ++ +G +DF +F S   +A + IR + +  +   
Sbjct: 119 SRPALLRNYAYYYPYQLDVDAMQRACEYFIGEYDFKSFCSADSEAKTTIRRVYNAYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR + G   PP GLY
Sbjct: 179 NECIAIYITANGFLYNMARIIAGTILDVGAGKLKPMDIPLIIESKDRTKAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|323483257|ref|ZP_08088647.1| tRNA pseudouridine synthase A [Clostridium symbiosum WAL-14163]
 gi|323691247|ref|ZP_08105522.1| pseudouridylate synthase [Clostridium symbiosum WAL-14673]
 gi|323403355|gb|EGA95663.1| tRNA pseudouridine synthase A [Clostridium symbiosum WAL-14163]
 gi|323504587|gb|EGB20374.1| pseudouridylate synthase [Clostridium symbiosum WAL-14673]
          Length = 341

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +I+  + KA+  +  E V V GA RTDSGVHA   
Sbjct: 1   MKRIKLTVAYDGTAYCGWQIQPNGVTIEEVLNKALTGLLKEPVTVIGASRTDSGVHARGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +C ALN  L   D I +     V   FH R +   ++Y Y+I+ R+
Sbjct: 61  VAVFDTESRIPGDKICFALNQRL--PDDIRVQASEEVPLSFHPRKANCTKTYEYKILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             + LE+  +     +LD E M+ AA  LVG HDF +F ++  QA   +RTI   DV+  
Sbjct: 119 ISMPLERLYSHFCYFNLDVEKMKQAAAFLVGEHDFKSFCTVRTQAEETVRTIYSLDVSKD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++I IR+    FL+  +R   G+L  VG G +    +E+ L+A+DR   GP  P  GL 
Sbjct: 179 GDMITIRISGSGFLYNMVRIITGTLVKVGLGVYPPEHMEEILEARDRSAAGPTIPAVGLT 238

Query: 241 FDSVEY 246
             S+EY
Sbjct: 239 LVSLEY 244


>gi|261417639|ref|YP_003251321.1| tRNA pseudouridine synthase A [Geobacillus sp. Y412MC61]
 gi|319765297|ref|YP_004130798.1| tRNA pseudouridine synthase A [Geobacillus sp. Y412MC52]
 gi|261374096|gb|ACX76839.1| tRNA pseudouridine synthase A [Geobacillus sp. Y412MC61]
 gi|317110163|gb|ADU92655.1| tRNA pseudouridine synthase A [Geobacillus sp. Y412MC52]
          Length = 258

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 121/248 (48%), Gaps = 4/248 (1%)

Query: 1   MI-RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI-VVVHGAGRTDSGVHAL 58
           M  R   II Y+G+ + G+Q Q    ++QG +E+ +  +     V V  +GRTD+GVHA 
Sbjct: 1   MTKRIKCIIAYDGTHFSGYQIQPGKRTVQGELEEVLRRMHKGKGVRVAASGRTDAGVHAY 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            QV HFD           KALNA L   D I +  +   D  FHARFSA  + Y Y++ T
Sbjct: 61  GQVIHFDTSLSLSSEQWKKALNAQL--PDDIVVRFVQEADADFHARFSAKAKEYRYKVWT 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
                   +      P  L  + M  A +   G HDFT+F S        +RTI    V 
Sbjct: 119 AAERDVFRRHYCAWHPYPLHMDAMNEALRLFCGTHDFTSFCSAKTTIEDRVRTIYRAKVK 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G ++E R V   FL+  +R  VG++  +G GK +  D+   L A+DR+  GP AP EG
Sbjct: 179 VDGPMLEFRFVGSGFLYNMVRIMVGTVLEIGQGKRSPADISTLLAAKDRRLAGPTAPAEG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLWRVYY 246


>gi|303240936|ref|ZP_07327447.1| tRNA pseudouridine synthase A [Acetivibrio cellulolyticus CD2]
 gi|302591522|gb|EFL61259.1| tRNA pseudouridine synthase A [Acetivibrio cellulolyticus CD2]
          Length = 245

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQ Q N  ++Q ++EKAI+ +TGE++ ++G+ RTD GVHA  Q
Sbjct: 1   MKNVKLIIEYDGTNYHGWQSQSNAKTVQETVEKAIYGLTGEVININGSSRTDQGVHAYGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN  L   + I I     V   FHAR+ A  + Y Y I    
Sbjct: 61  VANFFTKSNIPHDRFSYALNRML--PEDIIIRKSEEVSMDFHARYCAKGKKYRYLIYNSS 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P A+ + R++ +  +LD ++M+ A     G HDF+ F++      + +RTI   +++  
Sbjct: 119 FPSAIFRNRSYHVSHNLDMDSMKKAIPFFKGTHDFSAFKATGSSVKTSVRTIFDVNLSRA 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I   V    FL+  +R  VG+L  VG G+  + ++   +++ DRK  G  APP+GLY
Sbjct: 179 EDNIWFEVSGDGFLYNMVRIMVGTLVDVGMGRIKAEEIPGIIESCDRKRAGRTAPPQGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVEVYY 244


>gi|312622107|ref|YP_004023720.1| tRNA pseudouridine synthase a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202574|gb|ADQ45901.1| tRNA pseudouridine synthase A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 244

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+GYFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTGYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     ISI +   V   F AR+SA +++Y Y I  ++
Sbjct: 61  KANFKTSSKIPTDKFPLALNSVL--PGDISIKDAIEVPLDFSARYSARQKTYKYLIYNKK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+   ++ +G +DF +F S   +A + IR + +  +   
Sbjct: 119 SRPALLRNYAYYYPYQLDVDAMQRTCEYFIGEYDFKSFCSADSEAKTTIRRVYNAYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR + G   PP GLY
Sbjct: 179 NECIAIYITANGFLYNMARIIAGTILDVGAGKLKPMDIPLIIESKDRTKAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|315122856|ref|YP_004063345.1| tRNA pseudouridine synthase A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496258|gb|ADR52857.1| tRNA pseudouridine synthase A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 247

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 203/247 (82%), Positives = 222/247 (89%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           MIRYC+IIEY+GSGY GWQRQKNG SIQG IEKAIFLVTGE + V+GAGRTDSGVHALRQ
Sbjct: 1   MIRYCLIIEYDGSGYVGWQRQKNGVSIQGEIEKAIFLVTGESMTVYGAGRTDSGVHALRQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDLVREWVP  LCKALNA+L IS+ ISIL L +VD++FHARFSAIRRSYLYRIITRQ
Sbjct: 61  VAHFDLVREWVPEKLCKALNAHLNISNDISILELCVVDEKFHARFSAIRRSYLYRIITRQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLALEKGRAW  PK LDCE MR+AAQHL+G+HDFTTFRS+ CQA SPIRTID  D+N  
Sbjct: 121 APLALEKGRAWWFPKDLDCEMMRVAAQHLIGKHDFTTFRSVQCQALSPIRTIDRLDINRL 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++IEIRVVARSFLHTQIRSFVGSLKLVGD KWTS DL+KAL+AQDRK CGPL+P EGLY
Sbjct: 181 GDMIEIRVVARSFLHTQIRSFVGSLKLVGDRKWTSDDLQKALKAQDRKACGPLSPSEGLY 240

Query: 241 FDSVEYS 247
           FDSVEYS
Sbjct: 241 FDSVEYS 247


>gi|312877809|ref|ZP_07737759.1| tRNA pseudouridine synthase A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311795435|gb|EFR11814.1| tRNA pseudouridine synthase A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 244

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+GYFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTGYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     IS+ +   V   F AR+SA +++Y Y I  ++
Sbjct: 61  KANFKTNSKIPTDKFPLALNSVL--PGDISVKDAVEVPLDFSARYSAKQKTYKYLIYNKK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+ A ++ +G +DF +F S   +A + IR + +  +   
Sbjct: 119 SRPALLRNYAYYYPYELDVDAMQRACEYFIGEYDFKSFCSADSEAKTTIRRVYNAYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR + G   PP GLY
Sbjct: 179 NECIAIYITANGFLYNMARIIAGTILDVGAGKLKPMDIPLVIESKDRTKAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|226309840|ref|YP_002769734.1| tRNA pseudouridine synthase A [Brevibacillus brevis NBRC 100599]
 gi|254789606|sp|C0ZIL2|TRUA_BREBN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226092788|dbj|BAH41230.1| tRNA pseudouridine synthase A [Brevibacillus brevis NBRC 100599]
          Length = 244

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 120/246 (48%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R   ++ Y+G+ + G+Q Q +  ++QG IE A+  VTGE + V G+GRTD+GVHA  Q
Sbjct: 1   MKRLRCVLAYDGTDFSGFQVQPDQVTVQGEIEAALNRVTGEDIQVFGSGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD             LN  L  S  I    +  VD  FHARF    + Y Y I    
Sbjct: 61  VIHFDTASNIPMDKWRFVLNNQLPDSIVIRT--VEEVDASFHARFDVQVKEYRYCIDNNP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                    A  +   LD + M+ AA +LVG HDFT+F S        +RT+    V   
Sbjct: 119 VADVFRHRYADHVRFPLDVDAMQQAAHYLVGEHDFTSFCSAKTYVEDKVRTVYGLSVEKI 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + +      FL+  +R  VG+L  VG GK    +L + L A DR++ G  AP +GL 
Sbjct: 179 GDEVWVTCRGNGFLYNMVRIIVGTLVEVGQGKRNPAELREILAACDREKAGKTAPAKGLT 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 MWEVVY 244


>gi|225573074|ref|ZP_03781829.1| hypothetical protein RUMHYD_01265 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039560|gb|EEG49806.1| hypothetical protein RUMHYD_01265 [Blautia hydrogenotrophica DSM
           10507]
          Length = 245

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ Q NG +IQG + + +  + GE +   GA RTD+GVHA+  
Sbjct: 1   MKRVGLIVAYDGTNYCGWQVQPNGITIQGELNRCLSELLGEEIETIGASRTDAGVHAMGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  ALN  L   + I I     +   FH R+    ++Y YRI+ R+
Sbjct: 61  VAVFDTETRMPGEKISYALNQRL--PEDIRIQLSEEMPMDFHPRYCDSVKTYEYRILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +  E+  ++     LD + MR A  +L+GRHDF +F     Q  S +RTI   +V  F
Sbjct: 119 FQIPTERLYSYFYHYKLDEKKMREATSYLIGRHDFASFCGAGAQVKSTVRTIRSVEVERF 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+++ IR+    FL+  +R   G+L  +G+G++    +++ L A+DR+  GP AP +GL 
Sbjct: 179 GDMVTIRISGEGFLYNMVRIIAGTLIEIGNGQYPPERMQEILDARDREWAGPTAPAKGLT 238

Query: 241 FDSVEY 246
              ++Y
Sbjct: 239 LLGIQY 244


>gi|119775285|ref|YP_928025.1| tRNA pseudouridine synthase A [Shewanella amazonensis SB2B]
 gi|166229832|sp|A1S7J9|TRUA_SHEAM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|119767785|gb|ABM00356.1| pseudouridylate synthase [Shewanella amazonensis SB2B]
          Length = 261

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS ++GWQRQ   +S+Q  +E+A+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSKFYGWQRQAEVNSVQAELERALSIVANEPIEVQCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +N +L   D I++     V+  FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNAVRKEGAWTLGVNVHL--PDDIAVRWAMPVNDDFHARFSATARRYRYVIFNHNF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D E M  AAQ L+G  DFT+FR+I CQ+++P R +    V+  G
Sbjct: 119 RPGILRKGVSHYHGDIDVERMHDAAQALIGERDFTSFRAIGCQSNTPFRNVHKVSVSRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VGSL  +G G      +   L+A+DR +    A P GLY 
Sbjct: 179 MYIVVDIQANAFLHHMVRNIVGSLLEIGLGNQPLDWMATLLEAKDRSQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|167759245|ref|ZP_02431372.1| hypothetical protein CLOSCI_01592 [Clostridium scindens ATCC 35704]
 gi|167663119|gb|EDS07249.1| hypothetical protein CLOSCI_01592 [Clostridium scindens ATCC 35704]
          Length = 248

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 127/247 (51%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I Y+G+ Y GWQ Q NG +++  + K +  +TGE + V GA RTDSGVHAL  
Sbjct: 1   MKRIKLTIAYDGTDYCGWQIQPNGITVEEILNKKLKKLTGEDIHVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIR-RSYLYRIITR 119
           VA FD         +  ALN  L   D I I++   V   +H R+     ++Y Y I   
Sbjct: 61  VAVFDTESSIPAERMAYALNQRL--PDDIVIVSSKEVPLDWHPRYQDEILKTYEYHIYNA 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                L++  +  +   ++ E MR  A +L+G HDF +F ++       +RT+    +  
Sbjct: 119 PVQNPLKRRYSAFVSFPMNVEKMREGAAYLLGEHDFVSFCNVRTSVEDTVRTVKELMIEQ 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I IR+    FL+  +R   G+L  VG G +  T +++ L+A++R + G  APPEGL
Sbjct: 179 EGPDITIRITGNGFLYNMVRIIAGTLIRVGRGFYEPTKVKEILEARERTQAGVTAPPEGL 238

Query: 240 YFDSVEY 246
               +EY
Sbjct: 239 TLVCIEY 245


>gi|238916297|ref|YP_002929814.1| tRNA-pseudouridine synthase I [Eubacterium eligens ATCC 27750]
 gi|238871657|gb|ACR71367.1| tRNA-pseudouridine synthase I [Eubacterium eligens ATCC 27750]
          Length = 253

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ Q    +I+  ++KAI  +TGE V V GA RTD+GVHA   
Sbjct: 1   MRRIKLIVAYDGTEYSGWQIQPEAPTIEMCLDKAIRELTGENVHVTGASRTDAGVHAYGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN +L  S  I       V   FH R    R++Y YRI+   
Sbjct: 61  VAVFDTESTIPGDRFTFALNRFLPDSIVIQDSW--EVSGDFHPRHCNTRKTYEYRILNTV 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL  ++   W +  S+D E M+ AA ++VG HDF +F  +  QA S +RTI   +V   
Sbjct: 119 VPLPQKRNFTWHVTGSIDIEKMKEAAAYIVGEHDFKSFCCVRTQAESTVRTIYSLEVLQE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I IR+    FL+  +R   G+L  VG G++    +++ L+A+DR   G  APP+GL 
Sbjct: 179 GSEIIIRIKGNGFLYNMVRIITGTLIQVGKGRFKPEYVKQMLEAKDRTVAGQTAPPQGLT 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LVGIEY 244


>gi|312127288|ref|YP_003992162.1| tRNA pseudouridine synthase a [Caldicellulosiruptor hydrothermalis
           108]
 gi|311777307|gb|ADQ06793.1| tRNA pseudouridine synthase A [Caldicellulosiruptor hydrothermalis
           108]
          Length = 244

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ YFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTEYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     ISI +   V   F AR+SA +++Y Y I  + 
Sbjct: 61  KANFKTSSKIPTDKFPLALNSVL--PGDISIKDAVEVPLNFSARYSAKQKTYKYLIYNKN 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+ A ++ +G +DF +F S   +A + IR + +  +   
Sbjct: 119 SRPALLRNYAYYYPYQLDVDAMQRACEYFIGEYDFKSFCSADSEAKTTIRRVYNSYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR + G   PP GLY
Sbjct: 179 NECIAIYITANGFLYNMARIIAGTILDVGAGKLKPMDIPLIIESKDRTKAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVVY 244


>gi|172056172|ref|YP_001812632.1| tRNA pseudouridine synthase A [Exiguobacterium sibiricum 255-15]
 gi|229470753|sp|B1YH83|TRUA_EXIS2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|171988693|gb|ACB59615.1| tRNA pseudouridine synthase A [Exiguobacterium sibiricum 255-15]
          Length = 249

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 130/246 (52%), Gaps = 4/246 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+   I+Y+G+ Y G+Q Q NG +IQ  +EK +  +    V V G+GRTD+ VHA  Q
Sbjct: 1   MRRFKCTIQYDGTDYSGYQVQPNGLTIQEVLEKTLGRMHKHPVKVIGSGRTDARVHAQGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD      P  + KALN  L   D I + +   V   F AR+  +     YR   R+
Sbjct: 61  VIHFDTELSIAPASMVKALNTLL--PDDIRVRDCKEVASDFEARYDVV--GKEYRYFVRR 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A  + ++ LIP SLD   +R+   HLVG HDF++F     +  + +RTI   ++   
Sbjct: 117 TENAFRRHQSVLIPYSLDVAQIRLGLAHLVGTHDFSSFCVAKTETDNRVRTIYEAELIEQ 176

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  +  R     FL+ QIR  VG+L  VG G++   D+++ L+A+DR   G  APP GLY
Sbjct: 177 GEELIFRFQGSGFLYNQIRIMVGTLLDVGRGRFAPDDIKRMLEAKDRNVAGVTAPPHGLY 236

Query: 241 FDSVEY 246
              V Y
Sbjct: 237 LWEVFY 242


>gi|240948735|ref|ZP_04753107.1| tRNA pseudouridine synthase A [Actinobacillus minor NM305]
 gi|240296951|gb|EER47529.1| tRNA pseudouridine synthase A [Actinobacillus minor NM305]
          Length = 262

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ++  S+Q  +E+A+  V    V V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQESVESVQQKLEEALSTVANSPVEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA+L   D I++     V + FHARFSA  R Y Y I  R+ 
Sbjct: 61  VHFETDANRPLQAWCFGTNAHL--PDDIAVKWAVEVPEDFHARFSATARRYRYIIFNRKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M  A Q+L+G +DF++FR+  CQ+ +P R I H +V+  G
Sbjct: 119 RSAILPKGVSHYHVDLDHEKMHEAGQYLLGENDFSSFRAAKCQSHTPWRNIHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ +DR    P A  EGLY 
Sbjct: 179 AYIIVDIQANAFVHHMVRNIVGSLIEVGQGNQPPEWIKWLLEQKDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|260773232|ref|ZP_05882148.1| tRNA pseudouridine synthase A [Vibrio metschnikovii CIP 69.14]
 gi|260612371|gb|EEX37574.1| tRNA pseudouridine synthase A [Vibrio metschnikovii CIP 69.14]
          Length = 264

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ YFGWQRQ++  S+Q  +EKA+ ++    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYFGWQRQRDVISVQEKLEKALSIIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E          NA L     I++    +V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERNMAAWTMGANANL--PKDIAVRWAKVVADDFHARFSATARRYRYVIYNHAY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M++A Q+L+G +DFT+FR++HCQ+ SP R I H +V+   
Sbjct: 119 RPGILSSGVSHYHPELDVQRMQLAGQYLLGENDFTSFRAVHCQSRSPWRNIMHLNVSRHE 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G+     +E  L A+DRK     A  EGLY 
Sbjct: 179 RYVVVDIKANAFVHHMVRNIVGSLIEVGRGEKEPQWIEWLLAAKDRKLAAATAKAEGLYL 238

Query: 242 DSVEY 246
            +V+Y
Sbjct: 239 VAVDY 243


>gi|302871559|ref|YP_003840195.1| tRNA pseudouridine synthase A [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574418|gb|ADL42209.1| tRNA pseudouridine synthase A [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 244

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+GYFGWQ+Q N  +IQG+IE+AI  +TGE V + G+GRTD GVHAL Q
Sbjct: 1   MRNILLTIEYDGTGYFGWQKQPNKKTIQGTIEEAIKKLTGEEVNLIGSGRTDRGVHALNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        ALN+ L     IS+ +   V   F AR+SA +++Y Y I  ++
Sbjct: 61  KANFKTSSKIPTDKFPLALNSVL--PGDISVKDAIEVSLDFSARYSAKQKTYKYLIYNKK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  AL +  A+  P  LD + M+ A ++ +G +DF +F S+  ++ + +R I +  +   
Sbjct: 119 SRPALLRNYAYYYPYELDVDAMQRACEYFIGEYDFKSFCSVDSESKTTVRRIYNAYLTFE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+   R   G++  VG GK    D+   ++++DR   G   PP GLY
Sbjct: 179 NECIAIYLTANGFLYNMARIIAGTILDVGAGKLKPMDIPLIIESKDRTLAGKTLPPWGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVAY 244


>gi|220934425|ref|YP_002513324.1| tRNA pseudouridine synthase A [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995735|gb|ACL72337.1| tRNA pseudouridine synthase A [Thioalkalivibrio sp. HL-EbGR7]
          Length = 259

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 98/246 (39%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R  + +EY+GSG+ GWQ Q  G ++Q  +E+A+  V    V V  AGRTD+GVHA  Q
Sbjct: 1   MMRIALGVEYDGSGFCGWQTQLQGRAVQACVEQALSRVANHPVSVVCAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD              N +L     IS+L    VD  F ARFSA  R Y Y I+ R 
Sbjct: 61  VIHFDTESVRTARSWVLGGNTHL--PPEISLLWAKEVDADFSARFSARSRRYRYVILNRW 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   +       LD E M  A Q L+G  DFT+FR++ CQA SP+RT+    V   
Sbjct: 119 VRPGVLHRKVSWHHPPLDAERMHAAGQRLLGEWDFTSFRAVGCQAKSPVRTLLSLSVTRR 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I + V A +FLH  +R+  G L  VG+G+     + + L A+DR   G  APP GLY
Sbjct: 179 GDFIYLDVHANAFLHHMVRNIAGVLMAVGEGERPVEWVSEVLHARDRTLGGVTAPPHGLY 238

Query: 241 FDSVEY 246
              VEY
Sbjct: 239 LVHVEY 244


>gi|269102116|ref|ZP_06154813.1| tRNA pseudouridine synthase A [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162014|gb|EEZ40510.1| tRNA pseudouridine synthase A [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 261

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ YFGWQRQ+   S+Q  +EKA+  +  E V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGAKYFGWQRQREVDSVQERLEKALAKIANEPVDVFCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+            +NA+L     I++   + V   FHARF+A  R Y Y I     
Sbjct: 61  VHFDVNVNRKMAAWTMGVNAHL--PSDIAVRWAAEVSDDFHARFTATARRYRYVIYNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q+L+G +DFT+FR++HCQ+ SP R + H +V+  G
Sbjct: 119 RPAILSSGVSHYHGDLDEKKMHEAGQYLLGENDFTSFRAVHCQSRSPWRNLMHLNVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + I + A +F+H  +R+  GSL  VG G+     ++  L+ +DR   G  A  EGLY 
Sbjct: 179 NYVIIDIKANAFVHHMVRNITGSLIKVGRGEEKPEWIKWLLEQKDRTLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|257464802|ref|ZP_05629173.1| tRNA pseudouridine synthase A [Actinobacillus minor 202]
 gi|257450462|gb|EEV24505.1| tRNA pseudouridine synthase A [Actinobacillus minor 202]
          Length = 262

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ++  S+Q  +E+A+ +V    V V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQESVESVQQKLEEALSIVANSPVEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +      C   NA+L   D I++     V + FHARFSA  R Y Y I  R+ 
Sbjct: 61  VHFETEAKRPLQAWCFGTNAHL--PDDIAVKWAVEVPEDFHARFSATARRYRYIIFNRKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M  A Q+L+G +DF++FR+  CQ+ +P R I H +V+  G
Sbjct: 119 RSAILPKGVSHYHVDLDHEKMHEAGQYLLGENDFSSFRAAKCQSHTPWRNIHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ +DR    P A  EGLY 
Sbjct: 179 AYIIVDIQANAFVHHMVRNIVGSLIEVGQGNQPPEWIKWLLEQKDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|297528514|ref|YP_003669789.1| tRNA pseudouridine synthase A [Geobacillus sp. C56-T3]
 gi|297251766|gb|ADI25212.1| tRNA pseudouridine synthase A [Geobacillus sp. C56-T3]
          Length = 258

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 123/246 (50%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            R   II Y+G+ + G+Q Q    ++QG  E+ +  +  G  V V  +GRTD+GVHA  Q
Sbjct: 3   TRIKCIIAYDGTHFSGYQIQPGKRTVQGEFEEVLRRMHKGTKVRVAASGRTDAGVHAYGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD           KALNA L   D I +  +   D  FHARFSA  + Y Y++ T  
Sbjct: 63  VIHFDTSLSLSSEQWKKALNAQL--PDDIVVRFVQEADADFHARFSAKAKEYRYKVWTAA 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +      P SL    M  A + L G HDFT+F S        +RT+   +V + 
Sbjct: 121 ERDVFRRHYCAWHPYSLHISAMNEALRLLHGTHDFTSFCSAKTLIEDRVRTMYRAEVKAD 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G ++E R V   FL+  +R  VG++  +G GK +  D+   L A+DR+  GP AP EGLY
Sbjct: 181 GPMLEFRFVGSGFLYNMVRIIVGTVLEIGQGKRSPADISMLLAAKDRRLAGPTAPAEGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LWRVYY 246


>gi|253579808|ref|ZP_04857076.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848807|gb|EES76769.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 246

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q NG ++QG +   +  + GE +   GA RTD+GVHA+  
Sbjct: 1   MKRIGLVVAYDGTNYCGWQTQPNGITVQGVLNDTLSELLGEKIETIGASRTDAGVHAMGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  ALN  L   + I I     V+  FH R+    ++Y YRI+ R+
Sbjct: 61  VAVFDTNTRIPGEKISYALNQRL--PEDIRIQLSEEVEPDFHPRYCDSEKTYEYRILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  E+   +     LD + M+ A  +L+G+HDF +F     Q  + IRT+   DV   
Sbjct: 119 FPVPTERLYTYFYHYKLDVDKMKAATSYLIGQHDFASFCGAKAQVKTTIRTVTGIDVWRD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+++ IRV    FL+  +R   G+L  VG+G++    ++  L+A +R+  GP AP +GL 
Sbjct: 179 GDIVTIRVTGTGFLYNMVRIISGTLIEVGNGQYPPERVKTILEACNREMAGPTAPAQGLT 238

Query: 241 FDSVEY 246
              +E+
Sbjct: 239 LMGIEF 244


>gi|118589718|ref|ZP_01547123.1| tRNA pseudouridine synthase A [Stappia aggregata IAM 12614]
 gi|118437804|gb|EAV44440.1| tRNA pseudouridine synthase A [Stappia aggregata IAM 12614]
          Length = 266

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 121/246 (49%), Positives = 155/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  + GWQRQ N  S+Q  IE+A    +GE V + GAGRTD+GVHA  Q
Sbjct: 1   MPRYKLTVEYDGRPFSGWQRQANAPSVQAVIERAAKAFSGEEVTIGGAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL ++W    +  ALN +    D + IL+ + + + F ARFSAIRRSY YRI  R 
Sbjct: 61  VCHVDLSKDWDARTVMGALNFH-CQPDPVVILDAAEMHEGFDARFSAIRRSYRYRIHNRL 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL  + G AW +   LD + M  AAQ  VG HDFTTFR   CQA SP +T++ F V   
Sbjct: 120 PPLTHQLGLAWHVKVHLDADAMHAAAQEFVGHHDFTTFRHTRCQAKSPEKTLEEFRVYRD 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  +     +RSFLH Q+RS VGSL+LVG+GKW   D+ KAL A+DR  CGP+AP +GLY
Sbjct: 180 GEFVIAECASRSFLHNQVRSMVGSLRLVGEGKWGPGDITKALAARDRNACGPVAPADGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTRVDY 245


>gi|59712303|ref|YP_205079.1| tRNA pseudouridine synthase A [Vibrio fischeri ES114]
 gi|197334265|ref|YP_002156517.1| tRNA pseudouridine synthase A [Vibrio fischeri MJ11]
 gi|62901138|sp|Q5E455|TRUA_VIBF1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238690294|sp|B5FFN7|TRUA_VIBFM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|59480404|gb|AAW86191.1| pseudouridylate synthase I [Vibrio fischeri ES114]
 gi|197315755|gb|ACH65202.1| tRNA pseudouridine synthase A [Vibrio fischeri MJ11]
          Length = 262

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 137/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ++ +S+Q  +EKA+ +V  E + VH AGRTD+GVH   QV
Sbjct: 1   MRIALCIEYDGAEYYGWQRQRDVNSVQEELEKALTIVANEPIEVHCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD              NA L     I++     V++ FHARF+A  R Y Y I   + 
Sbjct: 61  VHFDTTSSRKLAAWMMGANANL--PKNIAVRWAKEVNEDFHARFTATARRYRYIIYNNRL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+          +LD   M  A Q+L+G +DFT+FR++HCQ+ SP R + H  V   G
Sbjct: 119 RPAILGHGVSHYHDALDANLMHEAGQYLLGENDFTSFRAVHCQSRSPWRNLMHLKVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG GK     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 DFIVIDIKANAFVHHMVRNITGSLIEVGKGKQKPEWIKWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|332678185|gb|AEE87314.1| tRNA pseudouridine synthase A [Francisella cf. novicida Fx1]
          Length = 258

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    E       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IINFYSDAERPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|83859280|ref|ZP_00952801.1| tRNA pseudouridine synthase A [Oceanicaulis alexandrii HTCC2633]
 gi|83852727|gb|EAP90580.1| tRNA pseudouridine synthase A [Oceanicaulis alexandrii HTCC2633]
          Length = 253

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 126/246 (51%), Positives = 159/246 (64%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQRQ NG S+QG++E A   + G    V+GAGRTDSGVHAL Q
Sbjct: 1   MPRYKLTIEYDGGPFVGWQRQDNGPSVQGALEAAAAKLDGGPREVYGAGRTDSGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++     +  A+N +LK    I+++    V  +FHARF A RR Y+YR+  R+
Sbjct: 61  VAHVDLEKDLPADKVRDAINHHLK-PHPIAVVEAVRVTDEFHARFKAHRRGYIYRLHARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APL L +G+ W + + LD E M  AAQHLVG HDFTTFR   CQA SP++++D   V   
Sbjct: 120 APLTLTRGQVWRVYQPLDVEAMHTAAQHLVGTHDFTTFRDSQCQADSPVKSLDKIAVFHS 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I + V A SFLH Q+RS VGSL  VG GKWT  D + AL A DR  CGP+APP+GLY
Sbjct: 180 GEEIHVTVEAISFLHRQVRSIVGSLVEVGLGKWTPEDFKAALDAADRSRCGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LSLVAY 245


>gi|254501121|ref|ZP_05113272.1| tRNA pseudouridine synthase A [Labrenzia alexandrii DFL-11]
 gi|222437192|gb|EEE43871.1| tRNA pseudouridine synthase A [Labrenzia alexandrii DFL-11]
          Length = 272

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 119/246 (48%), Positives = 157/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  + GWQRQ N  S+Q  IE+AI   +GE V + GAGRTD+GVHA  Q
Sbjct: 1   MPRYKLTVEYDGRPFSGWQRQANAPSVQAVIERAIKAFSGEEVTIGGAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL ++W    +  ALN +    D + IL+   + + F ARFSAIRR+Y YRI  R 
Sbjct: 61  VCHADLSKQWPTKTVMGALNFH-CQPDPVVILDCEEMHEGFDARFSAIRRAYRYRIHNRL 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL  + G AW +   LD + M  AAQ  VG HDFTTFR   CQA SP +T++HF V   
Sbjct: 120 QPLTHQLGLAWHVKHELDADAMHQAAQEFVGHHDFTTFRHSRCQAKSPEKTLEHFSVYRD 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +     +RSFLH Q+RS VG+L+LVG+ +W   D+  AL+A+DRK CGP+AP +GLY
Sbjct: 180 GDFVIAECSSRSFLHNQVRSMVGTLRLVGEDRWGPGDITNALKARDRKACGPVAPADGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTRVDY 245


>gi|208779289|ref|ZP_03246635.1| tRNA pseudouridine synthase A [Francisella novicida FTG]
 gi|208745089|gb|EDZ91387.1| tRNA pseudouridine synthase A [Francisella novicida FTG]
          Length = 258

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    E       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSDAERPLSAWQRGVNALL--PQDIKILAVQQVDNDFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD   M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIYKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|319952056|ref|YP_004163323.1| tRNA pseudouridine synthase a [Cellulophaga algicola DSM 14237]
 gi|319420716|gb|ADV47825.1| tRNA pseudouridine synthase A [Cellulophaga algicola DSM 14237]
          Length = 250

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 81/245 (33%), Positives = 123/245 (50%), Gaps = 4/245 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY +   Y G  Y GWQ+Q N  ++QG +E A+  +    +++ GAGRTD+GVHA    
Sbjct: 1   MRYFIRFSYFGKHYHGWQKQPNAVTVQGVLEDALSKLLANEIILMGAGRTDAGVHAKELY 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD             LNA+L     I+IL++  V +  HARF+A+ R+Y Y I   Q 
Sbjct: 61  AHFDFEEIPNKENFVFRLNAFL--PKDIAILDVFQVPEDAHARFNAVARTYEYWI--VQQ 116

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
                   A LI   LD   M  AAQ  +   DF  F   +   ++    + + +     
Sbjct: 117 KNPFLTNHAHLIKYPLDINKMNEAAQVFLSHIDFECFSKSNTAVNTFNCDVKYAEWKVTD 176

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
            ++   + A  FL   +R+ VG+L  VG GK   ++++  L+++DR + G  AP +GLY 
Sbjct: 177 GILVFTITADRFLRNMVRAIVGTLLEVGLGKIDISNVKAILKSKDRSKAGASAPAKGLYL 236

Query: 242 DSVEY 246
            SV Y
Sbjct: 237 TSVLY 241


>gi|56708110|ref|YP_170006.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670581|ref|YP_667138.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis FSC198]
 gi|224457202|ref|ZP_03665675.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370594|ref|ZP_04986599.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874909|ref|ZP_05247619.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|62901197|sp|Q5NG36|TRUA_FRATT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|123169371|sp|Q14HI8|TRUA_FRAT1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|56604602|emb|CAG45654.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320914|emb|CAL09037.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis FSC198]
 gi|151568837|gb|EDN34491.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840908|gb|EET19344.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159310|gb|ADA78701.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 258

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    +       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNADRPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|167036834|ref|YP_001664412.1| tRNA pseudouridine synthase A [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167039553|ref|YP_001662538.1| tRNA pseudouridine synthase A [Thermoanaerobacter sp. X514]
 gi|256752665|ref|ZP_05493517.1| tRNA pseudouridine synthase A [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300915196|ref|ZP_07132511.1| tRNA pseudouridine synthase A [Thermoanaerobacter sp. X561]
 gi|307725120|ref|YP_003904871.1| tRNA pseudouridine synthase A [Thermoanaerobacter sp. X513]
 gi|320115256|ref|YP_004185415.1| tRNA pseudouridine synthase A [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|238687621|sp|B0K5S6|TRUA_THEPX RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238687718|sp|B0KCN3|TRUA_THEP3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166853793|gb|ABY92202.1| tRNA pseudouridine synthase A [Thermoanaerobacter sp. X514]
 gi|166855668|gb|ABY94076.1| tRNA pseudouridine synthase A [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|256748485|gb|EEU61537.1| tRNA pseudouridine synthase A [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300888920|gb|EFK84067.1| tRNA pseudouridine synthase A [Thermoanaerobacter sp. X561]
 gi|307582181|gb|ADN55580.1| tRNA pseudouridine synthase A [Thermoanaerobacter sp. X513]
 gi|319928347|gb|ADV79032.1| tRNA pseudouridine synthase A [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 244

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 140/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +++EY+G+ Y GWQ QKN  ++Q  ++KAI  VTGE V + GA RTD+GVHAL Q
Sbjct: 1   MRNVMIVVEYDGTNYHGWQYQKNAVTVQEVLQKAIKKVTGEEVNLIGASRTDTGVHALYQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F    +     L  ALN+ L   D I ++    V+  FHAR+SA R+ Y Y I+ R+
Sbjct: 61  VANFKTNTKIPAEKLPYALNSVL--PDDIVVVQAKDVEDSFHARYSAKRKRYKYIILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +   +   W I   L+ E M+ AA +L+G HDF+ F++     +S IRT+    +   
Sbjct: 119 FQMPTMRNYCWHISYPLNIEEMKKAASYLIGTHDFSAFKASGSSKTSTIRTVYDLTIEKN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I I + A  FL+  +R  VG+L  VG GK    ++   L+++DR + G  APP+GLY
Sbjct: 179 EDFINIEIEANGFLYNMVRIIVGTLSYVGLGKIKEDEVYDILKSKDRTKAGITAPPQGLY 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LIKIIY 244


>gi|330446609|ref|ZP_08310261.1| tRNA pseudouridine synthase A [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490800|dbj|GAA04758.1| tRNA pseudouridine synthase A [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 261

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G+ Y+GWQRQ++  S+Q  +EKA+  V  + + V  AGRTD+GVH   QV
Sbjct: 1   MRIALGVEYDGAKYYGWQRQRDVDSVQERLEKALSKVANQPIEVFCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+  +   V      NA L     I++   + V + FHARF+A  R Y Y I     
Sbjct: 61  VHFDVNIDRKMVAWTMGANANL--PKDIAVRWATEVSEDFHARFTATARRYRYIIFNNAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q+L+G +DFT+FR++HCQ+ SP R + H  V   G
Sbjct: 119 RPAILGTGVSHYHGHLDEKKMHEAGQYLLGENDFTSFRAVHCQSRSPWRNLMHLKVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+     ++  L+ +DR   G  A  EGLY 
Sbjct: 179 DFVIIDIKANAFVHHMVRNITGSLIKVGKGEEKPEWIKWLLEQKDRTLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|254374311|ref|ZP_04989793.1| tRNA pseudouridine synthase A [Francisella novicida GA99-3548]
 gi|151572031|gb|EDN37685.1| tRNA pseudouridine synthase A [Francisella novicida GA99-3548]
          Length = 258

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    +       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNADRPLSAWQRGVNALL--PKDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|325291802|ref|YP_004277666.1| tRNA pseudouridine synthase A [Agrobacterium sp. H13-3]
 gi|325059655|gb|ADY63346.1| tRNA pseudouridine synthase A [Agrobacterium sp. H13-3]
          Length = 266

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 148/247 (59%), Positives = 187/247 (75%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ M +EY+G+ YFGWQRQ NG S+QG++E A+  +TGE V + GAGRTDSGVHA+ Q
Sbjct: 1   MPRFRMTVEYDGTPYFGWQRQDNGPSVQGALEAAVRSLTGETVSIRGAGRTDSGVHAVGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKI-SDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL R+W P  L  ALNA+L +  + +S+++++ V + F ARFSA+RR YLYRII R
Sbjct: 61  VAHVDLSRDWAPYKLRNALNAHLAMAKEAVSVIDVTAVTEDFDARFSALRRHYLYRIICR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +A LALE  RAW + K LD E M  AAQ LVGRHDFTTFRS+HCQASSP+RT+D  DV  
Sbjct: 121 KARLALEHKRAWWVSKDLDHERMHEAAQMLVGRHDFTTFRSVHCQASSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+LIEIR  A+SFLH QIRSF G+LK+ G+G  T  D+  AL+A+DRK CGP+APP+GL
Sbjct: 181 NGDLIEIRATAQSFLHNQIRSFAGTLKMAGEGSMTPEDVRAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMQVDY 247


>gi|118497491|ref|YP_898541.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           novicida U112]
 gi|195536184|ref|ZP_03079191.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           novicida FTE]
 gi|254372827|ref|ZP_04988316.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|166228699|sp|A0Q6C2|TRUA_FRATN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|118423397|gb|ABK89787.1| tRNA pseudouridine synthase A [Francisella novicida U112]
 gi|151570554|gb|EDN36208.1| tRNA pseudouridine synthase A [Francisella novicida GA99-3549]
 gi|194372661|gb|EDX27372.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           novicida FTE]
          Length = 258

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGRNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    E       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSDAERPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|291548427|emb|CBL21535.1| pseudouridylate synthase I [Ruminococcus sp. SR1/5]
          Length = 245

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q NG +IQG +   +  + GE +   GA RTD+GVHAL  
Sbjct: 1   MKRVGLVVAYDGTKYSGWQTQPNGITIQGVLNDTLSELLGEKIETIGASRTDAGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN  L   + I I     V+  FH R+    ++Y YRI+ R+
Sbjct: 61  VAVFDTESRIPGEKFSYALNQRL--PEDIRIQLSEEVEPDFHPRYCDSEKTYEYRILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  E+  ++     LD + M+ A  +L+GRHDF +F     Q  + IRT+   DV   
Sbjct: 119 FPVPTERLYSYFYHYKLDVDKMKEATSYLIGRHDFASFCGSGAQVKTTIRTVTSMDVWRD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+++ IR+    FL+  +R   G+L  +G+G++    ++K L+A DR   GP AP +GL 
Sbjct: 179 GDMVTIRISGTGFLYNMVRIISGTLIEIGNGQYPPERMDKILKACDRGAAGPTAPAQGLT 238

Query: 241 FDSVEY 246
              +E+
Sbjct: 239 LMGIEF 244


>gi|262402660|ref|ZP_06079221.1| tRNA pseudouridine synthase A [Vibrio sp. RC586]
 gi|262351442|gb|EEZ00575.1| tRNA pseudouridine synthase A [Vibrio sp. RC586]
          Length = 264

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDIAVRWATAVPDDFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ ++R      A  EGLY 
Sbjct: 179 RYVVIDLKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLEQKNRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|258627102|ref|ZP_05721898.1| tRNA pseudouridine synthase A [Vibrio mimicus VM603]
 gi|258580620|gb|EEW05573.1| tRNA pseudouridine synthase A [Vibrio mimicus VM603]
          Length = 264

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     +++   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDVAVRWATAVPDDFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R I H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNIMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ ++R      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLEQKNRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|144900443|emb|CAM77307.1| Pseudouridylate synthase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 245

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 125/246 (50%), Positives = 164/246 (66%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ ++IEY+G+ + GWQRQ NG S+QG +E AIF   G    V  AGRTD+GVHA  Q
Sbjct: 1   MPRFKLLIEYHGTPFVGWQRQDNGISVQGEVEAAIFRFCGLETTVTAAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFDL R+     +  ALN +LK    I++  + IV   FHARFSA+ RSYLYRI+ R+
Sbjct: 61  VIHFDLDRDVSAERVQGALNYHLK-PHPIAVRAVEIVPDDFHARFSALGRSYLYRIVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP+A+E+ R W +   L+ E M+ AAQHL+GRHDFT+FR+  CQA SP +T+D   V   
Sbjct: 120 APVAIERERVWWVSVPLNAEAMQEAAQHLLGRHDFTSFRAAACQAQSPDKTLDLLQVTRT 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I +   ARSFLH Q+R+ VG+LKLVG+GKW    ++ AL+A+DR   GP APP+GLY
Sbjct: 180 DEEIRMIAEARSFLHHQVRNMVGTLKLVGEGKWHPDRVKAALEARDRAAAGPTAPPDGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LTGVVY 245


>gi|205372037|ref|ZP_03224854.1| tRNA pseudouridine synthase A [Bacillus coahuilensis m4-4]
          Length = 251

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 81/247 (32%), Positives = 134/247 (54%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R    ++Y+G+ Y G+Q Q N  +IQG IEK +  + G+ + +  +GRTD+GVHA+ Q
Sbjct: 4   MRRIKCTVQYDGTWYAGYQVQPNSKTIQGEIEKVLEKIHGKPIRISASGRTDAGVHAIGQ 63

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   ++         N+ L   + I ++++  V   FH+RF +I + Y Y++    
Sbjct: 64  VFHFDTDTKFPVEKWLPIFNSQL--PNDIVVIHVEEVAGSFHSRFGSIEKEYRYKVYRAP 121

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                    A+ +P SL  + M  A+++L+G HDFT+F S   +    +RTI    +   
Sbjct: 122 HKSPFLIHHAYHVPHSLSVQKMEEASRYLLGTHDFTSFCSAKTEVEDKVRTIFTISIEEE 181

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            N++   +V   FL+  +R  +G L  VG GK    ++++ L+A+DR+  G  AP +GLY
Sbjct: 182 ENMLTFSLVGNGFLYNMVRIIIGVLIEVGQGKRAPIEVKEILEAKDRRAGGKTAPAQGLY 241

Query: 241 FDSVEYS 247
              V+YS
Sbjct: 242 LYRVKYS 248


>gi|197302933|ref|ZP_03167984.1| hypothetical protein RUMLAC_01661 [Ruminococcus lactaris ATCC
           29176]
 gi|197298014|gb|EDY32563.1| hypothetical protein RUMLAC_01661 [Ruminococcus lactaris ATCC
           29176]
          Length = 297

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q N ++I+G +   +  +TG+ V V GA RTD+GVHA   
Sbjct: 26  MKRIRLTVAYDGTDYCGWQVQNNVATIEGELNTVLTQLTGQTVKVIGASRTDAGVHARGN 85

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P     A+NA L   + I +++   V   +H R     ++Y YR++ ++
Sbjct: 86  VAVFDTESSIPPERFLYAVNALL--PEDIVVVDSCEVAADWHPRHCNTEKTYEYRVLNQK 143

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  + +   + +   LD E MR AA +L G HDF +F ++H      +RTI   +V   
Sbjct: 144 LPDPMRRRDTYFVSFPLDLERMRQAAGYLEGEHDFKSFCNVHTHVEDTVRTIYRLEVIRE 203

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            N+I  RV    FL+  +R   G+L  VG G     ++   L+A+DR+  G   PP+GL 
Sbjct: 204 ENVITFRVRGNGFLYNMVRILAGTLIGVGRGLIDPEEIPAMLEAKDRQAAGMTVPPQGLT 263

Query: 241 FDSVEY 246
              ++Y
Sbjct: 264 LMKIDY 269


>gi|195940683|ref|ZP_03086065.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4024]
 gi|295098046|emb|CBK87136.1| pseudouridylate synthase I [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 270

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 10  HRIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPISVFCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L     I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 70  VHFDTTAVRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYVIYNQRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V+ +G
Sbjct: 128 RPAVLSQGVTHFYEPLDAERMQRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHINVSRYG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGAGHQPESWIAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            SV+Y
Sbjct: 248 VSVDY 252


>gi|163795438|ref|ZP_02189405.1| Pseudouridylate synthase [alpha proteobacterium BAL199]
 gi|159179424|gb|EDP63955.1| Pseudouridylate synthase [alpha proteobacterium BAL199]
          Length = 248

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 120/247 (48%), Positives = 169/247 (68%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ + GWQRQ NG+++QG+IE A+F  +G+ V V GAGRTD+GVHA  Q
Sbjct: 1   MTRYRLTVEYDGAPFVGWQRQDNGATVQGAIEDAVFAFSGQRVEVAGAGRTDTGVHAEGQ 60

Query: 61  VAHFDLVREWVP-VILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL  +    V +  A+NA+L+    +++++ S+    FHARFSAI RSY Y I+ R
Sbjct: 61  VAHIDLATDRFDAVTVMNAINAHLR-PLPVAVVSASVASPDFHARFSAIWRSYRYVIVNR 119

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLAL+ GRAW +   LD   M   A+ L+G HDFT+FR++HCQ+ SP++T+D   V+ 
Sbjct: 120 RAPLALDLGRAWSVLAPLDVAAMSAGAERLIGHHDFTSFRAVHCQSKSPMKTLDVLQVSR 179

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH Q+R+ VG+L+LVG+GKW   D+  AL+A+DR   GP AP +GL
Sbjct: 180 HGERIVVEARARSFLHHQVRNMVGTLRLVGEGKWQPDDVTAALKARDRVAAGPTAPADGL 239

Query: 240 YFDSVEY 246
              +V Y
Sbjct: 240 TLTAVGY 246


>gi|317497062|ref|ZP_07955389.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316895607|gb|EFV17762.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 252

 Score =  198 bits (504), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+GY GWQ Q N  +++G + K I  +TGE + V GA RTDSGVHAL  
Sbjct: 1   MKRVKLIVAYDGTGYCGWQVQPNEITVEGVLNKHISELTGEDIKVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         + KALNA L   + I I +   V   +H RF   R++Y Y     +
Sbjct: 61  VAVFDTESRIPGEKMAKALNARL--PEDIIIQDSKEVPLDYHPRFQDTRKTYEYTFYNAR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +       +   LD E M+ AA + +G H F +  S   Q +S +R I   DV   
Sbjct: 119 YDNPVTSRHHHFVYVPLDVEKMKEAASYFLGEHCFISMCSSKAQVTSYVREIYECDVTQN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I +RV    FL+  +R   G+L  VG GK     +++ L +++R   GP  P +GL 
Sbjct: 179 GRYITMRVTGSGFLYNMVRLMAGTLLEVGRGKQEPQWVKEILASKERVTPGPKLPAKGLT 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LIQIEY 244


>gi|332970797|gb|EGK09777.1| tRNA pseudouridine synthase A [Desmospora sp. 8437]
          Length = 258

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 84/248 (33%), Positives = 128/248 (51%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + + Y+G+ + G+QRQ    ++QG++E+ +  VTGE + V GAGRTD+GVHAL Q
Sbjct: 1   MGKIKLTVAYDGTDFSGFQRQPGKRTVQGTLEETLTRVTGETISVTGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+           + LNA L     + +     V ++FHAR+ A  + Y Y + T  
Sbjct: 61  VIHFETSVPIPTERWVRLLNASL--PRDLLVTQAKEVPREFHARYDACWKHYRYTLDTCP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +      P  L  + M+ AA+HL G HDFT+F +   Q     R++ H +V   
Sbjct: 119 IPDLFRRRYQTHYPHPLSRDRMQRAARHLTGTHDFTSFSAARAQVKDRRRSLYHCEVKEV 178

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              ++ I VV   FL+  +R   G+L  +G GK    ++   L+A+DR   G   PPEGL
Sbjct: 179 NPGVLSIEVVGDGFLYHMVRILTGTLVEIGAGKIPPDEIRGILKAKDRSAAGKTFPPEGL 238

Query: 240 YFDSVEYS 247
               V Y+
Sbjct: 239 VMVEVGYT 246


>gi|167767771|ref|ZP_02439824.1| hypothetical protein CLOSS21_02306 [Clostridium sp. SS2/1]
 gi|167710510|gb|EDS21089.1| hypothetical protein CLOSS21_02306 [Clostridium sp. SS2/1]
 gi|291558888|emb|CBL37688.1| pseudouridylate synthase I [butyrate-producing bacterium SSC/2]
          Length = 252

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 125/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+GY GWQ Q N  +++G + K I  +TGE + V GA RTDSGVHAL  
Sbjct: 1   MKRVKLIVAYDGTGYCGWQVQPNEITVEGVLNKHISELTGEDIKVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         + KALNA L   + I I +   V   +H RF   R++Y Y     +
Sbjct: 61  VAVFDTESRIPGEKMAKALNARL--PEDIIIQDSKEVPLDYHPRFQDTRKTYEYTFYNAR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +       +   LD E M+ AA + +G H F +  S   Q +S +R I   DV   
Sbjct: 119 YDNPVTSRHHHFVYVPLDVEKMKEAASYFLGEHCFISMCSSKAQVTSYVREIYECDVTQN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I++RV    FL+  +R   G+L  VG GK     +++ L +++R   GP  P +GL 
Sbjct: 179 GRYIKMRVTGSGFLYNMVRLMAGTLLEVGRGKQEPQWVKEILASKERVTPGPKLPAKGLT 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LIQIEY 244


>gi|261211961|ref|ZP_05926247.1| tRNA pseudouridine synthase A [Vibrio sp. RC341]
 gi|260838569|gb|EEX65220.1| tRNA pseudouridine synthase A [Vibrio sp. RC341]
          Length = 264

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++   S V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDIAVRWASSVPDDFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHCELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNLMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ ++R      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLEQKNRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|328676060|gb|AEB28735.1| tRNA pseudouridine synthase A [Francisella cf. novicida 3523]
          Length = 258

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 127/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  SIQ  +EKA+  +    + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSIQAELEKALSKIANRNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F    +       +  NA L     I IL    V+  F++RF+AI R+Y Y I    
Sbjct: 61  VVNFHSDADRPLSAWQRGANALL--PHDIKILAAQEVNDDFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKLVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|315651854|ref|ZP_07904857.1| tRNA pseudouridine synthase A [Eubacterium saburreum DSM 3986]
 gi|315485856|gb|EFU76235.1| tRNA pseudouridine synthase A [Eubacterium saburreum DSM 3986]
          Length = 245

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ+Q NG +++  + +AI  +TGE + V GA RTDSGVHA   
Sbjct: 1   MRRIRLIVSYDGTNYCGWQKQPNGITVEEILNRAISKLTGEEIEVIGASRTDSGVHAYGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            A+N  L   D I I     V+  +H R +   ++Y YRI+ R+
Sbjct: 61  VAVFDTNVRMAADKFAFAINQRL--PDDIRIQYSDEVESDWHPRKNDCIKTYTYRILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +  E+  A     +LD E MR A+ + +G HDFT+F S   QASSPIRT+   +V   
Sbjct: 119 IDIPTERLYAHFCYFNLDVEKMREASGYFIGTHDFTSFCSQKSQASSPIRTVFSLEVLQD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            ++I I V    FL+  IR   G+L  VG G +  + + + ++A++RK  G   P +GL 
Sbjct: 179 EDMITIVVRGDGFLYNMIRIIAGTLIKVGMGVYPPSHITEIMKAKERKFAGQTMPAKGLT 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LVEIEY 244


>gi|163801903|ref|ZP_02195800.1| tRNA pseudouridine synthase A [Vibrio sp. AND4]
 gi|159174411|gb|EDP59215.1| tRNA pseudouridine synthase A [Vibrio sp. AND4]
          Length = 264

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+   S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTNYFGWQRQREVKSVQQELEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA   +   I++     V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNVSRKMVAWTMGANAN--MPSDIAVRWAVEVSDDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DF++FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDEKKMHEAGQYLLGENDFSSFRAAHCQSLSPCRNMMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+     ++  L A+DRK  G  A  EGLY 
Sbjct: 179 DYVVIDIKANAFVHHMVRNITGSLIKVGRGEEKPAWIKSLLDAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|258622013|ref|ZP_05717042.1| tRNA pseudouridine synthase A [Vibrio mimicus VM573]
 gi|258585766|gb|EEW10486.1| tRNA pseudouridine synthase A [Vibrio mimicus VM573]
          Length = 264

 Score =  198 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     +++   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDVAVRWATAVPDDFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R I H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNIMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ ++R      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLEQKNRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|227820646|ref|YP_002824616.1| tRNA pseudouridine synthase A [Sinorhizobium fredii NGR234]
 gi|254764861|sp|C3MF26|TRUA_RHISN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|227339645|gb|ACP23863.1| tRNA pseudouridine synthase A [Sinorhizobium fredii NGR234]
          Length = 247

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 154/247 (62%), Positives = 186/247 (75%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+GS Y GWQRQ+NG S+QG+IEKA+  +TGE V + GAGRTDSGVHA+ Q
Sbjct: 1   MPRYRLTVEYDGSDYVGWQRQENGPSVQGAIEKAVLSLTGETVSIRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWV-PVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL REW    +           ++ +SIL+ + V  +F ARFSAIRR YLYRII+R
Sbjct: 61  VAHLDLTREWKTHTLRNALNAHLALAAERVSILDAAEVPPEFDARFSAIRRHYLYRIISR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++PLALE  RAW +PK+LD E M  AAQHLVG HDFTTFRS HCQA+SP+RTID  DV  
Sbjct: 121 RSPLALEARRAWWVPKTLDHEAMHEAAQHLVGHHDFTTFRSAHCQANSPLRTIDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF GSLKLVG+GKWT  DL+ AL+A+DRK CGP+APPEGL
Sbjct: 181 SGELIEIRATAQSFLHNQIRSFAGSLKLVGEGKWTPDDLKTALEARDRKACGPVAPPEGL 240

Query: 240 YFDSVEY 246
           +F  V+Y
Sbjct: 241 FFMQVDY 247


>gi|262165233|ref|ZP_06032970.1| tRNA pseudouridine synthase A [Vibrio mimicus VM223]
 gi|262024949|gb|EEY43617.1| tRNA pseudouridine synthase A [Vibrio mimicus VM223]
          Length = 264

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    + V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPIEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     +++   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDVAVRWATAVPDDFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ ++R      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLEQKNRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|283796516|ref|ZP_06345669.1| tRNA pseudouridine synthase A [Clostridium sp. M62/1]
 gi|291075930|gb|EFE13294.1| tRNA pseudouridine synthase A [Clostridium sp. M62/1]
 gi|295092580|emb|CBK78687.1| pseudouridylate synthase I [Clostridium cf. saccharolyticum K10]
          Length = 368

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 130/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +I+  + +A+  +  E + V GA RTDSGVHA+  
Sbjct: 1   MKRIRLTVAYDGTNYCGWQLQPNGITIEEVLNRALSELLKEEIQVVGASRTDSGVHAMGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +A FD      P  +C ALN  L   + + +     V   FH R +   ++Y Y+I+ R+
Sbjct: 61  IAVFDTESRIPPEKICFALNQRL--PEDVRVQKSEEVPLTFHPRKANCVKTYEYKILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS- 179
             + L +         LD E MR AA  LVG HDF +F ++  QA   +RTI    V+  
Sbjct: 119 IDMPLNRLYCHFCYFDLDVEKMRRAAAFLVGEHDFKSFCTVRTQAEETVRTIYSLTVDRG 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             ++I IR+    FL+  +R   G+L  +G G W    +E+ L+A+DR   GP  P +GL
Sbjct: 179 ADDVIVIRISGSGFLYNMVRIITGTLVKIGMGVWPPEYMEEILEARDRAAAGPTIPAKGL 238

Query: 240 YFDSVEY 246
              S+EY
Sbjct: 239 TLVSMEY 245


>gi|90579292|ref|ZP_01235102.1| tRNA pseudouridine synthase A [Vibrio angustum S14]
 gi|90440125|gb|EAS65306.1| tRNA pseudouridine synthase A [Vibrio angustum S14]
          Length = 261

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G+ Y+GWQRQ++  S+Q  +EKA+  V  + V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGVEYDGAKYYGWQRQRDVDSVQERLEKALSKVANQPVEVFCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+  +   V      NA+L     I++   + V + FHARF+A  R Y Y I     
Sbjct: 61  VHFDINIDRKMVAWTMGANAHL--PKDIAVRWATEVSEDFHARFTATARRYRYIIFNNAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q+L+G +DFT+FR++HCQ+ SP R + H  V   G
Sbjct: 119 RPAILGNGVSHYHGHLDEKKMHEAGQYLLGENDFTSFRAVHCQSRSPWRNLMHLKVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+     +E  L  ++R   G  A  EGLY 
Sbjct: 179 DFVIIDIKANAFVHHMVRNITGSLIKVGKGEENPEWIEWLLAQKNRTLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|299132601|ref|ZP_07025796.1| tRNA pseudouridine synthase A [Afipia sp. 1NLS2]
 gi|298592738|gb|EFI52938.1| tRNA pseudouridine synthase A [Afipia sp. 1NLS2]
          Length = 245

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 130/246 (52%), Positives = 169/246 (68%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +IIEY+G+ + GWQ Q NG S+QG++E A+  +TG  V VHGAGRTD+GVHAL Q
Sbjct: 1   MPRYKLIIEYDGTPFCGWQYQDNGPSVQGALEDAVMAMTGSRVRVHGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL + +    +  ALNA+      I +L+  IV   F ARFSA++R Y+YRI  R+
Sbjct: 61  VAHIDLEKTYRADRVRDALNAH-VRPHPIGVLSAEIVPDTFEARFSALKRHYIYRISNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A LAL+ GRAW + + LD   M  AAQ L+G+HDFTTFR   CQA SP +T+D  DV   
Sbjct: 120 ANLALDAGRAWRVARPLDVAAMNEAAQVLIGKHDFTTFRDTECQAKSPDKTLDQLDVIRD 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + I   ARSFLH+Q+RS VGSL  VG G+WT+ D+ KAL A++R  CGP+APP+GLY
Sbjct: 180 GDTVNIVTSARSFLHSQVRSMVGSLVWVGHGRWTAADMRKALDARNRAACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LVKVDY 245


>gi|302388745|ref|YP_003824566.1| tRNA pseudouridine synthase A [Thermosediminibacter oceani DSM
           16646]
 gi|302199373|gb|ADL06943.1| tRNA pseudouridine synthase A [Thermosediminibacter oceani DSM
           16646]
          Length = 243

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +   +++EY+G+ Y GWQ+Q N  S+Q  +EKAI+ +TGE V + GAGRTD+GVHA  QV
Sbjct: 1   MNVKILLEYDGTNYHGWQKQNNALSVQEVLEKAIYALTGERVSIIGAGRTDAGVHARGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A+F          L  A+N+ L   + I++     V   FHAR+SA  + Y Y I     
Sbjct: 61  ANFRTNTRIPVERLPYAINSKL--PEDIAVKGAEAVPDDFHARYSAKAKVYTYSIYNAPF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P  L +  ++  P  LD E MR AA+  +G HDF  FR+      + +R I   DV   G
Sbjct: 119 PSPLLRRYSYFFPLPLDVEAMRRAAKAFIGVHDFAAFRASGSSVKTSVRNITRLDVKKCG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
            L+ I V A  FL+  +R   G+L  VG GK    ++   ++++DR+  G   P  GL  
Sbjct: 179 KLLTIEVEADGFLYNMVRIIAGTLLEVGTGKKDPEEIPSIIESRDRERAGVTLPAHGLCL 238

Query: 242 DSVEY 246
           + V Y
Sbjct: 239 EKVIY 243


>gi|323499722|ref|ZP_08104688.1| tRNA pseudouridine synthase A [Vibrio sinaloensis DSM 21326]
 gi|323315224|gb|EGA68269.1| tRNA pseudouridine synthase A [Vibrio sinaloensis DSM 21326]
          Length = 264

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ Y+GWQRQ+   S+Q ++EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTQYYGWQRQQEVKSVQEALEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA L     +++     V + FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTASRKMVAWTMGANANL--PSDVAVRWAKEVPEDFHARFSATARRYRYIIFNSAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  AAQ+L+G +DFT+FR+ HCQ+ SP R + H +V    
Sbjct: 119 RPGILSSGVSHYHGELDEKKMHQAAQYLLGENDFTSFRATHCQSRSPWRNMMHINVTRHN 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     +E  LQA+DRK  G  A  EGLY 
Sbjct: 179 QYVVIDIKANAFVHHMVRNITGSLICVGRGEQKPEWIEWLLQAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|209694634|ref|YP_002262562.1| tRNA pseudouridine synthase A [Aliivibrio salmonicida LFI1238]
 gi|238057726|sp|B6EIW6|TRUA_ALISL RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|208008585|emb|CAQ78760.1| tRNA pseudouridine synthase A [Aliivibrio salmonicida LFI1238]
          Length = 262

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 138/245 (56%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y GWQ QK+ +S+Q  +EKA+ +V  E + V  AGRTD+GVH   QV
Sbjct: 1   MRIALCIEYDGASYHGWQSQKDVTSVQEELEKALMVVANEPIEVMCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD        +    +NA L     I++  +  V++ FHARF+A  R Y Y I   + 
Sbjct: 61  VHFDTNSVRKLPVWMVGVNANL--PKNIAVRWVKEVNEDFHARFTATARRYRYIIFNNRQ 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         ++LD + M  A Q+L+G +DFT+FR++ CQ+ +P R + H  V   G
Sbjct: 119 RPAIFSHGVSHYHETLDADLMHEAGQYLLGENDFTSFRAVRCQSRTPWRNLIHLKVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG GK     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 DFIVIDIKANAFVHHMVRNITGSLIEVGRGKQKPEWVQWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 IDVDY 243


>gi|134301921|ref|YP_001121890.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|166228700|sp|A4IXW8|TRUA_FRATW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|134049698|gb|ABO46769.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 258

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q S+EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQESLEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    +       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNADRPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|254473752|ref|ZP_05087147.1| tRNA pseudouridine synthase A [Pseudovibrio sp. JE062]
 gi|211957138|gb|EEA92343.1| tRNA pseudouridine synthase A [Pseudovibrio sp. JE062]
          Length = 302

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 126/246 (51%), Positives = 160/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + I+Y+G  + GWQRQ NG ++QG IE+AI   TGE V + GAGRTDSGVHA  Q
Sbjct: 27  MPRYKITIDYDGRPFVGWQRQDNGPTVQGVIERAIKSFTGETVTIGGAGRTDSGVHATGQ 86

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++W    +  ALN +    D ++IL+       F ARFSAIRR Y Y+I  R 
Sbjct: 87  VAHLDLSKDWPAETVKNALNFH-AQPDPVAILDCEKAGLGFDARFSAIRRHYRYKIANRL 145

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL  ++G AW +   LD E M  AAQ L+G HDFTTFR   CQA SP +T++   V   
Sbjct: 146 EPLTHDRGLAWYVKPELDAEAMNEAAQVLLGHHDFTTFRHTRCQAKSPWKTMERICVYRQ 205

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + +   +RSFLH Q+RS VGSL+LVG+G+WT  DL+ AL+A DRK CGP+A PEGLY
Sbjct: 206 GYHVFLECSSRSFLHNQVRSMVGSLRLVGEGRWTKDDLKAALEACDRKACGPVAVPEGLY 265

Query: 241 FDSVEY 246
              V+Y
Sbjct: 266 LTQVDY 271


>gi|110802389|ref|YP_699630.1| tRNA pseudouridine synthase A [Clostridium perfringens SM101]
 gi|110682890|gb|ABG86260.1| tRNA pseudouridine synthase A [Clostridium perfringens SM101]
          Length = 244

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ YFGWQ+Q  G++IQ  +E+AI  VT E V + G+ RTDSGVHA   
Sbjct: 1   MRNIKLTIEYDGTSYFGWQKQPIGNTIQQKVEEAIKKVTKEEVEILGSSRTDSGVHAKAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN+ L     I I+N   V + FHAR+    ++Y Y I+ R+
Sbjct: 61  VANFKTNSNIPGKNFKAALNSKL--PKDIVIMNSEEVAEDFHARYMTTGKTYCYTILNRE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P ALE+   + + K LD E+M+ A ++ +G+HDF  F+       + +RTI    +   
Sbjct: 119 EPPALERNYVYHVKKQLDVESMKEACKYFLGKHDFKAFQRPGGTVKTSVRTITDIHIEIE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I+I V A  FL+  +R  VG+L  VG GK     +++ + + DRK+ G   PP GL 
Sbjct: 179 GNKIKIYVSADGFLYNMVRLIVGTLLKVGRGKEKPEYIKEVIDSGDRKKAGICVPPTGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|110799502|ref|YP_697060.1| tRNA pseudouridine synthase A [Clostridium perfringens ATCC 13124]
 gi|168205200|ref|ZP_02631205.1| tRNA pseudouridine synthase A [Clostridium perfringens E str.
           JGS1987]
 gi|168211871|ref|ZP_02637496.1| tRNA pseudouridine synthase A [Clostridium perfringens B str. ATCC
           3626]
 gi|110674149|gb|ABG83136.1| tRNA pseudouridine synthase A [Clostridium perfringens ATCC 13124]
 gi|170663322|gb|EDT16005.1| tRNA pseudouridine synthase A [Clostridium perfringens E str.
           JGS1987]
 gi|170710156|gb|EDT22338.1| tRNA pseudouridine synthase A [Clostridium perfringens B str. ATCC
           3626]
          Length = 244

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 137/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ YFGWQ+Q  G++IQ  +E+AI  VT E V + G+ RTDSGVHA   
Sbjct: 1   MRNIKLTIEYDGTSYFGWQKQPIGNTIQQKVEEAIKKVTKEEVEILGSSRTDSGVHAKAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN+ L     I I+N   V + FHAR+    ++Y Y I+ R+
Sbjct: 61  VANFKTNSNIPGKNFKAALNSKL--PKDIVIMNSEEVAEDFHARYMTTGKTYCYTILNRE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P ALE+   + + K LD E+M+ A ++ +G+HDF  F+       + +RTI    + + 
Sbjct: 119 EPPALERNYVYHVKKQLDVESMKEACKYFLGKHDFKAFQRPGGTVKTSVRTITDIHIETE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I+I V A  FL+  +R  VG+L  VG GK     +++ + + DRK+ G   PP GL 
Sbjct: 179 GNKIKIYVSADGFLYNMVRLIVGTLLKVGRGKEKPEYIKEVIDSGDRKKAGICVPPTGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|15887719|ref|NP_353400.1| tRNA pseudouridine synthase A [Agrobacterium tumefaciens str. C58]
 gi|42559844|sp|Q8UIC9|TRUA_AGRT5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|15155280|gb|AAK86185.1| tRNA pseudouridine synthase I [Agrobacterium tumefaciens str. C58]
          Length = 266

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 146/247 (59%), Positives = 187/247 (75%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ M +EY+G+ Y+GWQRQ+NG S+QG++E A+  +TGE V + GAGRTDSGVHA+ Q
Sbjct: 1   MPRFRMTVEYDGTPYYGWQRQENGPSVQGALEAAVRSLTGESVSIRGAGRTDSGVHAVGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKI-SDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL R+W P  L  ALNA+L +  + +++L+ + V + F ARFSA+RR YLYRII R
Sbjct: 61  VAHIDLSRDWEPYKLRNALNAHLAMAGEAVAVLDAAAVTEDFDARFSALRRHYLYRIICR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++ LALE  RAW + K LD E M  AAQ LVGRHDFTTFRS+HCQA+SP+RT+D  DV  
Sbjct: 121 KSRLALEHKRAWWVSKDLDHERMHEAAQMLVGRHDFTTFRSVHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+LIEIR  A+SFLH QIRSF G+LKL G+G  T  D+  AL+A+DRK CGP+APP+GL
Sbjct: 181 NGDLIEIRATAQSFLHNQIRSFAGTLKLAGEGGMTPDDVRAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMQVDY 247


>gi|187931655|ref|YP_001891639.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|238691562|sp|B2SGK2|TRUA_FRATM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|187712564|gb|ACD30861.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 258

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    +       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNADRPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+ +DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEVKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|254369374|ref|ZP_04985386.1| hypothetical protein FTAG_00346 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122324|gb|EDO66464.1| hypothetical protein FTAG_00346 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 258

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F            + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNAYRPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|86356072|ref|YP_467964.1| tRNA pseudouridine synthase A [Rhizobium etli CFN 42]
 gi|86280174|gb|ABC89237.1| tRNA pseudouridine synthase A protein [Rhizobium etli CFN 42]
          Length = 267

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 154/247 (62%), Positives = 191/247 (77%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V V GAGRTDSGVHA+ Q
Sbjct: 1   MPRYRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSVRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL +EW P  L  ALNA+L+   + +SIL+++ V + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKEWSPYQLQNALNAHLRLAGERVSILDVAAVPEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK+LD E M  AAQ LVGRHDF+TFRS HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKTLDDEVMHAAAQRLVGRHDFSTFRSAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 SGALIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFLQVDY 247


>gi|327191110|gb|EGE58158.1| tRNA-pseudouridine synthase I protein [Rhizobium etli CNPAF512]
          Length = 266

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 154/247 (62%), Positives = 190/247 (76%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V V GAGRTDSGVHA+ Q
Sbjct: 1   MPRYRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSVRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL +EW P  L  ALNA+L+   + +SIL++  V + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKEWSPYQLQNALNAHLRLAGERVSILDVEAVPEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK+LD E M  AAQ LVGRHDF+TFRS HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKTLDHEVMHAAAQRLVGRHDFSTFRSAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 SGALIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFLQVDY 247


>gi|254506845|ref|ZP_05118984.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus 16]
 gi|219550130|gb|EED27116.1| tRNA pseudouridine synthase A [Vibrio parahaemolyticus 16]
          Length = 264

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ Y+GWQRQ++  S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTQYYGWQRQQDVKSVQEELEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA L     I++     V ++FHARF+A  R Y Y I     
Sbjct: 61  VHFDTTASRKMVAWTMGANANL--PGDIAVRWAKEVPEEFHARFTATARRYRYIIFNSAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M +AAQ+L+G +DFT+FR+ HCQ+ SP R + H +V    
Sbjct: 119 RPGILSTGVSHYHGELDEKKMHLAAQYLLGENDFTSFRATHCQSRSPWRNMMHINVTRHN 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L A+DRK  G  A  EGLY 
Sbjct: 179 QYVVIDIKANAFVHHMVRNITGSLICVGRGEQEPEWIQWLLGAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|295691224|ref|YP_003594917.1| tRNA pseudouridine synthase A [Caulobacter segnis ATCC 21756]
 gi|295433127|gb|ADG12299.1| tRNA pseudouridine synthase A [Caulobacter segnis ATCC 21756]
          Length = 247

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 121/246 (49%), Positives = 161/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G  Y G+Q Q    S+QG+IE A+    G+ V +  AGRTD+GVHA  Q
Sbjct: 1   MPRYRLLVEYDGRPYAGFQAQATLPSVQGAIEAAVKAFCGQDVRIAAAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL ++W    +  ALNA+L       + +  + +  +HARFSA  R YLYRI+ R+
Sbjct: 61  VVHVDLEKDWPAQTVFNALNAHLTHEAVSIL-SAEVAEGDWHARFSANERRYLYRILNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP AL+KGR W + K LD E M  AAQHLVG HDFTTFR +HCQ+ SP++T+D   V   
Sbjct: 120 APPALDKGRVWHMKKDLDAEAMHAAAQHLVGLHDFTTFRDMHCQSKSPVKTLDVARVRRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I +   ARSFLH Q+RS  G+L  VG G+WT  D++ AL+A+DR+ECGP+AP +GLY
Sbjct: 180 GEEIHLDFEARSFLHRQVRSMTGTLVEVGAGRWTPDDVKAALEAKDRRECGPVAPADGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LVGVGY 245


>gi|114568998|ref|YP_755678.1| tRNA pseudouridine synthase A [Maricaulis maris MCS10]
 gi|122316778|sp|Q0ASJ7|TRUA_MARMM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|114339460|gb|ABI64740.1| tRNA pseudouridine synthase A [Maricaulis maris MCS10]
          Length = 249

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 124/246 (50%), Positives = 170/246 (69%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQRQ N  S+Q S+E+A   + G  V+V+GAGRTDSGVHAL Q
Sbjct: 1   MPRYRITIEYDGRPFSGWQRQDNAPSVQESLERAAEKLDGAPVLVYGAGRTDSGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++     +  A+N +LK  D ++++  + V   FHARFSA RR YLYR+I R+
Sbjct: 61  VAHLDLAKDLSTDKVRDAINYHLK-PDPVAVIEAARVSDDFHARFSATRRHYLYRMIDRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APL L++G+ W + + LD E M  AAQ L+G+HDFTTFR   CQA SP++++D   V+ +
Sbjct: 120 APLTLDRGQVWRVTRKLDAEAMHHAAQALLGQHDFTTFRDAQCQAESPVKSLDAISVSRY 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  +++   ARSFLH Q+RS VGSL  VG GKW++ D ++AL A DR  CGP+AP +GLY
Sbjct: 180 GEEVQLTCSARSFLHRQVRSMVGSLVEVGVGKWSARDFKRALDAADRSRCGPVAPADGLY 239

Query: 241 FDSVEY 246
             +V+Y
Sbjct: 240 LTAVDY 245


>gi|262171995|ref|ZP_06039673.1| tRNA pseudouridine synthase A [Vibrio mimicus MB-451]
 gi|261893071|gb|EEY39057.1| tRNA pseudouridine synthase A [Vibrio mimicus MB-451]
          Length = 264

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     +++   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDVAVRWATAVPDDFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ ++R      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLITVGRGEQKPEWIQWLLEQKNRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|226322882|ref|ZP_03798400.1| hypothetical protein COPCOM_00654 [Coprococcus comes ATCC 27758]
 gi|225208668|gb|EEG91022.1| hypothetical protein COPCOM_00654 [Coprococcus comes ATCC 27758]
          Length = 256

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 119/246 (48%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +I+  + KAI  +TGE + V GA RTDSGVHA   
Sbjct: 9   MRRIRLTVAYDGTNYCGWQIQPNGITIEEVLNKAICKLTGEEIQVIGASRTDSGVHARGN 68

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +A FD            ALN  L     I ++    VD  +H R+    ++Y Y II  +
Sbjct: 69  IAVFDTESRIPAERFSYALNQRL--PKDIVVVKSDEVDLNWHPRYQDTLKTYEYHIINTK 126

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+  E+   + +   LD   MR  A +L G HDF  F  I   A + +RTI    +   
Sbjct: 127 VPIPTERLYNYFVSFDLDVGQMRRGAAYLEGEHDFAPFCCIRTNAKTTVRTITDLQILQS 186

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I IR+    FL+  +R   G L  VG G +    +++ L+  +R      APP+GL 
Sbjct: 187 GEHITIRITGNGFLYNMVRIIAGVLVRVGRGFYEPEKVKELLEGGERTREAVTAPPQGLC 246

Query: 241 FDSVEY 246
              + Y
Sbjct: 247 LMEIRY 252


>gi|254418055|ref|ZP_05031779.1| tRNA pseudouridine synthase A [Brevundimonas sp. BAL3]
 gi|196184232|gb|EDX79208.1| tRNA pseudouridine synthase A [Brevundimonas sp. BAL3]
          Length = 247

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 116/246 (47%), Positives = 157/246 (63%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ Y G+Q Q +  ++QG++E AI   +GE + +  AGRTD+GVHA  Q
Sbjct: 1   MPRYKLTLEYDGTAYNGFQAQADQPTVQGAVEAAILAFSGERIRIAAAGRTDTGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL R+W    +  A+NA+L   D   +      D  +HARFSA  R YLYRI+ R+
Sbjct: 61  VIHADLERDWPVDTVLNAVNAHLIKQDVCVLSAEYAPDPDWHARFSATGRGYLYRILNRR 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               LE+ R W + KSLD E M  AAQ LVG HDFTTFR + CQ+ SP++T+D   V+ F
Sbjct: 121 PQPVLERDRVWHVKKSLDAEAMHQAAQVLVGLHDFTTFRDVGCQSKSPVKTLDVARVSRF 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + +   ARSFLH Q+RS  G+L  VG G+WT+ D++ AL+A+DR  CGP+AP  GLY
Sbjct: 181 GEEVHLVFQARSFLHRQVRSMAGTLVEVGLGRWTAHDVKAALEAKDRARCGPVAPSAGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LSGVRY 246


>gi|18311353|ref|NP_563287.1| tRNA pseudouridine synthase A [Clostridium perfringens str. 13]
 gi|42559846|sp|Q8XHV5|TRUA2_CLOPE RecName: Full=tRNA pseudouridine synthase A 2; AltName: Full=tRNA
           pseudouridylate synthase I 2; AltName: Full=tRNA-uridine
           isomerase I 2
 gi|18146037|dbj|BAB82077.1| tRNA-pseudouridine synthase I [Clostridium perfringens str. 13]
          Length = 244

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 137/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ YFGWQ+Q  G++IQ  +E+AI  VT E V + G+ RTDSGVHA   
Sbjct: 1   MRNIKLTIEYDGTSYFGWQKQPIGNTIQQKVEEAIKKVTKEEVEILGSSRTDSGVHAKAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN+ L     I I+N   V + FHAR+    ++Y Y I+ R+
Sbjct: 61  VANFKTNSNIPGKNFKAALNSKL--PKDIVIINSEEVAEDFHARYMTTGKTYCYTILNRE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P ALE+   + + K LD E+M+ A ++ +G+HDF  F+       + +RTI    + + 
Sbjct: 119 EPPALERNYVYHVKKQLDVESMKEACKYFLGKHDFKAFQRPGGTVKTSVRTITDIHIETE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I+I V A  FL+  +R  VG+L  VG GK     +++ + + DRK+ G   PP GL 
Sbjct: 179 GNKIKIYVSADGFLYNMVRLIVGTLLKVGRGKEKPEYIKEVIDSGDRKKAGICVPPTGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|217977314|ref|YP_002361461.1| tRNA pseudouridine synthase A [Methylocella silvestris BL2]
 gi|254789643|sp|B8ENG8|TRUA_METSB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|217502690|gb|ACK50099.1| tRNA pseudouridine synthase A [Methylocella silvestris BL2]
          Length = 248

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 138/246 (56%), Positives = 173/246 (70%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ ++IEY+G+ + GWQRQ NG S+Q +IE A+   TGE V +HGAGRTD+GVHA  Q
Sbjct: 1   MPRFKLLIEYDGAPFVGWQRQANGFSVQEAIETALGGFTGESVAIHGAGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D  R+W P +L  A NA+L+  + I+IL    VD +F ARFSA+RR YLY+II R+
Sbjct: 61  VAHVDFSRDWRPDVLRDAANAWLR-PNPIAILKAERVDDEFSARFSAVRRHYLYKIINRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A L LE GR W I +SLD   M  AAQ L+G HDF+TFR   CQA SP+RT++ FDV   
Sbjct: 120 ASLTLEAGRCWAIRRSLDAGAMHEAAQTLLGFHDFSTFRDSECQAESPLRTLERFDVLRD 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  IEI V ARSFLH+Q+RS VGSL  VG GKW   D+ +AL A+DR+ CG +APPEGLY
Sbjct: 180 GENIEIHVAARSFLHSQVRSMVGSLAHVGSGKWRVEDMAEALAAKDRRRCGVVAPPEGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LMQVDY 245


>gi|261252353|ref|ZP_05944926.1| tRNA pseudouridine synthase A [Vibrio orientalis CIP 102891]
 gi|260935744|gb|EEX91733.1| tRNA pseudouridine synthase A [Vibrio orientalis CIP 102891]
          Length = 264

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ Y+GWQRQ+   S+Q  +E+A+ +V  + + V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTQYYGWQRQREVKSVQEKLERALSVVANQPIEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA L   D I++     V ++FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTATRKMVAWTMGANANL--PDDIAVRWAKEVPEEFHARFSATARRYRYIIFNSAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  AAQ+L+G +DFT+FR+ HCQ+ SP R + H +V    
Sbjct: 119 RPGILSSGVSHYHGELDEKKMHQAAQYLLGENDFTSFRATHCQSRSPWRNMMHINVTRHN 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     + + L  +DRK  G  A  EGLY 
Sbjct: 179 QYVVIDIKANAFVHHMVRNITGSLICVGRGEQQPEWIAELLAVKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|225376773|ref|ZP_03753994.1| hypothetical protein ROSEINA2194_02415 [Roseburia inulinivorans DSM
           16841]
 gi|225211399|gb|EEG93753.1| hypothetical protein ROSEINA2194_02415 [Roseburia inulinivorans DSM
           16841]
          Length = 247

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 127/247 (51%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ Q NG +I+  + + +  + GE + V GA RTDSGVH++  
Sbjct: 1   MKRVKLIVAYDGTNYCGWQVQPNGITIEQVLNENLSKLLGEEITVTGASRTDSGVHSMGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  ALN  L   + I + +   V   +H R+   R++Y YRI+ R 
Sbjct: 61  VAIFDTETRMPADKISFALNQRL--PEDIVVQDSCEVPSDWHPRYQVSRKTYEYRILNRT 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +   +   +     LD + M+ AA +LVG HDF +F ++  Q  +  RTI   +V   
Sbjct: 119 FRMPNRRLDTYFYHHKLDVDKMKQAASYLVGEHDFKSFCAVGAQVKTTTRTIYSCEVEKD 178

Query: 181 -GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             ++I IRV    FL+  +R   G+L  VG G+    ++ + L  +DR   GP AP  GL
Sbjct: 179 GNDIITIRVTGNGFLYNMVRIIAGTLIRVGGGEMAPDEIPQILGKKDRTAAGPTAPAHGL 238

Query: 240 YFDSVEY 246
               +EY
Sbjct: 239 TMMGIEY 245


>gi|54114177|gb|AAV29722.1| NT02FT0202 [synthetic construct]
          Length = 258

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           MI Y + I Y G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MINYLLQIGYFGKNYCGWQRQSHSPSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F    +       + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNADRPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|262276338|ref|ZP_06054147.1| tRNA pseudouridine synthase A [Grimontia hollisae CIP 101886]
 gi|262220146|gb|EEY71462.1| tRNA pseudouridine synthase A [Grimontia hollisae CIP 101886]
          Length = 264

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+GS ++GWQRQ+   S+Q  +EKA+  +  + V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGVEYDGSQFYGWQRQREVPSVQEHLEKALSKIANQPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+            +N +L   DTI++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDIEGSRPLRAWTMGVNTHL--PDTIAVRWAKEVPDEFHARFSATARRYRYIIYNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         LD   M  A Q+L+G +DFT+FR++ CQ+ SP R + H +V   G
Sbjct: 119 RPGILRHGVSHYHGELDETLMHEAGQYLLGENDFTSFRAVQCQSKSPWRNVHHINVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL +VG  +     ++  L+A+DR      A  EGLY 
Sbjct: 179 RFVIIDIKANAFVHHMVRNITGSLIVVGRKEQKPEWIKWLLEAKDRNLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             VEY
Sbjct: 239 VEVEY 243


>gi|158319577|ref|YP_001512084.1| tRNA pseudouridine synthase A [Alkaliphilus oremlandii OhILAs]
 gi|158139776|gb|ABW18088.1| tRNA pseudouridine synthase A [Alkaliphilus oremlandii OhILAs]
          Length = 248

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+GS Y GWQ Q N  +IQ  I KA+  + G+ VV+HG+GRTD+GVHA  Q
Sbjct: 1   MRNIMIEIEYDGSNYSGWQVQPNAITIQEEIMKALKKLEGKDVVIHGSGRTDAGVHAYGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F + R      L  A+N+ L     I+I++   V   FHAR+SAI + Y+Y I   +
Sbjct: 61  VATFLMERNIPVERLPLAMNSNL--PKDITIIDAKEVPMDFHARYSAIGKRYIYHIYESR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+ +  ++ I   LD   M  A++ L+G HDF  F S        +RTI   +  S 
Sbjct: 119 YRSAILRNYSYHINYKLDRSKMMEASKLLIGTHDFRGFMSNGSSVEDTVRTIKSLEFKSD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I + +    FL+  +R   G+L  +G G      +EK L+ +DR   G  APP+GL+
Sbjct: 179 GENIYMIIEGDGFLYNMVRIITGTLVQIGAGNKPLEQIEKILKTKDRSLAGHTAPPQGLF 238

Query: 241 FDSVEY 246
            D V Y
Sbjct: 239 LDKVFY 244


>gi|331002224|ref|ZP_08325743.1| tRNA pseudouridine synthase A [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330411318|gb|EGG90734.1| tRNA pseudouridine synthase A [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 245

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 133/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ+Q NG +I+  +  AI  +TGE + V GA RTDSGVHA   
Sbjct: 1   MRRIRLIVSYDGTNYCGWQKQPNGITIEEVLNNAITKLTGEDIEVIGASRTDSGVHAYGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +A FD            A+N  L   + I I     V+  +H R +   ++Y YRI+ R+
Sbjct: 61  IAVFDTNARIAADKFAFAINQRL--PEDIRIQYSDEVESGWHPRKNDCIKTYTYRILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +  E+  A     +LD E MR A+ + +G HDFT+F S   QASSPIRTI   ++   
Sbjct: 119 IDIPTERLYAHFCYFNLDVEKMREASGYFIGTHDFTSFCSQKSQASSPIRTIFSLEILQD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +++ I +    FL+  IR   G+L  VG G +  + + + ++A++RK  G   P +GL 
Sbjct: 179 EDMVTIVIRGDGFLYNMIRIIAGTLIKVGMGVYPPSHITEIMKAKNRKLAGQTMPAKGLT 238

Query: 241 FDSVEY 246
              +EY
Sbjct: 239 LVEIEY 244


>gi|260776454|ref|ZP_05885349.1| tRNA pseudouridine synthase A [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607677|gb|EEX33942.1| tRNA pseudouridine synthase A [Vibrio coralliilyticus ATCC BAA-450]
          Length = 264

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ Y+GWQRQK   S+Q  +E+A+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYNGTHYYGWQRQKEVKSVQEKLERALSIVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V     +NA L   + I++     V ++FHARFSA  R Y Y I     
Sbjct: 61  VHFDTSASRKMVAWTMGVNANL--PNDIAVRWAKEVPEEFHARFSATARRYRYIIFNSAF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M  A Q+L+G +DFT+FR++HCQ+ SP R I H DV   G
Sbjct: 119 RPGIMSSGVSHYHGELDAEKMHQAGQYLLGENDFTSFRAVHCQSRSPWRNIMHLDVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L+ +DRK  G  A   GLY 
Sbjct: 179 QYVVIDIKANAFVHHMVRNITGSLICVGRGEQKPEWIKWLLEVKDRKLAGATAKAAGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|295401888|ref|ZP_06811851.1| tRNA pseudouridine synthase A [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976018|gb|EFG51633.1| tRNA pseudouridine synthase A [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 248

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 126/246 (51%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            R    + Y+G+ +FG+Q Q    ++QG +E+A+  +  G+ + V  +GRTD+GVHA  Q
Sbjct: 3   KRIKCTLSYDGTHFFGYQIQPGKRTVQGELEQALEQIHKGKAIRVTASGRTDAGVHAYGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD      P    KALNA L   D I I +       FHARFSA  + Y Y++   Q
Sbjct: 63  VIHFDTFLSLSPEQWKKALNALL--PDDIVIKDAQEAAPSFHARFSATAKEYRYKVRIAQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +   +  P  LD E M  A + + G HDFT+F S        +RTI   D+   
Sbjct: 121 ERDVFLRHYCYHYPYPLDMEAMGRALRLIEGTHDFTSFCSAKTDVDDRVRTIYKADMTVR 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +L+E   +   FL+  +R  VG++  VG GK +   +  AL A+DR+  G  APP+GLY
Sbjct: 181 DDLLEFCFIGNGFLYNMVRIIVGTILEVGQGKRSVDSISSALAAKDRRFAGKTAPPQGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LWKVYY 246


>gi|168216665|ref|ZP_02642290.1| tRNA pseudouridine synthase A [Clostridium perfringens NCTC 8239]
 gi|182381201|gb|EDT78680.1| tRNA pseudouridine synthase A [Clostridium perfringens NCTC 8239]
          Length = 244

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 137/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ YFGWQ+Q  G++IQ  +E+AI  VT E V + G+ RTDSGVHA   
Sbjct: 1   MRNIKLTIEYDGTSYFGWQKQPIGNTIQQKVEEAIKKVTKEEVEILGSSRTDSGVHAKAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN+ L     I I+N   V + FHAR+    ++Y Y I+ R+
Sbjct: 61  VANFKTNSNIPGKNFKAALNSKL--PKDIVIMNSEEVAEDFHARYMTTGKTYCYTILNRE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P ALE+   + + K LD E+M+ A ++ +G+HDF  F+       + +RTI    + + 
Sbjct: 119 EPPALERNYVYHVKKQLDVESMKEACKYFLGKHDFKAFQRPGGTVKTSVRTITDIHIETE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I+I V A  FL+  +R  VG+L  VG GK     +++ + + DRK+ G   PP GL 
Sbjct: 179 GNKIKIYVSADGFLYNMVRLIVGTLLKVGRGKEKPEYIKEVIDSGDRKKSGICVPPTGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|83594681|ref|YP_428433.1| pseudouridylate synthase [Rhodospirillum rubrum ATCC 11170]
 gi|123725839|sp|Q2RNZ9|TRUA_RHORT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|83577595|gb|ABC24146.1| Pseudouridylate synthase [Rhodospirillum rubrum ATCC 11170]
          Length = 278

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 126/246 (51%), Positives = 168/246 (68%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+RY + +EY+G GY GWQRQ NG +IQ S+E+A F + G    VHG+GRTDSGVHAL Q
Sbjct: 1   MVRYRLTVEYDGRGYCGWQRQDNGPTIQQSLEEAAFRLCGVATRVHGSGRTDSGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R +    + KALNA+L+    I++++ + V + FHARFSA  RSY YRI+ R 
Sbjct: 61  VAHLDLPRAYGAATVMKALNAHLR-PQPIAVIDAAEVAEDFHARFSAEERSYRYRILNRI 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP  L++GR W + + ++   M  AAQ LVGRHDF++FR+  CQA SP++T+    V   
Sbjct: 120 APPTLDQGRVWWVARPMEAAIMDEAAQVLVGRHDFSSFRAAECQADSPVKTLSELRVTRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I +   ARSFLH Q+R+ VG+L LVGDG+WT+  L  AL+A DR   GP APP+GLY
Sbjct: 180 GDEIHVFARARSFLHHQVRNMVGTLALVGDGRWTADRLRAALEACDRSAAGPTAPPDGLY 239

Query: 241 FDSVEY 246
           F  V +
Sbjct: 240 FLRVRF 245


>gi|323706484|ref|ZP_08118045.1| tRNA pseudouridine synthase A [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534204|gb|EGB23994.1| tRNA pseudouridine synthase A [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 239

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/241 (35%), Positives = 127/241 (52%), Gaps = 2/241 (0%)

Query: 6   MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFD 65
           M+IEY+G+ Y GWQ QKN  ++Q  I KAI  +T E V + G+ RTD+GVHAL QVA+F 
Sbjct: 1   MVIEYDGTNYHGWQIQKNAVTVQEVITKAIKKITSEDVNLIGSSRTDAGVHALNQVANFI 60

Query: 66  LVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLAL 125
                    +  ALN+ L     I I N    D  FH+R+SA  + Y Y I  R+    +
Sbjct: 61  SNCNIPLSKMPNALNSVL--PKDIVIKNAYEADMDFHSRYSAKGKRYKYIIYNRKFNSPV 118

Query: 126 EKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIE 185
            +  +W I   LD + M  +  +L G HDF+ F+S        IRT+    +      +E
Sbjct: 119 YRNYSWHISDELDLDKMIESLTYLKGTHDFSAFKSSGSSVKDSIRTVRDISLRKNDFNVE 178

Query: 186 IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVE 245
             + A  FL+  +R  VG++  VG GK     +++ L+++DR   G  APP+GL+   + 
Sbjct: 179 FEIEADGFLYNMVRIIVGTIVDVGIGKINPIHVKEILESKDRCMAGKTAPPQGLFLTKIY 238

Query: 246 Y 246
           Y
Sbjct: 239 Y 239


>gi|300857214|ref|YP_003782198.1| tRNA pseudouridine synthase A [Clostridium ljungdahlii DSM 13528]
 gi|300437329|gb|ADK17096.1| tRNA pseudouridine synthase A [Clostridium ljungdahlii DSM 13528]
          Length = 244

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ Y GWQRQ N  +IQ  +E+AI  +TG    V GA RTD+GVHA   
Sbjct: 1   MKNVMLTIEYDGTNYSGWQRQNNAMTIQQRLEEAIKKITGNFSEVIGASRTDAGVHARGF 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F    +        ALN  L     I +LN   VD  FH+R+ ++ + Y+Y I+T  
Sbjct: 61  VCNFFTNSKMPSPNFKMALNGVL--PKDIVVLNAREVDNSFHSRYHSLGKKYVYTIVTGN 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               + +   +   + LD + M+ A ++ +G HDF+ F+     A S +RT+    +   
Sbjct: 119 NRPVIGRQYVYYFRRKLDIDKMKNACKYFIGTHDFSAFKKKGSSAKSSVRTVKELTIAQE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            NLI+  +V   FL+  +R  VG+L  VG G++T   ++  L ++DR + G   P  GL 
Sbjct: 179 DNLIKFSIVGDGFLYNMVRIIVGTLLEVGLGRFTPEYVKDILDSKDRSKAGKPVPALGLC 238

Query: 241 FDSVEY 246
            + + Y
Sbjct: 239 LEKIFY 244


>gi|229525612|ref|ZP_04415017.1| tRNA pseudouridine synthase A [Vibrio cholerae bv. albensis VL426]
 gi|229339193|gb|EEO04210.1| tRNA pseudouridine synthase A [Vibrio cholerae bv. albensis VL426]
          Length = 264

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTSAERQMVAWTMGANANL--PKDIAVRWAMAVPDEFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V    
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHS 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L  +DR      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLAQKDRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|121728128|ref|ZP_01681164.1| tRNA pseudouridine synthase A [Vibrio cholerae V52]
 gi|229512439|ref|ZP_04401912.1| tRNA pseudouridine synthase A [Vibrio cholerae TMA 21]
 gi|121629596|gb|EAX62018.1| tRNA pseudouridine synthase A [Vibrio cholerae V52]
 gi|229350520|gb|EEO15467.1| tRNA pseudouridine synthase A [Vibrio cholerae TMA 21]
          Length = 264

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDIAVRWAMAVPDEFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V    
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHS 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L  +DR      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLAQKDRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|138893815|ref|YP_001124268.1| tRNA pseudouridine synthase A [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250992|ref|ZP_03149674.1| tRNA pseudouridine synthase A [Geobacillus sp. G11MC16]
 gi|166228701|sp|A4IJL9|TRUA_GEOTN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|134265328|gb|ABO65523.1| tRNA pseudouridine synthase A [Geobacillus thermodenitrificans
           NG80-2]
 gi|196209464|gb|EDY04241.1| tRNA pseudouridine synthase A [Geobacillus sp. G11MC16]
          Length = 253

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 124/248 (50%), Gaps = 4/248 (1%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHAL 58
           M R    ++ Y+G+ + G+Q Q    ++QG  E  +  +  G+ V +  +GRTD+GVHA 
Sbjct: 1   MTRRIKCVVAYDGTYFSGYQVQPGKRTVQGEFEGVLKRMHKGDDVRITASGRTDAGVHAY 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            QV HFD      P    KALNA L   D I++ ++   D  FHARFSA  + Y Y + T
Sbjct: 61  GQVIHFDTPLALSPEQWKKALNAQL--PDDIAVRSVDEADSTFHARFSAKAKEYRYNVWT 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
                   +      P  L  + M  A   L G HDFT+F S        +RTI   ++ 
Sbjct: 119 AAERDVFRRHYCAWHPYPLRVDAMSEALGLLKGTHDFTSFCSAKTVIEDRVRTIYQAEME 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G +++ R V   FL+  +R  VG++  VG GK    D+E  L A+DR+  GP AP EG
Sbjct: 179 VDGPMLQFRFVGSGFLYNMVRIIVGTVLEVGQGKRPPDDIEALLAAKDRRLAGPTAPAEG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLWRVYY 246


>gi|148977676|ref|ZP_01814237.1| tRNA pseudouridine synthase A [Vibrionales bacterium SWAT-3]
 gi|145963044|gb|EDK28313.1| tRNA pseudouridine synthase A [Vibrionales bacterium SWAT-3]
          Length = 264

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG+ YFGWQRQ++  S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MKIALGIEYNGTHYFGWQRQRDVKSVQEELEKALSVVANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +   V      NA   +   I++   + V++ FHARFSA  R Y Y I     
Sbjct: 61  VHFETNVDRKMVAWTMGANAN--MPKDIAVRWATEVNEDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DFT+FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGHLDEKKMHEAGQYLLGENDFTSFRATHCQSHSPWRNMIHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG G+     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 HYIVIDIKANAFVHHMVRNITGSLIAVGKGEQKPEWIKWLLEAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|312109293|ref|YP_003987609.1| tRNA pseudouridine synthase A [Geobacillus sp. Y4.1MC1]
 gi|311214394|gb|ADP72998.1| tRNA pseudouridine synthase A [Geobacillus sp. Y4.1MC1]
          Length = 248

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 127/246 (51%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            R    + Y+G+ +FG+Q Q    ++QG +E+A+  +  G+ + V  +GRTD+GVHA  Q
Sbjct: 3   KRIKCTLSYDGTHFFGYQIQPGKRTVQGELEQALEQIHKGKAIRVTASGRTDAGVHAYGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD      P    KALNA L   D I I +       FHARFSA  + Y Y++   Q
Sbjct: 63  VIHFDTFLSLSPEQWKKALNALL--PDDIVIKDAQEAAPSFHARFSATAKEYRYKVRIAQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +   +  P  LD E M  A + + G HDFT+F S        +RTI   D+   
Sbjct: 121 ERDVFLRHYCYHYPYPLDMEAMGRALRLIEGTHDFTSFCSAKTDVDDRVRTIYKADMTVR 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +L+E R +   FL+  +R  VG++  VG GK +   +  AL A+DR+  G  APP+GLY
Sbjct: 181 DDLLEFRFIGNGFLYNMVRIIVGTILEVGQGKRSVDSISSALAAKDRRFAGKTAPPQGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LWKVYY 246


>gi|169347102|ref|ZP_02866044.1| tRNA pseudouridine synthase A [Clostridium perfringens C str.
           JGS1495]
 gi|169296785|gb|EDS78914.1| tRNA pseudouridine synthase A [Clostridium perfringens C str.
           JGS1495]
          Length = 244

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 138/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ YFGWQ+Q  G++IQ  +E+AI  VT E V + G+ RTDSGVHA   
Sbjct: 1   MRNIKLIIEYDGTSYFGWQKQPIGNTIQQKVEEAIKKVTKEEVEILGSSRTDSGVHAKAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN+ L     I I+N   V + FHAR+    ++Y Y I+ R+
Sbjct: 61  VANFKTNSNIPGKNFKAALNSKL--PKDIVIMNSEEVAEDFHARYMTTGKTYCYTILNRE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P ALE+   + + K LD E+M+ A ++ +G+HDF  F+       + +RTI    + + 
Sbjct: 119 EPPALERNCVYHVKKQLDVESMKEACKYFLGKHDFKAFQRPGGTVKTSVRTITDIHIETE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I+I V A  FL+  +R  VG+L  VG GK     +++ + + DRK+ G   PP GL 
Sbjct: 179 GNKIKIYVSADGFLYNMVRLIVGTLLKVGRGKEKPEYIKEVIDSGDRKKAGICVPPTGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|153216039|ref|ZP_01950244.1| tRNA pseudouridine synthase A [Vibrio cholerae 1587]
 gi|153829544|ref|ZP_01982211.1| tRNA pseudouridine synthase A [Vibrio cholerae 623-39]
 gi|254226230|ref|ZP_04919824.1| tRNA pseudouridine synthase A [Vibrio cholerae V51]
 gi|254291873|ref|ZP_04962656.1| tRNA pseudouridine synthase A [Vibrio cholerae AM-19226]
 gi|124114489|gb|EAY33309.1| tRNA pseudouridine synthase A [Vibrio cholerae 1587]
 gi|125621266|gb|EAZ49606.1| tRNA pseudouridine synthase A [Vibrio cholerae V51]
 gi|148875004|gb|EDL73139.1| tRNA pseudouridine synthase A [Vibrio cholerae 623-39]
 gi|150422233|gb|EDN14197.1| tRNA pseudouridine synthase A [Vibrio cholerae AM-19226]
 gi|327483717|gb|AEA78124.1| tRNA pseudouridine synthase A [Vibrio cholerae LMA3894-4]
          Length = 264

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTSAERQMVAWTMGANANL--PKDIAVRWAMAVPDEFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L  +DR      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLAQKDRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|222084710|ref|YP_002543239.1| tRNA pseudouridine synthase A [Agrobacterium radiobacter K84]
 gi|221722158|gb|ACM25314.1| tRNA pseudouridine synthase A [Agrobacterium radiobacter K84]
          Length = 266

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 156/247 (63%), Positives = 187/247 (75%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY M +EY+G  Y GWQRQ NG S+QG+IE+AI  +TGE   V GAGRTDSGVHA+ Q
Sbjct: 2   MPRYRMTVEYDGIPYVGWQRQNNGPSVQGAIERAILSLTGETASVRGAGRTDSGVHAVGQ 61

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDT-ISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL +EW P  L  ALNA+L+++   ++ILN+  VD  F ARFSAIRR YLYRII R
Sbjct: 62  VTHADLSKEWKPHTLRNALNAHLRLAGDRVAILNVMEVDASFDARFSAIRRHYLYRIIVR 121

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE GRAW + K +D E M  AAQ LVGRHDFTTFRS+HCQA+SP+RT+D  DV  
Sbjct: 122 RAPLALEAGRAWWVAKDMDHEVMHTAAQTLVGRHDFTTFRSVHCQANSPVRTLDRLDVTR 181

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+  AL+A+DRK CGP+APP+GL
Sbjct: 182 SGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVRTALEARDRKACGPVAPPDGL 241

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 242 YFMQVDY 248


>gi|317472004|ref|ZP_07931336.1| tRNA pseudouridine synthase A [Anaerostipes sp. 3_2_56FAA]
 gi|316900408|gb|EFV22390.1| tRNA pseudouridine synthase A [Anaerostipes sp. 3_2_56FAA]
          Length = 252

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 121/246 (49%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q   ++I+G + + +  + GE + V GA RTDSGVHAL  
Sbjct: 1   MKRIKLEVAYDGTNYCGWQIQPKDTTIEGVLNEKLGSLLGEEITVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD   E     + +ALN  L   D I I + S V   FH R+   R++Y Y I   +
Sbjct: 61  VAVFDTETEIPGERIARALNQRL--PDDIVIQSSSEVKDDFHPRYQDTRKTYEYTIYNAE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +       +   LD E MR AA+  +G HDF +F +      + +RTI   +V   
Sbjct: 119 FDNPVTARHHHFVYVPLDVERMRTAARCFLGEHDFLSFSTTGSPTKTTVRTIYECEVRQN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I +RV    FL+  +R   G+L  +G G+     + +      R + GP AP +GL 
Sbjct: 179 GRYITMRVTGNGFLYNMVRMMAGTLISIGRGRRDPEWVRELFLHPKRGKAGPNAPAKGLT 238

Query: 241 FDSVEY 246
             ++ Y
Sbjct: 239 LINIHY 244


>gi|15641014|ref|NP_230645.1| tRNA pseudouridine synthase A [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121587328|ref|ZP_01677099.1| tRNA pseudouridine synthase A [Vibrio cholerae 2740-80]
 gi|147674772|ref|YP_001216471.1| tRNA pseudouridine synthase A [Vibrio cholerae O395]
 gi|153819838|ref|ZP_01972505.1| tRNA pseudouridine synthase A [Vibrio cholerae NCTC 8457]
 gi|183179415|ref|ZP_02957626.1| tRNA pseudouridine synthase A [Vibrio cholerae MZO-3]
 gi|227081173|ref|YP_002809724.1| tRNA pseudouridine synthase A [Vibrio cholerae M66-2]
 gi|229505402|ref|ZP_04394912.1| tRNA pseudouridine synthase A [Vibrio cholerae BX 330286]
 gi|229510928|ref|ZP_04400407.1| tRNA pseudouridine synthase A [Vibrio cholerae B33]
 gi|229518049|ref|ZP_04407493.1| tRNA pseudouridine synthase A [Vibrio cholerae RC9]
 gi|229529907|ref|ZP_04419297.1| tRNA pseudouridine synthase A [Vibrio cholerae 12129(1)]
 gi|229608421|ref|YP_002879069.1| tRNA pseudouridine synthase A [Vibrio cholerae MJ-1236]
 gi|254848129|ref|ZP_05237479.1| tRNA pseudouridine synthase A [Vibrio cholerae MO10]
 gi|255744781|ref|ZP_05418732.1| tRNA pseudouridine synthase A [Vibrio cholera CIRS 101]
 gi|262151270|ref|ZP_06028406.1| tRNA pseudouridine synthase A [Vibrio cholerae INDRE 91/1]
 gi|262167166|ref|ZP_06034879.1| tRNA pseudouridine synthase A [Vibrio cholerae RC27]
 gi|262190865|ref|ZP_06049084.1| tRNA pseudouridine synthase A [Vibrio cholerae CT 5369-93]
 gi|297578606|ref|ZP_06940534.1| tRNA pseudouridine synthase A [Vibrio cholerae RC385]
 gi|298498887|ref|ZP_07008694.1| tRNA pseudouridine synthase A [Vibrio cholerae MAK 757]
 gi|24212594|sp|Q9KTA4|TRUA_VIBCH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|172047415|sp|A5F2T4|TRUA_VIBC3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254764874|sp|C3LTP7|TRUA_VIBCM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|9655462|gb|AAF94160.1| tRNA pseudouridine synthase A [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121548411|gb|EAX58471.1| tRNA pseudouridine synthase A [Vibrio cholerae 2740-80]
 gi|126509619|gb|EAZ72213.1| tRNA pseudouridine synthase A [Vibrio cholerae NCTC 8457]
 gi|146316655|gb|ABQ21194.1| tRNA pseudouridine synthase A [Vibrio cholerae O395]
 gi|183012826|gb|EDT88126.1| tRNA pseudouridine synthase A [Vibrio cholerae MZO-3]
 gi|227009061|gb|ACP05273.1| tRNA pseudouridine synthase A [Vibrio cholerae M66-2]
 gi|227012816|gb|ACP09026.1| tRNA pseudouridine synthase A [Vibrio cholerae O395]
 gi|229333681|gb|EEN99167.1| tRNA pseudouridine synthase A [Vibrio cholerae 12129(1)]
 gi|229344764|gb|EEO09738.1| tRNA pseudouridine synthase A [Vibrio cholerae RC9]
 gi|229350893|gb|EEO15834.1| tRNA pseudouridine synthase A [Vibrio cholerae B33]
 gi|229357625|gb|EEO22542.1| tRNA pseudouridine synthase A [Vibrio cholerae BX 330286]
 gi|229371076|gb|ACQ61499.1| tRNA pseudouridine synthase A [Vibrio cholerae MJ-1236]
 gi|254843834|gb|EET22248.1| tRNA pseudouridine synthase A [Vibrio cholerae MO10]
 gi|255737812|gb|EET93206.1| tRNA pseudouridine synthase A [Vibrio cholera CIRS 101]
 gi|262024387|gb|EEY43075.1| tRNA pseudouridine synthase A [Vibrio cholerae RC27]
 gi|262030961|gb|EEY49589.1| tRNA pseudouridine synthase A [Vibrio cholerae INDRE 91/1]
 gi|262033256|gb|EEY51775.1| tRNA pseudouridine synthase A [Vibrio cholerae CT 5369-93]
 gi|297536200|gb|EFH75033.1| tRNA pseudouridine synthase A [Vibrio cholerae RC385]
 gi|297543220|gb|EFH79270.1| tRNA pseudouridine synthase A [Vibrio cholerae MAK 757]
          Length = 264

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDIAVRWAMAVPDEFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L  +DR      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGRGEQKPEWIQWLLAQKDRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|302876500|ref|YP_003845133.1| tRNA pseudouridine synthase A [Clostridium cellulovorans 743B]
 gi|307687172|ref|ZP_07629618.1| tRNA pseudouridine synthase A [Clostridium cellulovorans 743B]
 gi|302579357|gb|ADL53369.1| tRNA pseudouridine synthase A [Clostridium cellulovorans 743B]
          Length = 244

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 139/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +I+EY+G+ Y GWQ+QKN  ++QG+IEKAI  +T E V + G  RTDSGVHA   
Sbjct: 1   MRNIKLILEYDGTKYSGWQKQKNSVTVQGTIEKAIEAITKESVELIGCSRTDSGVHAKGY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F    +        A+NA L   + I IL+   V + FH+RF+ I ++Y Y ++ R 
Sbjct: 61  TANFFTNSKIPIERFYIAINAKL--PEDIVILSSEEVPEDFHSRFNCIGKTYCYSVLNRV 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +  A+ +   + +P+ L  + M+ AA+  VG +DF  FR++  + +S +RTI   +V   
Sbjct: 119 SYPAMYRNYLYHVPRKLSIDEMKKAAESFVGTYDFNAFRNLGTEVASTVRTIHRIEVEEH 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++I I V    FL+  +R   G+L  VG G+  S  ++  L+++DR   G  AP  GL 
Sbjct: 179 GDIINILVTGDGFLYNMVRIIAGTLVEVGLGQKRSDQIKVILESKDRNRAGKTAPARGLS 238

Query: 241 FDSVEY 246
            D V Y
Sbjct: 239 LDKVYY 244


>gi|295132840|ref|YP_003583516.1| tRNA pseudouridine synthase A [Zunongwangia profunda SM-A87]
 gi|294980855|gb|ADF51320.1| tRNA pseudouridine synthase A [Zunongwangia profunda SM-A87]
          Length = 250

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 116/245 (47%), Gaps = 4/245 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY + + Y G+ Y GWQ Q    S+Q  +++A+  +  + + V GAGRTD+GVHA +  
Sbjct: 1   MRYFIDLAYLGTAYHGWQIQPEAVSVQQVLQEALSKILQQNIEVVGAGRTDAGVHATQMY 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD         L   LN++L     ISI  L  V  Q HARF A  RSY Y I+  + 
Sbjct: 61  AHFDADLNCDEKTLQFKLNSFL--PKDISIRQLFKVQSQAHARFDACSRSYEYHIVNFKD 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P  ++      + K  D E M  AA  L    +F  F        +    I         
Sbjct: 119 PFKIDLAY--YLLKQPDIEKMNHAAAMLKDYTNFKCFSKSRTDVKTYNCNITAAFWEQSK 176

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + +   + A  FL   +R+ VG+L  +G GK +   L++ L+++DR   G   P  GLY 
Sbjct: 177 DELIFHITADRFLRNMVRAIVGTLLDIGLGKNSVEFLKEILKSEDRSMAGTSVPAHGLYL 236

Query: 242 DSVEY 246
             +EY
Sbjct: 237 TRIEY 241


>gi|322514646|ref|ZP_08067676.1| tRNA pseudouridine synthase A [Actinobacillus ureae ATCC 25976]
 gi|322119437|gb|EFX91539.1| tRNA pseudouridine synthase A [Actinobacillus ureae ATCC 25976]
          Length = 289

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    V    AGRTDSGVH   QV
Sbjct: 28  MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSVVANAPVEAFCAGRTDSGVHGTGQV 87

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   + I++     V + FHARFSA  R Y Y I   + 
Sbjct: 88  VHFETETVRPLQSWCFGTNANL--PNDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 145

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  C++ +P R I H +V+  G
Sbjct: 146 RSAILPKGVSHYHHELDHQKMHEAGQFLLGENDFSSFRAAKCESHTPWRNIHHLNVSRLG 205

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 206 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 265

Query: 242 DSVEY 246
             V Y
Sbjct: 266 VDVHY 270


>gi|328545265|ref|YP_004305374.1| tRNA pseudouridine synthase A [polymorphum gilvum SL003B-26A1]
 gi|326415007|gb|ADZ72070.1| tRNA pseudouridine synthase A [Polymorphum gilvum SL003B-26A1]
          Length = 276

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 121/246 (49%), Positives = 162/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQRQ NG S+Q  IE+A+    GE V + GAGRTD+GVHA  Q
Sbjct: 1   MPRYKLTIEYDGRPFCGWQRQANGPSVQAVIERAVKAFCGEEVTIGGAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R+W    +  ALN +    D +++L    +   F +RFSAIRR+Y YRI+ R 
Sbjct: 61  VAHVDLSRDWPADTVLGALNFH-CQPDPVALLACEKMHAGFDSRFSAIRRAYRYRIVNRV 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            PL  E+G AW +   LD E M  AAQ  VG HDFTTFR   CQA SP++T++ F V   
Sbjct: 120 PPLTYERGLAWHVKPPLDAEAMHAAAQVFVGHHDFTTFRHARCQAKSPVKTLEFFAVRRE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+++     +RSFLH Q+RS VG+L+LVG+G+W +  + +AL A++RK CGP+APP+GLY
Sbjct: 180 GDVVVAECASRSFLHNQVRSMVGTLRLVGEGRWDAQTVREALAARNRKACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTRVDY 245


>gi|190890088|ref|YP_001976630.1| tRNA-pseudouridine synthase I protein [Rhizobium etli CIAT 652]
 gi|190695367|gb|ACE89452.1| tRNA-pseudouridine synthase I protein [Rhizobium etli CIAT 652]
          Length = 266

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 152/247 (61%), Positives = 190/247 (76%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V V GAGRTDSGVHA+ Q
Sbjct: 1   MPRYRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSVRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL ++W P  L  A+NA+L+   + +SIL++  V + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKQWSPYQLQNAMNAHLRLAGERVSILDVEAVPEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK+LD E M  AAQ LVGRHDF+TFRS HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKTLDHEVMHAAAQRLVGRHDFSTFRSAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 SGALIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFLQVDY 247


>gi|89256403|ref|YP_513765.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314847|ref|YP_763570.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica OSU18]
 gi|167010425|ref|ZP_02275356.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367741|ref|ZP_04983762.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica 257]
 gi|122325138|sp|Q0BLV1|TRUA_FRATO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|122999741|sp|Q2A3D7|TRUA_FRATH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|89144234|emb|CAJ79507.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129746|gb|ABI82933.1| tRNA-pseudouridine synthase I [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253552|gb|EBA52646.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica 257]
          Length = 258

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSLSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F            + +NA L     I IL +  VD  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNAYRPLSAWQRGVNALL--PQDIKILAVQQVDNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|153853813|ref|ZP_01995169.1| hypothetical protein DORLON_01160 [Dorea longicatena DSM 13814]
 gi|149753563|gb|EDM63494.1| hypothetical protein DORLON_01160 [Dorea longicatena DSM 13814]
          Length = 246

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +I+  + K++  +TGE + + GA RTDSGVHAL  
Sbjct: 1   MKRIRIFVAYDGTNYCGWQVQPNGVTIEEKLNKSLARLTGEEIRIIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIR-RSYLYRIITR 119
           VA FD      P     ALN  L   + I ++    V   +H R+     ++Y Y I   
Sbjct: 61  VAVFDTESSIPPERFAYALNQRL--PEDIVVVRSDEVPADWHPRYQENISKTYEYHIYNA 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
             P  L+      +   +D E MR  A++LVG HDF +F +I       +RT+    +  
Sbjct: 119 AVPNPLKTRYCTFVSFPMDVEAMRAGAKYLVGEHDFVSFCNIRTNTQDTVRTVYDLIIEK 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I +R+    FL+  +R   G L  VG G +T   +++ L A+     G  APP GL
Sbjct: 179 KDDEIVLRITGNGFLYNMVRIIAGVLIRVGRGFYTPEKVKEILDAKVHTSEGATAPPNGL 238

Query: 240 YFDSVEYS 247
               ++Y+
Sbjct: 239 VLMKIDYN 246


>gi|116250203|ref|YP_766041.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254851|emb|CAK05925.1| putative tRNA pseudouridine synthase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 272

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 150/247 (60%), Positives = 189/247 (76%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V V GAGRTDSGVHA+ Q
Sbjct: 1   MPRFRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSVRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKI-SDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL ++W P  L  ALNA+L+I  + +S+L++    + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKDWSPYQLQNALNAHLRIAGERVSVLDVEAAPEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK LD E M  AAQ LVGRHDF+TFR+ HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGRHDFSTFRAAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 RGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALKARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMQVDY 247


>gi|310823108|ref|YP_003955466.1| tRNA pseudouridine synthase a [Stigmatella aurantiaca DW4/3-1]
 gi|309396180|gb|ADO73639.1| tRNA pseudouridine synthase A [Stigmatella aurantiaca DW4/3-1]
          Length = 265

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 123/247 (49%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + IEY+GS Y GWQ Q+NG S+Q  + +A+  + G  V V  AGRTDSGVHA  Q
Sbjct: 1   MPRLKLTIEYDGSRYVGWQVQRNGRSVQAELGEALGRLLGGDVEVVAAGRTDSGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V  FD  R+       + LN  L   + I+++    V   F  R  +  + Y YR+    
Sbjct: 61  VVCFDTERQLPLKAYHRGLNGLL--PEDIAVVRAEEVSAAFDPRRWSRGKRYRYRVSNLP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +   L +   W I   L  E M  AA  L+GRHD++ FR+  CQA+  +R +    V   
Sbjct: 119 SRSPLRRHTHWEIYAPLQVEAMARAATSLLGRHDYSAFRASDCQAAHAVREVRRLSVEGT 178

Query: 181 GNLIEIRVV-ARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
                  VV   +FL   +R+ VG+L  VG G+     + + L + DR   GP APP GL
Sbjct: 179 PGDAVAFVVEGTAFLKHMVRNLVGTLVEVGKGRRPEAWVAEVLASGDRTLAGPTAPPHGL 238

Query: 240 YFDSVEY 246
             + V Y
Sbjct: 239 VLEEVFY 245


>gi|319403559|emb|CBI77141.1| tRNA pseudouridine synthase A [Bartonella rochalimae ATCC BAA-1498]
          Length = 247

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 128/247 (51%), Positives = 170/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R+ + +EY+GS Y GWQRQKN  +IQGSIE AIF  +G+ + +  AGRTD+GVHA+ Q
Sbjct: 1   MVRFKLTLEYDGSNYAGWQRQKNLRTIQGSIENAIFHFSGQKLTITTAGRTDAGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D  + W    +  ALNA+L+   + I++LN+  V   F ARF A +R YL++I+ R
Sbjct: 61  VAHIDFEKNWNTNTVRDALNAHLQKQGEDIAVLNVQNVPDNFDARFCATKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W +PK LD + M  AAQ LVG+HDFTTFRS +CQA SP+RT++  D+  
Sbjct: 121 RSPPALNTKRVWWLPKPLDADAMHKAAQKLVGQHDFTTFRSAYCQAKSPVRTLERLDIQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A++R  CG +APP GL
Sbjct: 181 EGDEIFLYAQARSFLHHQIRSFAGSLMEVGIGRWTAEDLEAALHARNRARCGVVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   V+Y
Sbjct: 241 YLMKVDY 247


>gi|261340711|ref|ZP_05968569.1| tRNA pseudouridine synthase A [Enterobacter cancerogenus ATCC
           35316]
 gi|288317127|gb|EFC56065.1| tRNA pseudouridine synthase A [Enterobacter cancerogenus ATCC
           35316]
          Length = 270

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 10  HRIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVLCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L     I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 70  VHFETTAVRKDAAWTLGVNANL--PGDIAVRWVKNVPDDFHARFSATARRYRYVIYNQRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V+ +G
Sbjct: 128 RPAVLSQGVTHFYEPLDAERMQRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHINVSRYG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGAGHQPESWIAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            SV+Y
Sbjct: 248 VSVDY 252


>gi|303251239|ref|ZP_07337417.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252529|ref|ZP_07534425.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307261387|ref|ZP_07543062.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|302649781|gb|EFL79959.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860121|gb|EFM92138.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306869118|gb|EFN00920.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 262

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILPKGVSHYHYELDHQKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|307245766|ref|ZP_07527852.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254739|ref|ZP_07536566.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259179|ref|ZP_07540909.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306853468|gb|EFM85687.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862265|gb|EFM94232.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866846|gb|EFM98704.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 262

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILPKGISHYHYELDHQKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|254429312|ref|ZP_05043019.1| tRNA pseudouridine synthase A [Alcanivorax sp. DG881]
 gi|196195481|gb|EDX90440.1| tRNA pseudouridine synthase A [Alcanivorax sp. DG881]
          Length = 267

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 91/247 (36%), Positives = 129/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQ-KNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R  + IEY+G+ + GWQ Q     ++Q  +E A+  V    V V  AGRTD+GVH   
Sbjct: 1   MTRIALGIEYDGTDFRGWQTQQPGVRTVQECLEAALSKVANHPVAVVCAGRTDAGVHGTG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD              N  L     +++   + VD  FHARFSA+ R Y Y I   
Sbjct: 61  QVVHFDSEAPREMKSWIMGANTNL--PRDVTVRWATPVDDAFHARFSAVSRRYRYVIYNH 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
             P AL + +     + LD   MR AA +LVG HDFT +RS+HCQA SP++T+   ++  
Sbjct: 119 ARPPALFRNQVTWNYRPLDVAAMREAAAYLVGEHDFTAYRSVHCQAKSPLKTMHSLELYE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G ++ +   A +FL   +R+  G L  VG GK  +    + L+ +DR++    APP GL
Sbjct: 179 HGKVLVLEAHANAFLMHMVRNIAGVLMSVGAGKRPAHWAREVLEGRDRRKGAATAPPFGL 238

Query: 240 YFDSVEY 246
           Y   +EY
Sbjct: 239 YLVDIEY 245


>gi|312882128|ref|ZP_07741878.1| tRNA pseudouridine synthase A [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370264|gb|EFP97766.1| tRNA pseudouridine synthase A [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 264

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNGS YFGWQRQK   S+Q  +EKA+ +V    V V  AGRTD+GVH   Q+
Sbjct: 1   MKIALGIEYNGSQYFGWQRQKEVKSVQECLEKALSIVANHKVEVQCAGRTDAGVHGTGQI 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+       V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFETTASRKAVAWTMGANANL--PKDIAVRWAKEVPDEFHARFSATARRYRYLIFNDAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD   M  A Q+L+G +DFT+FR+ HCQ+ SP R + H +V S G
Sbjct: 119 RPGILSSGVSHYHGDLDVTQMHKAGQYLLGENDFTSFRATHCQSKSPWRNLMHLNVTSHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL +VG G+     +   L  +DRK+ G  A  EGLY 
Sbjct: 179 KYIVVDIKANAFVHHMVRNIVGSLLVVGRGEKKPEWIRDLLAIKDRKQAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|291562296|emb|CBL41112.1| pseudouridylate synthase I [butyrate-producing bacterium SS3/4]
          Length = 344

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 124/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q NG +I+  + KA+  +  E V V GA RTDSGVHA   
Sbjct: 1   MRRIKLTVAYDGTAYKGWQLQPNGVTIEEMLNKALSDLLKEPVCVIGASRTDSGVHARGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD          C A+N  L   + I ++    V   +H R     ++Y Y+I+  +
Sbjct: 61  VAVFDTESRIPGDKFCYAVNRGL--PEDIRVVESEEVPLDWHPRKQNCVKTYEYQILNCK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +   +  A      L+ E M  AA++L+G HDF +F + + QA   +RTI   +V   
Sbjct: 119 IEIPTRRLYAHFCYYPLNVEKMNEAAKYLIGEHDFISFCAANHQAEETVRTIYGAEVKKN 178

Query: 181 GNLIEIRV-VARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              I         FL+  +R   G+L  VG G+W    +++ L+A++RKE G  AP +GL
Sbjct: 179 DEDIVTIRLCGSGFLYNMVRIIAGTLLKVGTGEWEPEHVKEVLEARNRKEAGQTAPAKGL 238

Query: 240 YFDSVEY 246
               +EY
Sbjct: 239 TLVGIEY 245


>gi|297618350|ref|YP_003703509.1| tRNA pseudouridine synthase A [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146187|gb|ADI02944.1| tRNA pseudouridine synthase A [Syntrophothermus lipocalidus DSM
           12680]
          Length = 244

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 126/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R   ++EY G+ Y G+QRQ  G +I+G +E AI  +TGE V V  AGRTD+GVHAL Q
Sbjct: 1   MNRIKALVEYEGTRYSGFQRQPRGLTIEGELEAAICKLTGERVKVLAAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V  FD      P     ALN+ L     I +L      + FH R+ A  ++Y Y I  ++
Sbjct: 61  VIAFDTESPIPPERFAPALNSVL--PSDIRVLKSEKAKEGFHPRYQARAKAYRYLIYRQE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +  A+  P+ LD   M  AA+++ G HDF  F +      + +RT+    +N  
Sbjct: 119 EGRTFYRNLAYYYPQPLDLPAMAKAARYMEGTHDFMAFCASGSGVRNYVRTVFEVSINEK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              ++I V    FL+  +R  VG+L  VG  +    ++E+ L ++DR+  GP  P  GLY
Sbjct: 179 PPFLQIDVCGDGFLYNMVRIMVGTLLEVGRKRLAPEEVEQILLSRDRQRAGPTVPACGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LKRVFY 244


>gi|156502494|ref|YP_001428559.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|290953826|ref|ZP_06558447.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312837|ref|ZP_06803569.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica URFT1]
 gi|166228698|sp|A7NCA0|TRUA_FRATF RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|156253097|gb|ABU61603.1| tRNA pseudouridine synthase A [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 258

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSLSVQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F            + +NA L     I IL +  V+  F++RF+AI R+Y Y I    
Sbjct: 61  IVNFYSNAYRPLSAWQRGVNALL--PQDIKILAVQQVNNNFNSRFTAINRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + LD + M  A ++L+G  DF++FRS  CQ+++P R I   +    
Sbjct: 119 TSSPIFAEHCLWENRELDIDKMNQACEYLLGEQDFSSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+ VGSL  VG G  +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNLVGSLLKVGLGFESPEWIKVVLEAKDRTQAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|89073216|ref|ZP_01159746.1| tRNA pseudouridine synthase A [Photobacterium sp. SKA34]
 gi|89050926|gb|EAR56390.1| tRNA pseudouridine synthase A [Photobacterium sp. SKA34]
          Length = 261

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G+ Y+GWQRQ++  S+Q  +EKA+  V  + V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGVEYDGAKYYGWQRQRDVDSVQERLEKALSKVANQPVEVFCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF++  +   V      NA+L     I++   + V + FHARF+A  R Y Y I     
Sbjct: 61  VHFEINIDRKIVAWTMGANAHL--PKDIAVRWATEVSEDFHARFTATARRYRYIIFNNAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPAILGNGVSHYHGHLDEKKMHEAGQYLLGENDFTSFRAMHCQSRSPWRNLIHLNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+     +E  L  ++R   G  A  EGLY 
Sbjct: 179 DFVIIDIKANAFVHHMVRNITGSLIKVGKGEEKPEWIEWLLAQKNRTLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|226940175|ref|YP_002795248.1| tRNA pseudouridine synthase A [Laribacter hongkongensis HLHK9]
 gi|226715101|gb|ACO74239.1| TruA [Laribacter hongkongensis HLHK9]
          Length = 283

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 139/245 (56%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G G+ GWQRQ +  ++QG++E A+  + G  V V  AGRTD+GVHA +QV
Sbjct: 26  MRIALGLEYDGRGFAGWQRQPDQDTVQGALEGALSQIAGHPVSVLAAGRTDAGVHASQQV 85

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E       + +N +L     +++L +  V   FHARFSA  RSY Y ++    
Sbjct: 86  VHFDTGVERPLTAWVRGVNRFL--PPGVAVLWVQPVADDFHARFSACSRSYSYYLMNHPV 143

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             AL  GR       LD   M+ AA  L+G+HDF++FR+  CQA +P++T+  FD++   
Sbjct: 144 RPALGAGRVGWFHAPLDVPAMQAAAGLLLGQHDFSSFRAAECQAKTPVKTLARFDISEHD 203

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
            LI   + A +FLH  +R+ VG+L  VG G      +   L A+DR +  P   P+GLY 
Sbjct: 204 GLIRFDLQADAFLHHMVRNLVGALVYVGKGAHAPEWMAGLLAARDRTQAPPTFMPDGLYL 263

Query: 242 DSVEY 246
            +V Y
Sbjct: 264 TAVGY 268


>gi|153826201|ref|ZP_01978868.1| tRNA pseudouridine synthase A [Vibrio cholerae MZO-2]
 gi|149740061|gb|EDM54230.1| tRNA pseudouridine synthase A [Vibrio cholerae MZO-2]
          Length = 264

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EKA+  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKALSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDIAVRWAMAVPDEFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHDELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL +VG G+     ++  L  +DR      A  EGLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIVVGRGEQKPEWIQWLLAQKDRTLAAATAKAEGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|33152228|ref|NP_873581.1| tRNA pseudouridine synthase A [Haemophilus ducreyi 35000HP]
 gi|42559759|sp|Q7U335|TRUA_HAEDU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|33148450|gb|AAP95970.1| tRNA pseudouridine synthase A [Haemophilus ducreyi 35000HP]
          Length = 261

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q ++E+A+  VT   + V  AGRTDSGVH   QV
Sbjct: 1   MKVALGIEYDGSNYFGWQRQAEVVSVQQTLEEALSKVTNTTIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E      C   NA+L   + I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFDTEVERPLASWCFGTNAHLA--NDIAVKWAVKVAEDFHARFSATARRYRYIIFNSKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q+L+G  DF++FR+  CQ+ +P R I H +V   G
Sbjct: 119 RTAILPKGVAHYHYPLDAQKMHQAGQYLLGEQDFSSFRAAKCQSHTPWRNIHHLNVVRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + + + A +F+H  +R+ VGSL  VG G+     ++  L+ ++R+   P    EGLY 
Sbjct: 179 NYVIVDIQANAFVHHMVRNIVGSLLEVGQGRQPIEWIKWLLEQKNRQLAAPTTKAEGLYL 238

Query: 242 DSVEY 246
            +VEY
Sbjct: 239 VNVEY 243


>gi|326390628|ref|ZP_08212183.1| tRNA pseudouridine synthase A [Thermoanaerobacter ethanolicus JW
           200]
 gi|325993306|gb|EGD51743.1| tRNA pseudouridine synthase A [Thermoanaerobacter ethanolicus JW
           200]
          Length = 244

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 138/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +++EY+G+ Y GWQ QKN  ++Q  ++KAI  VTGE V + GA RTD+GVHAL Q
Sbjct: 1   MRNVMIVVEYDGTNYHGWQYQKNAVTVQEVLQKAIKKVTGEEVNLIGASRTDTGVHALYQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F    +     L  ALN+ L   D I ++    V+  FHAR+SA R+ Y Y I+ R+
Sbjct: 61  VANFKTNTKIPAEKLPYALNSVL--PDDIVVVQAKDVEDSFHARYSAKRKRYKYIILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +   +   W I   L  E M+ AA +L+G HDF+ F++     +S IRT+    +   
Sbjct: 119 FQMPTMRNYCWHIDYPLSIEKMKKAASYLIGTHDFSAFKASGSSKTSTIRTVYDLTIEKD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I I + A  FL+  +R  VG+L  VG GK    ++   L ++DR + G  APP+GLY
Sbjct: 179 EDFINIEIEANGFLYNMVRIIVGTLSYVGLGKIEVNEVYDILTSRDRTKAGITAPPQGLY 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LIKIMY 244


>gi|46143880|ref|ZP_00204588.1| COG0101: Pseudouridylate synthase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 262

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILPKGVSHYHYELDHQKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|190150230|ref|YP_001968755.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307263568|ref|ZP_07545183.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|238692338|sp|B3GXP8|TRUA_ACTP7 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|189915361|gb|ACE61613.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306871211|gb|EFN02940.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 262

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILPKGVSHYHYELDHQKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|153952894|ref|YP_001393659.1| tRNA pseudouridine synthase A [Clostridium kluyveri DSM 555]
 gi|189029994|sp|A5N4T0|TRUA_CLOK5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|146345775|gb|EDK32311.1| TruA [Clostridium kluyveri DSM 555]
          Length = 244

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    ++IEY+G+ Y GWQRQ N  +IQ  +E+AI   TGE   V G+ RTD+GVHA   
Sbjct: 1   MKNIKLVIEYDGTNYSGWQRQYNAITIQQRLEEAIEKATGEFSPVIGSSRTDAGVHARGF 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F    +     +   LN  L   + I++L+   VD  FH+R+    + Y Y I+T  
Sbjct: 61  VCNFFTASKIPTSNIKMVLNTLL--PEDIAVLDSKEVDSSFHSRYFTTGKEYSYTIVTGD 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  + +   +   + LD E ++ + ++ +G HDF+ F+     A S IRTI    V   
Sbjct: 119 RPPVIGRQYVYYFRRKLDIEKIKNSCEYFIGTHDFSAFKKKGSTARSSIRTIKELTVLKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            N+I+  +V   FL+  +R  +G+L  VG G+++   ++  L+++DR + G   P +GL 
Sbjct: 179 KNIIKFNIVGDGFLYNMVRIIIGTLLEVGLGRFSIEYVKYILESKDRAKAGKPVPAKGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|259047524|ref|ZP_05737925.1| tRNA pseudouridine synthase A [Granulicatella adiacens ATCC 49175]
 gi|259035715|gb|EEW36970.1| tRNA pseudouridine synthase A [Granulicatella adiacens ATCC 49175]
          Length = 249

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 86/247 (34%), Positives = 135/247 (54%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY + I+Y+G+ Y G+Q Q+NG+SIQ  + KA+  +T G+ + V G+GRTDSGVHA  
Sbjct: 1   MQRYKLTIQYDGTPYVGFQVQENGNSIQAELNKALKKMTKGQYIPVSGSGRTDSGVHANG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV H D  +      L +A+N+ L    +I I++   V ++FHAR+S   + Y+Y++ T 
Sbjct: 61  QVVHIDYPKRIEANSLVRAMNSLL--PTSIRIVSAEAVSEEFHARYSVTGKRYIYKVTTA 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           Q      +      P   D + +  A + ++G HDFT+F S      S +R +   +V  
Sbjct: 119 QVQSPFLRQYELHHPFKTDVDRINKAFEAVIGEHDFTSFCSTKSDKDSKVRVVTKAEVKR 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ +      + FL+  +R  VG+   +GDG     ++++ L+A DR   GP AP  GL
Sbjct: 179 NGDELIFTFEGKGFLYNMVRILVGTALQIGDGLREVEEMKQILEAMDRNAAGPTAPSHGL 238

Query: 240 YFDSVEY 246
           Y D V Y
Sbjct: 239 YLDEVFY 245


>gi|212635890|ref|YP_002312415.1| tRNA pseudouridine synthase A [Shewanella piezotolerans WP3]
 gi|226708659|sp|B8CPW5|TRUA_SHEPW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|212557374|gb|ACJ29828.1| tRNA pseudouridine synthase [Shewanella piezotolerans WP3]
          Length = 261

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS Y+GWQRQ +  S+QG +EKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 1   MRVALGIEYDGSRYYGWQRQLDVDSVQGQLEKALSKVANEPITVQCAGRTDTGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +N  L   D I++  + +VD++FHARFSA  R Y Y I   Q 
Sbjct: 61  VHFDTNAIRKETAWTLGVNVNL--PDDIAVRWVKVVDEEFHARFSATARRYRYMIYNHQL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +        ++D + M  AAQ  VG HDFT+FR++ CQ+ +P R I   +V   G
Sbjct: 119 RPGILRSGVSHYRGNIDEDKMHQAAQLFVGEHDFTSFRALQCQSKTPFREIHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VG+L  +G G      +   L  +DR +    A P GLY 
Sbjct: 179 MYICVDIKANAFLHHMVRNIVGTLLEIGKGNQPKEWVNTLLALKDRSKAAATAQPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|15896350|ref|NP_349699.1| tRNA pseudouridine synthase A [Clostridium acetobutylicum ATCC 824]
 gi|30913407|sp|Q97EL1|TRUA_CLOAB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|15026164|gb|AAK81039.1|AE007806_12 Pseudouridylate synthase, TRUA [Clostridium acetobutylicum ATCC
           824]
 gi|325510506|gb|ADZ22142.1| tRNA pseudouridine synthase A [Clostridium acetobutylicum EA 2018]
          Length = 244

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + +EY+G+ Y GWQ+QKN  ++Q  +EK I  +TGE + V G  RTDSGVHA   
Sbjct: 1   MKNVKLTLEYDGTNYCGWQKQKNVVTVQEEVEKIIGEITGEKIDVIGCSRTDSGVHAKAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
             +F       P      LN+ L   D I  LN   V   FH+RF    ++Y Y I+ R 
Sbjct: 61  TCNFKTNTVIPPEKFYLVLNSVL--PDDIVALNSEEVPMDFHSRFDNKGKTYSYTILNRL 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+++   +     L+C+ MR A ++++G HDFT+F+S   +  S IRTI    +   
Sbjct: 119 QRAAIDRNYVYQYGHKLNCDLMREATKYILGTHDFTSFKSTGSKVKSNIRTIYEARIVED 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            N +   V    FL+  +R  VG+L  VG+ K T  +++  ++++DR + G + P +GL 
Sbjct: 179 ENKVIFYVTGDGFLYNMVRIIVGTLLEVGEEKITPLNVKTIVESKDRTKAGRVVPAKGLC 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVMY 244


>gi|84394308|ref|ZP_00993032.1| tRNA pseudouridine synthase A [Vibrio splendidus 12B01]
 gi|84375076|gb|EAP91999.1| tRNA pseudouridine synthase A [Vibrio splendidus 12B01]
          Length = 264

 Score =  194 bits (493), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG+ YFGWQRQ++  S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MKIALGIEYNGTHYFGWQRQRDVKSVQEELEKALSVVANHPVEVMCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +   V      NA   +   I++   + V++ FHARFSA  R Y Y I     
Sbjct: 61  VHFETNVDRKMVAWTMGANAN--MPKDIAVRWATEVNEDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DFT+FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGHLDEKKMHEAGQYLLGENDFTSFRATHCQSRSPWRNMIHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG G+     ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 HYIVIDIKANAFVHHMVRNITGSLIAVGKGEQKPEWIQWLLEAKDRKVAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|182677494|ref|YP_001831640.1| tRNA pseudouridine synthase A [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|238691224|sp|B2IEW0|TRUA_BEII9 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|182633377|gb|ACB94151.1| tRNA pseudouridine synthase A [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 260

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 137/246 (55%), Positives = 173/246 (70%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ + GWQRQKNG S+Q  IE A+  + G  V + GAGRTD+GVHA  Q
Sbjct: 1   MPRYKLTVEYDGASFVGWQRQKNGLSVQEVIETALLAINGAPVGIRGAGRTDAGVHASAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL REW P +L  ALNA+      ++++    V + F ARFSAIRR YLYRII R+
Sbjct: 61  VAHADLAREWRPDVLRDALNAH-MRPALVAVVAAEPVPETFDARFSAIRRHYLYRIINRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APL  E GRAWL+ + LD   M  AAQ L GRHDF+TFR+  CQA+SPIRT++  DV + 
Sbjct: 120 APLTFEAGRAWLVKRRLDARAMHEAAQVLTGRHDFSTFRAAECQAASPIRTLERLDVQAV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+LIEIR  ARSFLH Q+RS VGSL++VG GKW++ DL  AL+A DR+ CG +AP  GLY
Sbjct: 180 GDLIEIRASARSFLHHQVRSMVGSLEMVGSGKWSAGDLRAALEACDRRRCGMVAPAAGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTGVDY 245


>gi|241668494|ref|ZP_04756072.1| tRNA pseudouridine synthase A [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877028|ref|ZP_05249738.1| tRNA pseudouridine synthetase A [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843049|gb|EET21463.1| tRNA pseudouridine synthetase A [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 258

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  SIQ  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSIQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F    +       +  NA L     I IL++ +VD  F++RF+A  R+Y Y I    
Sbjct: 61  VVNFHSDADRNLSSWMRGTNALL--PQDIKILDIKVVDNDFNSRFTAKNRTYNYIIYNSL 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + L+ + M  A ++L+G  DFT+FRS  CQ+++P R I   +    
Sbjct: 119 ISSPIFAEHCLWENRQLNIDKMNQACKYLLGEQDFTSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+F+GSL  VG    +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNFIGSLLKVGLEFESPEWIKLVLEAKDRTKAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|303252899|ref|ZP_07339058.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247890|ref|ZP_07529926.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648329|gb|EFL78526.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855692|gb|EFM87859.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 262

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKP 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+ +P R + + +V+  G
Sbjct: 119 RSAILPKGVSHYHYELDHQKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHYLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|182418813|ref|ZP_02950078.1| tRNA pseudouridine synthase A [Clostridium butyricum 5521]
 gi|237666467|ref|ZP_04526452.1| tRNA pseudouridine synthase A [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182377310|gb|EDT74871.1| tRNA pseudouridine synthase A [Clostridium butyricum 5521]
 gi|237657666|gb|EEP55221.1| tRNA pseudouridine synthase A [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 244

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IE++GS + GWQ+Q  G ++Q  IE+AIF  TGE ++++G+ RTDSGVHA   
Sbjct: 1   MRNIKLTIEFDGSEFCGWQKQPKGRTVQKVIEEAIFKATGEEIIINGSSRTDSGVHAKDM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +A+F            +ALN  L     +SI+    V + FHAR+S+  ++Y Y II R 
Sbjct: 61  IANFFTNSTIPGDKFREALNVRL--PKDVSIIRSEEVSEDFHARYSSKGKTYSYTIIHRY 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             ++      +     LD +NMR A ++ +G HDF  F S      + +RTI    +   
Sbjct: 119 ERVSFGHQYVYHWRHDLDIDNMREACKYFIGTHDFRAFMSPGSSIKTTVRTITDLHIEQN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I+I V A  FL+  +R  VG+L  VG+ K    D++  ++  +RK  G + PP GL 
Sbjct: 179 GEKIKIFVSADGFLYNMVRIIVGTLIKVGNKKLKPEDIQDIIREGNRKRAGMVVPPNGLV 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|17988610|ref|NP_541243.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 1 str. 16M]
 gi|62317861|ref|YP_223714.1| tRNA pseudouridine synthase A [Brucella abortus bv. 1 str. 9-941]
 gi|83269839|ref|YP_419130.1| tRNA pseudouridine synthase A [Brucella melitensis biovar Abortus
           2308]
 gi|148558621|ref|YP_001257944.1| tRNA pseudouridine synthase A [Brucella ovis ATCC 25840]
 gi|161621080|ref|YP_001594966.1| tRNA pseudouridine synthase A [Brucella canis ATCC 23365]
 gi|163845146|ref|YP_001622801.1| tRNA pseudouridine synthase A [Brucella suis ATCC 23445]
 gi|221090245|ref|YP_002519393.1| tRNA pseudouridine synthase A [Brucella suis 1330]
 gi|225629482|ref|ZP_03787515.1| tRNA pseudouridine synthase A [Brucella ceti str. Cudo]
 gi|225686787|ref|YP_002734759.1| tRNA pseudouridine synthase A [Brucella melitensis ATCC 23457]
 gi|237817402|ref|ZP_04596394.1| tRNA pseudouridine synthase A [Brucella abortus str. 2308 A]
 gi|254690653|ref|ZP_05153907.1| tRNA pseudouridine synthase A [Brucella abortus bv. 6 str. 870]
 gi|254696042|ref|ZP_05157870.1| tRNA pseudouridine synthase A [Brucella abortus bv. 3 str. Tulya]
 gi|254699151|ref|ZP_05160979.1| tRNA pseudouridine synthase A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700227|ref|ZP_05162055.1| tRNA pseudouridine synthase A [Brucella suis bv. 5 str. 513]
 gi|254703348|ref|ZP_05165176.1| tRNA pseudouridine synthase A [Brucella suis bv. 3 str. 686]
 gi|254705511|ref|ZP_05167339.1| tRNA pseudouridine synthase A [Brucella pinnipedialis M163/99/10]
 gi|254710742|ref|ZP_05172553.1| tRNA pseudouridine synthase A [Brucella pinnipedialis B2/94]
 gi|254712788|ref|ZP_05174599.1| tRNA pseudouridine synthase A [Brucella ceti M644/93/1]
 gi|254715857|ref|ZP_05177668.1| tRNA pseudouridine synthase A [Brucella ceti M13/05/1]
 gi|254732595|ref|ZP_05191173.1| tRNA pseudouridine synthase A [Brucella abortus bv. 4 str. 292]
 gi|256015792|ref|YP_003105801.1| tRNA pseudouridine synthase A [Brucella microti CCM 4915]
 gi|256029125|ref|ZP_05442739.1| tRNA pseudouridine synthase A [Brucella pinnipedialis M292/94/1]
 gi|256043901|ref|ZP_05446820.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256058808|ref|ZP_05449024.1| tRNA pseudouridine synthase A [Brucella neotomae 5K33]
 gi|256111035|ref|ZP_05452097.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 3 str.
           Ether]
 gi|256157317|ref|ZP_05455235.1| tRNA pseudouridine synthase A [Brucella ceti M490/95/1]
 gi|256253705|ref|ZP_05459241.1| tRNA pseudouridine synthase A [Brucella ceti B1/94]
 gi|256255835|ref|ZP_05461371.1| tRNA pseudouridine synthase A [Brucella abortus bv. 9 str. C68]
 gi|256262079|ref|ZP_05464611.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 2 str. 63/9]
 gi|260167783|ref|ZP_05754594.1| tRNA pseudouridine synthase A [Brucella sp. F5/99]
 gi|260545096|ref|ZP_05820917.1| tRNA pseudouridine synthase A [Brucella abortus NCTC 8038]
 gi|260565077|ref|ZP_05835562.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 1 str. 16M]
 gi|260567722|ref|ZP_05838191.1| tRNA pseudouridine synthase A [Brucella suis bv. 4 str. 40]
 gi|260756224|ref|ZP_05868572.1| pseudouridylate synthase [Brucella abortus bv. 6 str. 870]
 gi|260760407|ref|ZP_05872755.1| pseudouridylate synthase [Brucella abortus bv. 4 str. 292]
 gi|260763647|ref|ZP_05875979.1| pseudouridylate synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882048|ref|ZP_05893662.1| tRNA pseudouridine synthase A [Brucella abortus bv. 9 str. C68]
 gi|261216474|ref|ZP_05930755.1| pseudouridylate synthase [Brucella abortus bv. 3 str. Tulya]
 gi|261217618|ref|ZP_05931899.1| tRNA pseudouridine synthase A [Brucella ceti M13/05/1]
 gi|261220842|ref|ZP_05935123.1| tRNA pseudouridine synthase A [Brucella ceti B1/94]
 gi|261312915|ref|ZP_05952112.1| tRNA pseudouridine synthase A [Brucella pinnipedialis M163/99/10]
 gi|261318310|ref|ZP_05957507.1| tRNA pseudouridine synthase A [Brucella pinnipedialis B2/94]
 gi|261320495|ref|ZP_05959692.1| tRNA pseudouridine synthase A [Brucella ceti M644/93/1]
 gi|261322745|ref|ZP_05961942.1| tRNA pseudouridine synthase A [Brucella neotomae 5K33]
 gi|261750722|ref|ZP_05994431.1| tRNA pseudouridine synthase A [Brucella suis bv. 5 str. 513]
 gi|261753978|ref|ZP_05997687.1| tRNA pseudouridine synthase A [Brucella suis bv. 3 str. 686]
 gi|261757220|ref|ZP_06000929.1| tRNA pseudouridine synthase A [Brucella sp. F5/99]
 gi|265986108|ref|ZP_06098665.1| tRNA pseudouridine synthase A [Brucella pinnipedialis M292/94/1]
 gi|265990323|ref|ZP_06102880.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265992570|ref|ZP_06105127.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995802|ref|ZP_06108359.1| tRNA pseudouridine synthase A [Brucella ceti M490/95/1]
 gi|294853986|ref|ZP_06794658.1| tRNA pseudouridine synthase A [Brucella sp. NVSL 07-0026]
 gi|297249204|ref|ZP_06932905.1| tRNA pseudouridine synthase A [Brucella abortus bv. 5 str. B3196]
 gi|30913400|sp|Q8YDB2|TRUA_BRUME RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|62901254|sp|Q60CV4|TRUA_BRUSU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|81309258|sp|Q576T1|TRUA_BRUAB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|123754475|sp|Q2YJQ4|TRUA_BRUA2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166228682|sp|A5VVT9|TRUA_BRUO2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|189030128|sp|A9MCV8|TRUA_BRUC2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|189030129|sp|A9WW43|TRUA_BRUSI RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254789607|sp|C0RMH2|TRUA_BRUMB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|17984412|gb|AAL53507.1| tRNA pseudouridine synthase a [Brucella melitensis bv. 1 str. 16M]
 gi|54112373|gb|AAV28867.1| tRNA pseudouridine synthase A [Brucella suis 1330]
 gi|62198054|gb|AAX76353.1| TruA, tRNA pseudouridine synthase A [Brucella abortus bv. 1 str.
           9-941]
 gi|82940113|emb|CAJ13161.1| tRNA pseudouridine synthase [Brucella melitensis biovar Abortus
           2308]
 gi|148369906|gb|ABQ62778.1| tRNA pseudouridine synthase A [Brucella ovis ATCC 25840]
 gi|161337891|gb|ABX64195.1| tRNA pseudouridine synthase A [Brucella canis ATCC 23365]
 gi|163675869|gb|ABY39979.1| tRNA pseudouridine synthase A [Brucella suis ATCC 23445]
 gi|225615978|gb|EEH13027.1| tRNA pseudouridine synthase A [Brucella ceti str. Cudo]
 gi|225642892|gb|ACO02805.1| tRNA pseudouridine synthase A [Brucella melitensis ATCC 23457]
 gi|237788215|gb|EEP62431.1| tRNA pseudouridine synthase A [Brucella abortus str. 2308 A]
 gi|255998452|gb|ACU50139.1| tRNA pseudouridine synthase A [Brucella microti CCM 4915]
 gi|260098367|gb|EEW82241.1| tRNA pseudouridine synthase A [Brucella abortus NCTC 8038]
 gi|260152720|gb|EEW87813.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 1 str. 16M]
 gi|260154387|gb|EEW89468.1| tRNA pseudouridine synthase A [Brucella suis bv. 4 str. 40]
 gi|260670725|gb|EEX57665.1| pseudouridylate synthase [Brucella abortus bv. 4 str. 292]
 gi|260674068|gb|EEX60889.1| pseudouridylate synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676332|gb|EEX63153.1| pseudouridylate synthase [Brucella abortus bv. 6 str. 870]
 gi|260871576|gb|EEX78645.1| tRNA pseudouridine synthase A [Brucella abortus bv. 9 str. C68]
 gi|260918081|gb|EEX84942.1| pseudouridylate synthase [Brucella abortus bv. 3 str. Tulya]
 gi|260919426|gb|EEX86079.1| tRNA pseudouridine synthase A [Brucella ceti B1/94]
 gi|260922707|gb|EEX89275.1| tRNA pseudouridine synthase A [Brucella ceti M13/05/1]
 gi|261293185|gb|EEX96681.1| tRNA pseudouridine synthase A [Brucella ceti M644/93/1]
 gi|261297533|gb|EEY01030.1| tRNA pseudouridine synthase A [Brucella pinnipedialis B2/94]
 gi|261298725|gb|EEY02222.1| tRNA pseudouridine synthase A [Brucella neotomae 5K33]
 gi|261301941|gb|EEY05438.1| tRNA pseudouridine synthase A [Brucella pinnipedialis M163/99/10]
 gi|261737204|gb|EEY25200.1| tRNA pseudouridine synthase A [Brucella sp. F5/99]
 gi|261740475|gb|EEY28401.1| tRNA pseudouridine synthase A [Brucella suis bv. 5 str. 513]
 gi|261743731|gb|EEY31657.1| tRNA pseudouridine synthase A [Brucella suis bv. 3 str. 686]
 gi|262550099|gb|EEZ06260.1| tRNA pseudouridine synthase A [Brucella ceti M490/95/1]
 gi|262763440|gb|EEZ09472.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000992|gb|EEZ13682.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091768|gb|EEZ16099.1| tRNA pseudouridine synthase A [Brucella melitensis bv. 2 str. 63/9]
 gi|264658305|gb|EEZ28566.1| tRNA pseudouridine synthase A [Brucella pinnipedialis M292/94/1]
 gi|294819641|gb|EFG36641.1| tRNA pseudouridine synthase A [Brucella sp. NVSL 07-0026]
 gi|297173073|gb|EFH32437.1| tRNA pseudouridine synthase A [Brucella abortus bv. 5 str. B3196]
 gi|326411195|gb|ADZ68259.1| tRNA pseudouridine synthase A [Brucella melitensis M28]
 gi|326554486|gb|ADZ89125.1| tRNA pseudouridine synthase A [Brucella melitensis M5-90]
          Length = 251

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 131/248 (52%), Positives = 174/248 (70%), Gaps = 1/248 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ Y GWQRQ+NG ++QG+IE+A     GE + +  AGRTD+GVHA  Q
Sbjct: 1   MPRYKLTVEYDGTPYVGWQRQENGHAVQGAIEQAFKKFCGEDLTLSAAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKI-SDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL ++W    +  A+NA+L +  + ISILN+      F ARFSA  R YLYRI  R
Sbjct: 61  VAHVDLAKDWGAGKVRDAVNAHLVMADERISILNVEKTTDTFDARFSARARHYLYRIHNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLA++  RAW + K LD + M  AAQ L+G HDFTTFR+  CQA SP++T+D  DV  
Sbjct: 121 RAPLAVDYQRAWWVQKQLDADAMHEAAQRLLGEHDFTTFRATQCQAKSPVKTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+++E+RV ARSFLH Q+RSF GSL  VG G+WT+ DL+ AL+A+DRK CG +APP GL
Sbjct: 181 NGDMVEMRVSARSFLHNQVRSFAGSLMEVGVGRWTADDLQAALEARDRKACGQVAPPYGL 240

Query: 240 YFDSVEYS 247
           Y   V+Y+
Sbjct: 241 YLVGVDYA 248


>gi|149910526|ref|ZP_01899165.1| tRNA pseudouridine synthase A [Moritella sp. PE36]
 gi|149806369|gb|EDM66342.1| tRNA pseudouridine synthase A [Moritella sp. PE36]
          Length = 263

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 104/245 (42%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS Y+GWQRQK+  S+Q  +E A+  V    V VH AGRTDSGVH   QV
Sbjct: 1   MRIALGIEYDGSKYYGWQRQKDVISVQEKLEDALSRVANHPVRVHCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V     +NA L   D I++     VD++FHARFSA  R Y Y I   Q 
Sbjct: 61  VHFDTDAVRQDVAWTLGVNANL--PDDIAVRWALEVDEEFHARFSATARRYRYIIYNSQL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           +D E M  AAQ LVG HDFT+FR+ HCQA SPI+T+ H +V    
Sbjct: 119 RPAILSAGVSHYYGDIDVELMHEAAQQLVGEHDFTSFRAKHCQAKSPIKTMHHINVIRQN 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I V A +FLH  +R+  GSL  VG G    + + + L  +DR      +  EGLY 
Sbjct: 179 SYIIIDVKANAFLHHMVRNLAGSLMEVGKGNKPVSWIAELLAGKDRSVAAATSKAEGLYM 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|256762037|ref|ZP_05502617.1| tRNA pseudouridine synthase [Enterococcus faecalis T3]
 gi|256683288|gb|EEU22983.1| tRNA pseudouridine synthase [Enterococcus faecalis T3]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++    + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERASEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|229546930|ref|ZP_04435655.1| tRNA-pseudouridine synthase I [Enterococcus faecalis TX1322]
 gi|229550518|ref|ZP_04439243.1| tRNA-pseudouridine synthase I [Enterococcus faecalis ATCC 29200]
 gi|255971742|ref|ZP_05422328.1| tRNA pseudouridine synthase [Enterococcus faecalis T1]
 gi|255974742|ref|ZP_05425328.1| tRNA pseudouridine synthase [Enterococcus faecalis T2]
 gi|256618347|ref|ZP_05475193.1| tRNA pseudouridine synthase [Enterococcus faecalis ATCC 4200]
 gi|257081530|ref|ZP_05575891.1| tRNA pseudouridine synthase [Enterococcus faecalis E1Sol]
 gi|257417608|ref|ZP_05594602.1| tRNA pseudouridine synthase [Enterococcus faecalis AR01/DG]
 gi|257421532|ref|ZP_05598522.1| tRNA pseudouridine synthase [Enterococcus faecalis X98]
 gi|307276430|ref|ZP_07557553.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX2134]
 gi|307278640|ref|ZP_07559710.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0860]
 gi|312952641|ref|ZP_07771505.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0102]
 gi|229304375|gb|EEN70371.1| tRNA-pseudouridine synthase I [Enterococcus faecalis ATCC 29200]
 gi|229307858|gb|EEN73845.1| tRNA-pseudouridine synthase I [Enterococcus faecalis TX1322]
 gi|255962760|gb|EET95236.1| tRNA pseudouridine synthase [Enterococcus faecalis T1]
 gi|255967614|gb|EET98236.1| tRNA pseudouridine synthase [Enterococcus faecalis T2]
 gi|256597874|gb|EEU17050.1| tRNA pseudouridine synthase [Enterococcus faecalis ATCC 4200]
 gi|256989560|gb|EEU76862.1| tRNA pseudouridine synthase [Enterococcus faecalis E1Sol]
 gi|257159436|gb|EEU89396.1| tRNA pseudouridine synthase [Enterococcus faecalis ARO1/DG]
 gi|257163356|gb|EEU93316.1| tRNA pseudouridine synthase [Enterococcus faecalis X98]
 gi|306504700|gb|EFM73900.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0860]
 gi|306506910|gb|EFM76057.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX2134]
 gi|310629429|gb|EFQ12712.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0102]
 gi|315026801|gb|EFT38733.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX2137]
 gi|315147137|gb|EFT91153.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX4244]
 gi|315153575|gb|EFT97591.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0031]
 gi|315156245|gb|EFU00262.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0043]
 gi|315158610|gb|EFU02627.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0312]
 gi|315168134|gb|EFU12151.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX1341]
 gi|315171426|gb|EFU15443.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX1342]
 gi|323479455|gb|ADX78894.1| tRNA pseudouridine synthase A [Enterococcus faecalis 62]
 gi|327534038|gb|AEA92872.1| tRNA-pseudouridine synthase I [Enterococcus faecalis OG1RF]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|323699460|ref|ZP_08111372.1| tRNA pseudouridine synthase A [Desulfovibrio sp. ND132]
 gi|323459392|gb|EGB15257.1| tRNA pseudouridine synthase A [Desulfovibrio desulfuricans ND132]
          Length = 251

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 117/248 (47%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y G+ + GWQ Q    ++QG +E+A+  + G  V VHG+GRTD+GVHAL Q
Sbjct: 3   MTRIRLTLAYEGTDFCGWQVQPADRTVQGEVERALATILGRAVRVHGSGRTDAGVHALGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD           + LN  L     + +L+ + V   FHAR+ A+ ++Y Y +   +
Sbjct: 63  VVHFDCPDGRTGFPWQRGLNGIL--PRDVRVLDAAEVPDDFHARYGAVSKTYEYCLWHER 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN-- 178
                ++ R       +D   M  AA  L+G HDF  F+++     S +RT+     +  
Sbjct: 121 GFCLPQRRRFVWNCGPVDFARMEAAAGLLLGEHDFAAFQNVGTDVDSTVRTVTEISRHAG 180

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
              +    R  A  FL   +R+ VG L   G GK     +   L+A DR       PP+G
Sbjct: 181 PTAHESVWRFTADGFLKQMVRNLVGCLVACGRGKLDLDGVRVILEAGDRTLAPATVPPQG 240

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 241 LTLVRVAY 248


>gi|256956829|ref|ZP_05561000.1| tRNA pseudouridine synthase [Enterococcus faecalis DS5]
 gi|257078499|ref|ZP_05572860.1| tRNA pseudouridine synthase [Enterococcus faecalis JH1]
 gi|294781084|ref|ZP_06746435.1| tRNA pseudouridine synthase A [Enterococcus faecalis PC1.1]
 gi|300861778|ref|ZP_07107858.1| tRNA pseudouridine synthase A [Enterococcus faecalis TUSoD Ef11]
 gi|307269121|ref|ZP_07550482.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX4248]
 gi|307286980|ref|ZP_07567055.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0109]
 gi|312901088|ref|ZP_07760376.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0470]
 gi|256947325|gb|EEU63957.1| tRNA pseudouridine synthase [Enterococcus faecalis DS5]
 gi|256986529|gb|EEU73831.1| tRNA pseudouridine synthase [Enterococcus faecalis JH1]
 gi|294451887|gb|EFG20338.1| tRNA pseudouridine synthase A [Enterococcus faecalis PC1.1]
 gi|295112531|emb|CBL31168.1| pseudouridylate synthase I [Enterococcus sp. 7L76]
 gi|300848303|gb|EFK76060.1| tRNA pseudouridine synthase A [Enterococcus faecalis TUSoD Ef11]
 gi|306501926|gb|EFM71215.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0109]
 gi|306514601|gb|EFM83155.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX4248]
 gi|311291760|gb|EFQ70316.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0470]
 gi|315031173|gb|EFT43105.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0017]
 gi|315035981|gb|EFT47913.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0027]
 gi|315145370|gb|EFT89386.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX2141]
 gi|315165868|gb|EFU09885.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX1302]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 84/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        IRTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKIRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|315172660|gb|EFU16677.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX1346]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NEKGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|167748465|ref|ZP_02420592.1| hypothetical protein ANACAC_03209 [Anaerostipes caccae DSM 14662]
 gi|167652457|gb|EDR96586.1| hypothetical protein ANACAC_03209 [Anaerostipes caccae DSM 14662]
          Length = 252

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 121/246 (49%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + + Y+G+ Y GWQ Q   ++I+G + + +  + GE + V GA RTDSGVHAL  
Sbjct: 1   MKRIKLEVAYDGTNYCGWQIQPKDTTIEGILNEKLGSLLGEEITVIGASRTDSGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD   E     + +ALN  L   D I I + S V   FH R+   R++Y Y I   +
Sbjct: 61  VAVFDTETEIPGERIARALNQRL--PDDIVIQSSSEVKDDFHPRYQDTRKTYEYTIYNAE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +       +   LD E MR AA+  +G HDF +F +      + +RTI   +V   
Sbjct: 119 FDNPVTARHHHFVYVPLDAERMRTAARCFLGEHDFLSFSTTGSPTKTTVRTIYECEVRQN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I +RV    FL+  +R   G+L  +G G+     + +      R + GP AP +GL 
Sbjct: 179 GRYITMRVTGNGFLYNMVRMMAGTLISIGRGRKDPEWVRELFLHPKRGKAGPNAPAKGLT 238

Query: 241 FDSVEY 246
             ++ Y
Sbjct: 239 LINIHY 244


>gi|167648522|ref|YP_001686185.1| tRNA pseudouridine synthase A [Caulobacter sp. K31]
 gi|189029993|sp|B0T1S6|TRUA_CAUSK RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|167350952|gb|ABZ73687.1| tRNA pseudouridine synthase A [Caulobacter sp. K31]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 118/246 (47%), Positives = 161/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  Y G+Q Q +  S+QG+IE A+   TG+ + +  AGRTD+GVHA  Q
Sbjct: 1   MPRYRLTIEYDGRPYNGFQAQASQPSVQGAIEAAVKAFTGQTIRIAAAGRTDTGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL R+W    +  ALNA+L       +  + + D  +HARFSA  R YLYRI+ R+
Sbjct: 61  VVHVDLERDWPAETVMNALNAHLVREAISVLDAVVVSD-DWHARFSANERRYLYRILNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP ALE+G+ W + K +D + M+ AAQ LVG HDFTTFR + CQA SP++T+D   V+  
Sbjct: 120 APPALERGKVWHVKKPIDADAMQTAAQALVGLHDFTTFRDMACQAKSPLKTLDVARVSRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + +   ARSFLH Q+RS  G+L  VG G+WT+ D+  AL+A+DR  CGP+AP +GLY
Sbjct: 180 GDEVHLVFEARSFLHRQVRSMTGTLAEVGVGRWTADDVMAALEARDRTACGPVAPADGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LTGVGY 245


>gi|114046997|ref|YP_737547.1| tRNA pseudouridine synthase A [Shewanella sp. MR-7]
 gi|123131546|sp|Q0HWL5|TRUA_SHESR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|113888439|gb|ABI42490.1| tRNA pseudouridine synthase A [Shewanella sp. MR-7]
          Length = 261

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GSGYFGWQRQ    S+QG +E+A+  V  E + +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSGYFGWQRQAEVDSVQGQLEQALSKVANEPISLFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++     VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETNAIRNEGAWTLGVNANL--PDNIAVRWAKEVDDSFHARFSATARRYRYVIYNHNF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M +AAQ L+G  DFT+FR+I CQ+ +P R +    V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADKMHVAAQALLGEQDFTSFRAIQCQSKTPFRNVHSVKVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDISANAFLHHMVRNIVGSLLEIGLGNQPLTWMADLLALKDRNQAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|256960635|ref|ZP_05564806.1| tRNA pseudouridine synthase [Enterococcus faecalis Merz96]
 gi|293382724|ref|ZP_06628649.1| tRNA pseudouridine synthase A [Enterococcus faecalis R712]
 gi|293388093|ref|ZP_06632621.1| tRNA pseudouridine synthase A [Enterococcus faecalis S613]
 gi|312908619|ref|ZP_07767561.1| tRNA pseudouridine synthase A [Enterococcus faecalis DAPTO 512]
 gi|312909233|ref|ZP_07768090.1| tRNA pseudouridine synthase A [Enterococcus faecalis DAPTO 516]
 gi|256951131|gb|EEU67763.1| tRNA pseudouridine synthase [Enterococcus faecalis Merz96]
 gi|291079884|gb|EFE17248.1| tRNA pseudouridine synthase A [Enterococcus faecalis R712]
 gi|291082544|gb|EFE19507.1| tRNA pseudouridine synthase A [Enterococcus faecalis S613]
 gi|310625406|gb|EFQ08689.1| tRNA pseudouridine synthase A [Enterococcus faecalis DAPTO 512]
 gi|311290475|gb|EFQ69031.1| tRNA pseudouridine synthase A [Enterococcus faecalis DAPTO 516]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NKTGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|187776609|ref|ZP_02993082.1| hypothetical protein CLOSPO_00123 [Clostridium sporogenes ATCC
           15579]
 gi|187775268|gb|EDU39070.1| hypothetical protein CLOSPO_00123 [Clostridium sporogenes ATCC
           15579]
          Length = 246

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 136/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EK I  +T E V + GA RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGTNYCGWQKQKNEKFITLQGTLEKVISNITKEKVEITGASRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             + +F       P  L + +N  L     I +L+   V  +FH+RF +  ++Y Y I+ 
Sbjct: 61  GYMCNFFTNSRIPPENLQRVINNNL--PPDIVVLSSEEVSSEFHSRFCSKGKTYEYTILN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
           +  P+A+ +   +     LD + M+IA+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 KSEPIAIGRNYVFHFKYKLDIDKMKIASKYFIGTHDFSAFQTKGSSVKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+LI+  +    FL+  +R  VG+L  +G  K     +E  ++++DR++ G   P  G
Sbjct: 179 KSGDLIKFIITGDGFLYNMVRIIVGTLIEIGLNKREPEYIEYVIKSKDRRKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|167627942|ref|YP_001678442.1| tRNA pseudouridine synthase A [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189029995|sp|B0U0B1|TRUA_FRAP2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|167597943|gb|ABZ87941.1| tRNA-pseudouridine synthase I [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 258

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y + IEY G  Y GWQRQ +  SIQ  +EKA+  +  + + V  AGRTD+GVHA  Q
Sbjct: 1   MKNYLLQIEYFGKNYCGWQRQSHSPSIQEELEKALSKIANQNIEVTCAGRTDTGVHATSQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F    +       +  NA L     I IL++  VD  F++RF+A  R+Y Y I    
Sbjct: 61  VVNFHSDADRNLSSWMRGTNALL--PQGIKILDIKEVDNDFNSRFTATNRTYNYIIYNSA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +         + L+ + M  A ++L+G  DFT+FRS  CQ+++P R I   +    
Sbjct: 119 ISSPILAEHCLWENRQLNIDKMNQACKYLLGEQDFTSFRSSQCQSNTPFRNIQKAEFIKQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I   VV  +FLH  IR+F+GSL  +G    +   ++  L+A+DR +    A   GLY
Sbjct: 179 GSFIVFEVVGNAFLHHMIRNFIGSLLKIGLEFESPEWIKLVLEAKDRTKAAETAKAHGLY 238

Query: 241 FDSVEY 246
           F  VEY
Sbjct: 239 FVGVEY 244


>gi|323703515|ref|ZP_08115161.1| tRNA pseudouridine synthase A [Desulfotomaculum nigrificans DSM
           574]
 gi|323531506|gb|EGB21399.1| tRNA pseudouridine synthase A [Desulfotomaculum nigrificans DSM
           574]
          Length = 249

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 131/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNG--SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + + Y+G+ Y G+Q Q+    +++Q  +E A+  V  E V V GAGRTD+GVHA 
Sbjct: 3   MKNIKLTVAYDGTNYHGFQEQRGTGLATVQEVLEAALSKVANETVQVIGAGRTDAGVHAR 62

Query: 59  RQVAHFD-LVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
            QV +F           +  A+N+ L   D I+++    V   FHARFSA  ++Y Y I 
Sbjct: 63  GQVVNFRSTNWPVPTEKIHLAVNSLL--PDDIAVIKAEEVPLDFHARFSATAKTYRYSIY 120

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
             +    L +  A+  P+ LD E MR AAQ+L+G HDF +F++        +RTI   ++
Sbjct: 121 NHRVMSPLHRLYAYHEPRPLDIEAMRQAAQYLLGTHDFKSFQAQGTPVKDTVRTIYRAEL 180

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
            S   LI + +    FL+  +R   G+L  VG GK +  +++  ++A++R   G   PP 
Sbjct: 181 VSEPPLIHLYLRGNGFLYNMVRIITGTLLDVGKGKKSPPEMKSIIEARNRTRAGTTVPPH 240

Query: 238 GLYFDSVEY 246
           GL    VEY
Sbjct: 241 GLCLMEVEY 249


>gi|254720140|ref|ZP_05181951.1| tRNA pseudouridine synthase A [Brucella sp. 83/13]
 gi|265985146|ref|ZP_06097881.1| tRNA pseudouridine synthase A [Brucella sp. 83/13]
 gi|264663738|gb|EEZ33999.1| tRNA pseudouridine synthase A [Brucella sp. 83/13]
          Length = 251

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 131/248 (52%), Positives = 173/248 (69%), Gaps = 1/248 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ Y GWQRQ+NG ++QG+IE+A     GE + +  AGRTD+GVHA  Q
Sbjct: 1   MPRYKLTVEYDGTPYVGWQRQENGHAVQGAIEQAFKKFCGEELTLSAAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKI-SDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL ++W    +  A+NA+L +  + ISILN+      F ARFSA  R YLYRI  R
Sbjct: 61  VAHVDLAKDWGAGKVRDAVNAHLVMADERISILNVEKTTDTFDARFSARARHYLYRIHNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLA+   RAW + K LD + M  AAQ L+G HDFTTFR+  CQA SP++T+D  DV  
Sbjct: 121 RAPLAVNYQRAWWVQKQLDADAMHEAAQRLLGEHDFTTFRATQCQAKSPVKTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+++E+RV ARSFLH Q+RSF GSL  VG G+WT+ DL+ AL+A+DRK CG +APP GL
Sbjct: 181 NGDMVEMRVSARSFLHNQVRSFAGSLMEVGVGRWTADDLQAALEARDRKACGQVAPPYGL 240

Query: 240 YFDSVEYS 247
           Y   V+Y+
Sbjct: 241 YLVGVDYA 248


>gi|16124533|ref|NP_419097.1| tRNA pseudouridine synthase A [Caulobacter crescentus CB15]
 gi|221233219|ref|YP_002515655.1| tRNA pseudouridine synthase A [Caulobacter crescentus NA1000]
 gi|42559871|sp|Q9ABF0|TRUA_CAUCR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254789610|sp|B8GYF0|TRUA_CAUCN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|13421415|gb|AAK22265.1| tRNA pseudouridine synthase [Caulobacter crescentus CB15]
 gi|220962391|gb|ACL93747.1| tRNA pseudouridine synthase A [Caulobacter crescentus NA1000]
          Length = 247

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 120/246 (48%), Positives = 162/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G  Y G+Q Q    S+QG+IE A+    G+ V +  AGRTD+GVHA  Q
Sbjct: 1   MPRYRLLVEYDGRPYAGFQAQATLPSVQGAIEAAVKAFCGQEVRIAAAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL ++W    +  ALNA+L       + +  + ++ +HARFSA  R YLYRI+ R+
Sbjct: 61  VVHVDLDKDWPAQTVFNALNAHLTREAVSIL-SAEVAEEGWHARFSANERRYLYRILNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP AL+KGR W + K LD E M  AAQHL+G HDFTTFR +HCQ+ SP++T+D   V   
Sbjct: 120 APPALDKGRVWHMKKDLDHEAMHAAAQHLIGLHDFTTFRDMHCQSKSPVKTLDVARVRRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I +   ARSFLH Q+RS  G+L  VG G+WT  D++ AL+A+DR+ECGP+AP +GLY
Sbjct: 180 GEEIHLDFEARSFLHRQVRSMTGTLVEVGAGRWTVDDVKAALEARDRRECGPVAPADGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LVGVGY 245


>gi|113969768|ref|YP_733561.1| tRNA pseudouridine synthase A [Shewanella sp. MR-4]
 gi|123325149|sp|Q0HKB3|TRUA_SHESM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|113884452|gb|ABI38504.1| tRNA pseudouridine synthase A [Shewanella sp. MR-4]
          Length = 261

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GSGYFGWQRQ    S+QG +E+A+  V  E + +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSGYFGWQRQAEVDSVQGQLEQALSKVANEPISLFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++     VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETNAIRNEGAWTLGVNANL--PDNIAVRWAKEVDDSFHARFSATARRYRYVIYNHNF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M +AAQ L+G  DFT+FR++ CQ+ +P R +    V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADKMHVAAQALLGEQDFTSFRAVQCQSKTPFRNVHSVKVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDISANAFLHHMVRNIVGSLLEIGLGNQPLTWMADLLALKDRNQAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|85713817|ref|ZP_01044807.1| tRNA pseudouridine synthase A [Nitrobacter sp. Nb-311A]
 gi|85699721|gb|EAQ37588.1| tRNA pseudouridine synthase A [Nitrobacter sp. Nb-311A]
          Length = 245

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 128/246 (52%), Positives = 168/246 (68%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQ Q NG S+QG++E A+  + G+ V VHGAGRTD+GVHAL Q
Sbjct: 1   MPRYRLTIEYDGGPFCGWQYQDNGPSVQGALEAAVKAICGDCVRVHGAGRTDAGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ + + P  L   LNA+L+    I +L   IV   F ARFSA RR Y+YRI  R+
Sbjct: 61  VAHCDIAKHFAPDRLRDGLNAHLR-PHPIGVLEAEIVPDSFEARFSARRRHYIYRIANRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A LA++ GR W +P+ LD E M  AAQ L+G+HDFTTFR   CQA SP +T+D  DV   
Sbjct: 120 ANLAIDVGRVWRVPRPLDTEAMHDAAQRLLGKHDFTTFRDTECQAKSPEKTLDQLDVVRN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + I  +ARS+LH+Q+RS VGSL  VG G+W++ DL  AL A+ R+ CGP+APP+GLY
Sbjct: 180 GDNVSIITLARSYLHSQVRSMVGSLVWVGHGRWSADDLSSALAARRREACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LVRVDY 245


>gi|256855196|ref|ZP_05560557.1| tRNA pseudouridine synthase [Enterococcus faecalis T8]
 gi|307291679|ref|ZP_07571554.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0411]
 gi|256709709|gb|EEU24756.1| tRNA pseudouridine synthase [Enterococcus faecalis T8]
 gi|306497298|gb|EFM66840.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0411]
 gi|315028842|gb|EFT40774.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX4000]
          Length = 249

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IE+ +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEETLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|296159699|ref|ZP_06842522.1| tRNA pseudouridine synthase A [Burkholderia sp. Ch1-1]
 gi|295890143|gb|EFG69938.1| tRNA pseudouridine synthase A [Burkholderia sp. Ch1-1]
          Length = 270

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 133/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+GS + GWQ Q +G+++Q  +E+A+       V    AGRTD+GVH L Q
Sbjct: 1   MKRIALGVQYDGSAFCGWQSQPHGNTVQDELERALREFAQTPVQTIVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +   V   +  N++L    TIS+     +  +FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTEIDRADVSWVRGTNSFL--PKTISVQWAKPMPDEFHARFSAFERTYYYVLYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +  +LD + M+ AA HL+G HDF+ FRS  CQ+ +PI+ +   DV   
Sbjct: 119 VRSPMLATRAGWVHTALDVDAMQAAAAHLIGEHDFSAFRSSQCQSKTPIKHLHQIDVRQH 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +  R  A +FLH  +R+ +G L  +G G+     + + L ++DR    P   P+GLY
Sbjct: 179 GDFVHFRFRANAFLHHMVRNLMGCLVYIGRGRRPVEWMAEVLASRDRDFAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|160894723|ref|ZP_02075498.1| hypothetical protein CLOL250_02274 [Clostridium sp. L2-50]
 gi|156863657|gb|EDO57088.1| hypothetical protein CLOL250_02274 [Clostridium sp. L2-50]
          Length = 245

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 125/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q NG +I+  + + I  +  E + V GA RTD+GVHA   
Sbjct: 1   MKRVKLVVAYDGTNYHGWQVQDNGITIEEVLNRTISELVQEDIKVIGASRTDAGVHACGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN  L   D I I     VD  FH R++   ++Y Y I+ R+
Sbjct: 61  VAVFDTESRIPGDKFSFALNQRL--PDDIRIQESCEVDADFHPRYADTVKTYEYNILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +  ++  A      +D E M  AA +LVG HDF +F S   Q  + +RTI   +V   
Sbjct: 119 FEMPSKRLYAAFCYYPMDIERMNQAAAYLVGEHDFKSFCSAGAQVQTTVRTIYAVNVTKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +++ IR+    FL+  +R   G+L  VG G      +++ L+A+DR + GP A  +GL 
Sbjct: 179 DDMVHIRITGNGFLYNMVRIIAGTLMQVGTGLMEPERVKEILEARDRSKAGPTAVAKGLT 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LVEIRY 244


>gi|307266981|ref|ZP_07548497.1| tRNA pseudouridine synthase A [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917966|gb|EFN48224.1| tRNA pseudouridine synthase A [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 244

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 139/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +++EY+G+ Y GWQ Q+N  ++Q  ++KAI  VTGE V + GA RTD+GVHAL Q
Sbjct: 1   MRNVMIVVEYDGTNYHGWQYQENAVTVQEVLQKAIKKVTGEEVNLIGASRTDTGVHALYQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F    +     L  ALN+ L   D I ++    V+  FHAR+SA R+ Y Y I+ R+
Sbjct: 61  VANFRTNTKIPAEKLPYALNSVL--PDDIVVVQAKDVEDSFHARYSAKRKRYKYIILNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P+   +   W I   L  E M+ AA +L+G HDF+ F++     +S IRT+    +   
Sbjct: 119 FPMPTMRNYCWHISYPLSIEKMKKAASYLIGTHDFSAFKASGSSKTSTIRTVYDLTIEKN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I + A  FL+  +R  VG+L  VG GK    ++   L+++DR + G  APP+GLY
Sbjct: 179 EEFINIEIEANGFLYNMVRIIVGTLSYVGLGKIEENEVYDILKSRDRTKAGITAPPQGLY 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LIKIMY 244


>gi|165976323|ref|YP_001651916.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|307250146|ref|ZP_07532106.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307256957|ref|ZP_07538734.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|238687566|sp|B0BPI7|TRUA_ACTPJ RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|165876424|gb|ABY69472.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|306857811|gb|EFM89907.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306864532|gb|EFM96438.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 262

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+ +P R + + +V+  G
Sbjct: 119 RSAILPKGVSHYHYELDHQKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHYLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVGSLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|297582482|ref|YP_003698262.1| tRNA pseudouridine synthase A [Bacillus selenitireducens MLS10]
 gi|297140939|gb|ADH97696.1| tRNA pseudouridine synthase A [Bacillus selenitireducens MLS10]
          Length = 261

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 84/248 (33%), Positives = 128/248 (51%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG-EIVVVHGAGRTDSGVHALR 59
           M R  + IEY+GSG+ G+Q+Q N  ++QG +E+A+ ++   E      +GRTD+GVH +R
Sbjct: 1   MRRMLIRIEYDGSGFNGYQKQPNARTVQGELERALSVMHKAESWPCTSSGRTDTGVHGVR 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           Q  HFD            ALN+ L   D I +L    VD  FHAR+  + + Y YR+ T 
Sbjct: 61  QPVHFDSPLTIPDERWPMALNSLL--PDDIQVLGAMEVDASFHARYDTVGKVYRYRVDTA 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P ++D E MR AA+HL G HDFT+  S        +RT+    +  
Sbjct: 119 KRQTVFRRSFAAHFPGNMDIEAMREAAKHLEGTHDFTSLSSPKTDVKDKVRTLFAVSLEE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             +  ++      FL+  +R  +G+L  VG G W    +   ++ Q+R+  GP AP  GL
Sbjct: 179 REDGFDVVFAGSGFLYQMVRILMGTLIKVGSGDWPPDVIPAIIEKQERQAAGPTAPGHGL 238

Query: 240 YFDSVEYS 247
           Y + V Y+
Sbjct: 239 YLEDVFYT 246


>gi|288554758|ref|YP_003426693.1| tRNA pseudouridine synthase A [Bacillus pseudofirmus OF4]
 gi|288545918|gb|ADC49801.1| tRNA pseudouridine synthase A [Bacillus pseudofirmus OF4]
          Length = 247

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 85/248 (34%), Positives = 130/248 (52%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R   II Y+G+ + G+Q Q N  ++Q  IE+A+  V  G+ V V  +GRTD+GVHA  
Sbjct: 1   MNRIACIISYDGTNFSGYQVQPNKRTVQLEIEQALKRVHKGQEVSVTASGRTDAGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD           KALNA L     +   + +     FHAR+    + Y YR++  
Sbjct: 61  QVIHFDSPFRIPAAQWPKALNACLPDDIRVLSAHYAEK--DFHARYHTTGKEYRYRVLNA 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P    +     +  +LD + MR AA +L+G HDF+ F + +      +RT+   D+N 
Sbjct: 119 EDPDVFRRHHTAHVLYALDIDKMRQAAAYLIGTHDFSAFCAANTSVIDKVRTLYAVDINV 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +   +    FL+  +R  VG+L  VG GK T+  ++ AL+   R + G  APP+GL
Sbjct: 179 HEDELHFILRGNGFLYNMVRIIVGTLLEVGYGKRTAESVDTALRTCKRDDAGKTAPPQGL 238

Query: 240 YFDSVEYS 247
           Y  SV+Y+
Sbjct: 239 YLWSVQYN 246


>gi|260598738|ref|YP_003211309.1| tRNA pseudouridine synthase A [Cronobacter turicensis z3032]
 gi|260217915|emb|CBA32500.1| tRNA pseudouridine synthase A [Cronobacter turicensis z3032]
          Length = 262

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + IEY+GS Y+GWQRQ+   S+Q  +EKA+  V  E V V  AGRTD+GVHA  Q
Sbjct: 1   MRKIALGIEYDGSKYYGWQRQQEVRSVQEKLEKALSQVANEPVNVFCAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+             +NA L     I++  +  V  +FHARFSA  R Y Y I   +
Sbjct: 61  VVHFETTAVRKDAAWTLGVNANL--PGDIAVRWVKDVPAEFHARFSATARRYRYVIYNHR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+           LD + M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V  F
Sbjct: 119 LRPAVLSQGVTHYHLPLDAQRMHRAAQCLIGENDFTSFRAVQCQSRTPWRNLMHINVERF 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I + + A +F+H  +R+ VGSL  +G G    + + + L A+DR      A  EGLY
Sbjct: 179 GAYIVVDIKANAFVHHMVRNIVGSLMEIGCGNQPESWMAELLAAKDRTLAAATAKAEGLY 238

Query: 241 FDSVEY 246
             SV+Y
Sbjct: 239 LVSVDY 244


>gi|257084178|ref|ZP_05578539.1| tRNA pseudouridine synthase [Enterococcus faecalis Fly1]
 gi|256992208|gb|EEU79510.1| tRNA pseudouridine synthase [Enterococcus faecalis Fly1]
          Length = 249

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGRSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|227555887|ref|ZP_03985934.1| tRNA-pseudouridine synthase I [Enterococcus faecalis HH22]
 gi|256964165|ref|ZP_05568336.1| tRNA pseudouridine synthase [Enterococcus faecalis HIP11704]
 gi|257418666|ref|ZP_05595660.1| tRNA pseudouridine synthase [Enterococcus faecalis T11]
 gi|307274205|ref|ZP_07555413.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0855]
 gi|227175054|gb|EEI56026.1| tRNA-pseudouridine synthase I [Enterococcus faecalis HH22]
 gi|256954661|gb|EEU71293.1| tRNA pseudouridine synthase [Enterococcus faecalis HIP11704]
 gi|257160494|gb|EEU90454.1| tRNA pseudouridine synthase [Enterococcus faecalis T11]
 gi|306509167|gb|EFM78229.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0855]
 gi|315573548|gb|EFU85739.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0309B]
 gi|315582104|gb|EFU94295.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0309A]
          Length = 249

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGRSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|117919927|ref|YP_869119.1| tRNA pseudouridine synthase A [Shewanella sp. ANA-3]
 gi|166229837|sp|A0KV94|TRUA_SHESA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|117612259|gb|ABK47713.1| tRNA pseudouridine synthase A [Shewanella sp. ANA-3]
          Length = 261

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GSGYFGWQRQ    S+QG +E+A+  V  E + +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSGYFGWQRQAEVDSVQGQLEQALSKVANEPISLFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++     VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETNAIRNEGAWTLGVNANL--PDNIAVRWAKEVDDTFHARFSATARRYRYVIYNHNF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M +AAQ L+G  DFT+FR+I CQ+ +P R +    V   G
Sbjct: 119 RPGILRHGVSHYHGDIDTDKMHVAAQALLGEQDFTSFRAIQCQSKTPFRNVHSVKVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDISANAFLHHMVRNIVGSLLEIGLGNQPLTWMADLLALKDRNQAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|146312509|ref|YP_001177583.1| tRNA pseudouridine synthase A [Enterobacter sp. 638]
 gi|166991163|sp|A4WCV2|TRUA_ENT38 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|145319385|gb|ABP61532.1| tRNA pseudouridine synthase A [Enterobacter sp. 638]
          Length = 270

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  + + V  AGRTD+GVH   QV
Sbjct: 10  HRIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANQPIAVCCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L     I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 70  VHFETTSVRKDAAWTLGVNANL--PGDIAVRWVKDVPDDFHARFSATARRYRYIIYNQRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V+ +G
Sbjct: 128 RPAVLGQGVTHFYEPLDAERMQRAAQSLIGENDFTSFRAVQCQSRTPWRNVMHINVSRYG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGAGHQPESWIAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            SV+Y
Sbjct: 248 VSVDY 252


>gi|153938429|ref|YP_001392800.1| tRNA pseudouridine synthase A [Clostridium botulinum F str.
           Langeland]
 gi|152934325|gb|ABS39823.1| tRNA pseudouridine synthase A [Clostridium botulinum F str.
           Langeland]
 gi|295320780|gb|ADG01158.1| tRNA pseudouridine synthase A [Clostridium botulinum F str. 230613]
          Length = 246

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EKAI  +T E + V GA RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGANYCGWQKQKNEKFITLQGTLEKAISNITKEKIEVIGASRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             + +F    +  P  L K +N  L     I +L+      +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYICNFFTNTKIPPENLQKVINNNL--PPDIVVLSSEEASSEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM++A+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 SSQPIAIGRNYIFQFKNKLNIDNMKMASRYFIGTHDFSAFKTKGSSIKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG+L  +G  K     ++  ++++DR + G   P  G
Sbjct: 179 KKGDFIKFIITGDGFLYNMVRIMVGTLIEIGLNKREPEYIKYVIKSKDRTKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|319898267|ref|YP_004158360.1| tRNA pseudouridine synthase A [Bartonella clarridgeiae 73]
 gi|319402231|emb|CBI75764.1| tRNA pseudouridine synthase A [Bartonella clarridgeiae 73]
          Length = 247

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 130/247 (52%), Positives = 166/247 (67%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQ N  +IQGSIE+AIF  +G+ + +  AGRTD+GVHA  Q
Sbjct: 1   MARFKLTLEYDGSNYAGWQRQANLRTIQGSIEQAIFHFSGQKLTITTAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D  + W    +  ALNA+L+   + ISILN+  V   F ARF A +R YL++I+ R
Sbjct: 61  VAHIDFEKNWNTHTVRDALNAHLQKQGEDISILNVQNVPDNFDARFCATKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P  L   R W +PK LD + M  AAQ LVG+HDFTTFRS HCQA SPIRT++  D+  
Sbjct: 121 RSPPVLNAKRVWWLPKPLDADAMHKAAQRLVGQHDFTTFRSAHCQAKSPIRTLERLDIQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A++R  CG +APP GL
Sbjct: 181 KGEEIFLYAQARSFLHHQIRSFAGSLMEVGIGRWTAEDLEAALHAKNRARCGVVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   V+Y
Sbjct: 241 YLIKVDY 247


>gi|227520026|ref|ZP_03950075.1| tRNA-pseudouridine synthase I [Enterococcus faecalis TX0104]
 gi|227072574|gb|EEI10537.1| tRNA-pseudouridine synthase I [Enterococcus faecalis TX0104]
          Length = 249

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGRSVTVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|114567807|ref|YP_754961.1| pseudouridylate synthase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317314|sp|Q0AUL4|TRUA_SYNWW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|114338742|gb|ABI69590.1| Pseudouridylate synthase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 249

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++EY+GS Y G+Q QKN +++Q  +EKAI+ ++GE   +  AGRTD+GVHA  Q
Sbjct: 1   MSRIKLLLEYDGSNYHGFQLQKNANTVQAELEKAIYRLSGERATIVCAGRTDAGVHAWGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V  FD            ALN+ L   + I +L       +F+ RF A+++ Y Y I  ++
Sbjct: 61  VVAFDSCSTIPGDRWAYALNSQL--PEDIQVLESQETRAEFNPRFDALKKCYGYLIYRQK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +  A    + L  E M+ AA+ L GR +F +F +    A +  R I H  ++  
Sbjct: 119 KKATFYRHYALCNTEPLKLEAMQEAAEILKGRQNFRSFCASGSSARTFEREIFHCRLSEK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + + + A  FL+  +R   G+L  VG GK+    L + + +QDR   GP APP+GLY
Sbjct: 179 GPCLLLHIAADGFLYNMVRIITGTLLEVGKGKYPPQHLREIIASQDRTRAGPTAPPQGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LLQVFY 244


>gi|170756303|ref|YP_001783087.1| tRNA pseudouridine synthase A [Clostridium botulinum B1 str. Okra]
 gi|169121515|gb|ACA45351.1| tRNA pseudouridine synthase A [Clostridium botulinum B1 str. Okra]
          Length = 246

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EKAI  +T E + V GA RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGANYCGWQKQKNEKFITLQGTLEKAISNITKEKIEVIGASRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             + +F    +  P  L K +N  L     I +L+      +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYICNFFTNTKIPPENLQKVINNNL--PPDIVVLSSEEASSEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM++A+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 SSQPIAIGRNYIFQFKDKLNIDNMKMASRYFIGTHDFSAFKTKGSSIKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG+L  +G  K     ++  ++++DR + G   P  G
Sbjct: 179 KKGDFIKFIITGDGFLYNMVRIMVGTLIEIGLNKREPEYIKYVIKSKDRTKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|209547671|ref|YP_002279588.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238057734|sp|B5ZN21|TRUA_RHILW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|209533427|gb|ACI53362.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 268

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 150/247 (60%), Positives = 188/247 (76%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V + GAGRTDSGVHA+ Q
Sbjct: 1   MPRFRMTVEYDGGPYVGWQRQENGPSVQGAIEAAVLSLTGETVSIRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL + W P  L  ALNA+L+   + +SIL++  V + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKAWSPYQLQNALNAHLRLAGERVSILDVEAVAEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK LD E M  AAQ LVGRHDF+TFR+ HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGRHDFSTFRAAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 SGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFLQVDY 247


>gi|120598385|ref|YP_962959.1| tRNA pseudouridine synthase A [Shewanella sp. W3-18-1]
 gi|166229838|sp|A1RIB0|TRUA_SHESW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|120558478|gb|ABM24405.1| tRNA pseudouridine synthase A [Shewanella sp. W3-18-1]
          Length = 261

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GSGYFGWQRQ    S+QG +E+A+ +V  E + +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSGYFGWQRQAEVDSVQGQLERALSIVANEPIGLFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +        ++D + M  AAQ L+G  DFT+FR++ CQ+ +P R +   +V   G
Sbjct: 119 RPGILRHGVSHYHGNIDADKMHQAAQVLLGEQDFTSFRAVQCQSKTPFRNVHSVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|301156483|emb|CBW15954.1| pseudouridylate synthase I [Haemophilus parainfluenzae T3T1]
          Length = 264

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y GWQRQ+   S+Q  +EKA+  V  E + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYNGKQYCGWQRQEKVRSVQEELEKALSFVANEKIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA L   D IS+    +VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETTAVRPEKAWAFGTNANL--PDDISVSWAKVVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+++P R + H +V   G
Sbjct: 119 RSAILPEGITHCHLDLDEKKMHQAGQFLLGENDFSSFRAAQCQSNTPWRNVHHLNVVRKG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G      ++  L+ +DRK   P A PEGLY 
Sbjct: 179 QFVIVDIQANAFVHHMVRNIVGSLIEVGAGNQPVEWMKWLLEQKDRKLAAPTAKPEGLYL 238

Query: 242 DSVEY 246
            +V Y
Sbjct: 239 VNVIY 243


>gi|86148380|ref|ZP_01066673.1| tRNA pseudouridine synthase A [Vibrio sp. MED222]
 gi|218708902|ref|YP_002416523.1| tRNA pseudouridine synthase A [Vibrio splendidus LGP32]
 gi|254764875|sp|B7VL84|TRUA_VIBSL RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|85833863|gb|EAQ52028.1| tRNA pseudouridine synthase A [Vibrio sp. MED222]
 gi|218321921|emb|CAV17914.1| tRNA pseudouridine synthase A [Vibrio splendidus LGP32]
          Length = 264

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG+ YFGWQRQ++  S+Q  +EKA+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MKIALGIEYNGTHYFGWQRQRDVKSVQEELEKALSVVANHPVEVMCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +   V      NA   +   I++   + V++ FHARFSA  R Y Y I     
Sbjct: 61  VHFETNVDRKMVAWTMGANAN--MPKDIAVRWATEVNEDFHARFSATARRYRYIIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  A Q+L+G +DFT+FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGHLDEKKMHEAGQYLLGENDFTSFRATHCQSRSPWRNMIHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I + A +F+H  +R+  GSL  VG G      ++  L+A+DRK  G  A  EGLY 
Sbjct: 179 HYIVIDIKANAFVHHMVRNITGSLIAVGKGDQKPEWIQWLLEAKDRKVAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|75677245|ref|YP_319666.1| tRNA pseudouridine synthase A [Nitrobacter winogradskyi Nb-255]
 gi|123759229|sp|Q3SN27|TRUA_NITWN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|74422115|gb|ABA06314.1| tRNA pseudouridine synthase [Nitrobacter winogradskyi Nb-255]
          Length = 255

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 129/246 (52%), Positives = 167/246 (67%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQ Q NG S+QG++E A+  + G+ V VHGAGRTD+GVHAL Q
Sbjct: 1   MPRYKLTIEYDGGPFCGWQYQTNGPSVQGALEAAVKAICGDDVRVHGAGRTDAGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ R ++P  L   LNA+L+    I +L   IV   F ARFSA RR Y+YRI  R+
Sbjct: 61  VAHCDIARHFMPDRLRDGLNAHLR-PHPIGVLEAEIVPDSFEARFSARRRHYIYRIANRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A LA++ GR W +P+ LD E M  AAQ L+G+HDFTTFR   CQA SP +T+D  DV   
Sbjct: 120 ANLAIDVGRVWRVPRPLDTEAMHAAAQRLLGKHDFTTFRDTECQAKSPEKTLDQLDVIRN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + I   ARS+LH+Q+RS VGSL  VG G+W + DL  AL A+ R+ CGP+APP+GLY
Sbjct: 180 GDNVSIITSARSYLHSQVRSMVGSLVWVGHGRWNADDLSGALAARRREACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LARVDY 245


>gi|260893342|ref|YP_003239439.1| tRNA pseudouridine synthase A [Ammonifex degensii KC4]
 gi|260865483|gb|ACX52589.1| tRNA pseudouridine synthase A [Ammonifex degensii KC4]
          Length = 259

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 83/243 (34%), Positives = 125/243 (51%), Gaps = 2/243 (0%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
             + + Y+G+ + G+QRQ    ++QG +E+A+  +T E   V GAGRTD+GVHA  QV  
Sbjct: 6   VALKVAYDGTAFSGFQRQPGLRTVQGVLEEALARLTKETCQVKGAGRTDAGVHAEGQVVS 65

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F          L  ALN  L     +++L  + V +QFH R+ A+ + Y Y    R    
Sbjct: 66  FRTASSIPTPRLVPALNGLL--PPDVAVLAAAEVPEQFHPRYDAVSKVYRYTFFRRAVRC 123

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
            L +  A  +P+ LD E MR AA +L GRHDF  F++      S +RT+    +   G  
Sbjct: 124 PLTRFYALHVPEPLDVERMREAAAYLGGRHDFRAFQNTGRPVKSSVRTVFSCRLEEAGPF 183

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           +   + A  FL+  +R   G+L  +G GK   + +  AL+  +R+  GP APP GL    
Sbjct: 184 LYFWIEADGFLYQMVRVIAGTLLEIGRGKLEPSVILAALEKGERQLLGPTAPPHGLCLVQ 243

Query: 244 VEY 246
           V+Y
Sbjct: 244 VKY 246


>gi|319404987|emb|CBI78590.1| tRNA pseudouridine synthase A [Bartonella sp. AR 15-3]
          Length = 247

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 129/247 (52%), Positives = 169/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQK+  +IQGSIEKA+F  +G+ + +  AGRTD+GVHA+ Q
Sbjct: 1   MARFKLTLEYDGSNYAGWQRQKSLRTIQGSIEKAVFHFSGQKLTITTAGRTDAGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D  + W   I+  ALNA+L+   + I +LN+  V   F ARF A +R YL++I+ R
Sbjct: 61  VAHIDFEKHWNTHIVRDALNAHLQKQGEDIVVLNVQSVPDNFDARFCATKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W +PK LD + M  AAQ LVG+HDFTTFRS HCQA SP+RT++  D+  
Sbjct: 121 RSPPALNAKRVWWLPKPLDADAMHKAAQRLVGQHDFTTFRSAHCQAKSPVRTLERLDIQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A++R  CG +APP GL
Sbjct: 181 EGEEIVLYAQARSFLHHQIRSFAGSLMEVGIGRWTAEDLEAALHAKNRARCGVVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   V+Y
Sbjct: 241 YLIKVDY 247


>gi|325567346|ref|ZP_08144013.1| tRNA pseudouridine synthase A [Enterococcus casseliflavus ATCC
           12755]
 gi|325158779|gb|EGC70925.1| tRNA pseudouridine synthase A [Enterococcus casseliflavus ATCC
           12755]
          Length = 248

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 79/249 (31%), Positives = 126/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY   I Y+G+ + G+QRQ NG ++Q  IEK +  +  G+ + +HG+GRTD+GVHA  
Sbjct: 1   MVRYKATIAYDGTNFQGFQRQPNGRTVQEEIEKTLTKMNNGQPIQIHGSGRTDAGVHAQG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  ++     +   L+   +  + +++ ++ IVD  FHAR+  + ++Y +R+   
Sbjct: 61  QVIHFDFPQKRPLEKMRFGLDT--QTPEDVAVKSVEIVDDTFHARYLVVEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A    +G HDFT+F +         RTI    +  
Sbjct: 119 KPRSPFRRHYASYYPYPLDLEKIQRALPDFLGTHDFTSFCATGSSVDDKTRTIHEASMAV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NDAGDELIFTFRGDGFLYKMIRIMVGTLLKIGNGRIAPDSIPAIIAQKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 239 GLYLVHVAY 247


>gi|168178866|ref|ZP_02613530.1| tRNA pseudouridine synthase A [Clostridium botulinum NCTC 2916]
 gi|226950899|ref|YP_002805990.1| tRNA pseudouridine synthase A [Clostridium botulinum A2 str. Kyoto]
 gi|182670055|gb|EDT82031.1| tRNA pseudouridine synthase A [Clostridium botulinum NCTC 2916]
 gi|226843785|gb|ACO86451.1| tRNA pseudouridine synthase A [Clostridium botulinum A2 str. Kyoto]
          Length = 246

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 136/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EKAI  +T E + V GA RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGANYCGWQKQKNEKFITLQGTLEKAISNITKEKIEVIGASRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             + +F    +  P  L K +N  L     I +L+      +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYICNFFTNTKIPPENLQKVINNNL--PPDIVVLSSEEASSEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM++A+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 SSKPIAIGRNYIFQFKDKLNIDNMKMASRYFIGTHDFSAFKTKGSSIKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG+L  +G  K     ++  ++++DR++ G   P  G
Sbjct: 179 KKGDFIKFIITGDGFLYNMVRIIVGTLIEIGLNKREPEYIKYVIKSKDRRKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|241202830|ref|YP_002973926.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856720|gb|ACS54387.1| tRNA pseudouridine synthase A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 272

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 150/247 (60%), Positives = 188/247 (76%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ M +EY+G  Y GWQRQ+NG S+QG+IE A+  +TGE V+V GAGRTDSGVHA+ Q
Sbjct: 1   MPRFRMTVEYDGGPYVGWQRQENGHSVQGAIEAAVLSLTGETVLVRGAGRTDSGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL +EW P  L  ALNA+L+   + +SIL +    + F ARFSA+RR YLYRI++R
Sbjct: 61  VIHADLSKEWSPYQLQNALNAHLRLAGERVSILEVEAAPEFFDARFSALRRHYLYRIVSR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLALE G+AW +PK LD E M  AAQ LVG+HDF+TFR+ HCQA+SP+RT+D  DV  
Sbjct: 121 RAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGKHDFSTFRAAHCQANSPVRTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LIEIR  A+SFLH QIRSF G+LKL G+GKWT  D+E AL+A+DRK CGP+APP+GL
Sbjct: 181 NGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAALEARDRKACGPVAPPDGL 240

Query: 240 YFDSVEY 246
           YF  V+Y
Sbjct: 241 YFMQVDY 247


>gi|239825725|ref|YP_002948349.1| tRNA pseudouridine synthase A [Geobacillus sp. WCH70]
 gi|259550397|sp|C5D3U9|TRUA_GEOSW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|239806018|gb|ACS23083.1| tRNA pseudouridine synthase A [Geobacillus sp. WCH70]
          Length = 248

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 128/246 (52%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            R    + Y+G+ +FG+Q Q    ++QG +E+ +  +  G+ + V  +GRTD+GVHA  Q
Sbjct: 3   KRIKCTLSYDGTHFFGYQIQPGKRTVQGELERVLEQMHKGKAIRVTASGRTDAGVHAYGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD      P    KALNA L   D I I ++   D  FHARFSA  + Y Y++   Q
Sbjct: 63  VIHFDTFLSLSPDQWKKALNAQL--PDDIVIKDVQEADPSFHARFSAKAKEYRYKVRIAQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +   +  P  LD E MR A + + G HDFT+F S        +RTI   D+   
Sbjct: 121 ERDVFLRNYCYHYPYPLDMEAMRHALRLIEGTHDFTSFCSAKTDVDDRVRTIYKADMAMH 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +L+E   +   FL+  +R  VG++  VG GK +   +  A +A+DR+  G  APP+GLY
Sbjct: 181 DDLLEFCFIGNGFLYNMVRIIVGTILEVGQGKRSIDSISHAFEAKDRQFAGKTAPPQGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LWKVYY 246


>gi|69247200|ref|ZP_00604262.1| tRNA pseudouridine synthase [Enterococcus faecium DO]
 gi|257878755|ref|ZP_05658408.1| tRNA pseudouridine synthase [Enterococcus faecium 1,230,933]
 gi|257881397|ref|ZP_05661050.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,502]
 gi|257890614|ref|ZP_05670267.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,410]
 gi|258615179|ref|ZP_05712949.1| tRNA pseudouridine synthase A [Enterococcus faecium DO]
 gi|293562977|ref|ZP_06677444.1| tRNA pseudouridine synthase A [Enterococcus faecium E1162]
 gi|314937639|ref|ZP_07844965.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133a04]
 gi|314942862|ref|ZP_07849675.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133C]
 gi|314948002|ref|ZP_07851406.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0082]
 gi|314950919|ref|ZP_07853988.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133A]
 gi|314991433|ref|ZP_07856910.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133B]
 gi|314995046|ref|ZP_07860166.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133a01]
 gi|68194965|gb|EAN09433.1| tRNA pseudouridine synthase [Enterococcus faecium DO]
 gi|257812983|gb|EEV41741.1| tRNA pseudouridine synthase [Enterococcus faecium 1,230,933]
 gi|257817055|gb|EEV44383.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,502]
 gi|257826974|gb|EEV53600.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,410]
 gi|291605103|gb|EFF34570.1| tRNA pseudouridine synthase A [Enterococcus faecium E1162]
 gi|313590772|gb|EFR69617.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133a01]
 gi|313593913|gb|EFR72758.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133B]
 gi|313596928|gb|EFR75773.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133A]
 gi|313598334|gb|EFR77179.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133C]
 gi|313643016|gb|EFS07596.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0133a04]
 gi|313645600|gb|EFS10180.1| tRNA pseudouridine synthase A [Enterococcus faecium TX0082]
          Length = 248

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY  II Y+G+ + G+Q+Q NG ++Q  +EK +  +  G+ + V G+GRTD+GVHA+ 
Sbjct: 1   MVRYKAIIAYDGTNFNGFQKQPNGRTVQEEVEKTLQKMANGKEITVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     +  AL+   +  + I++  + IV + FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDYPEERPLERMRFALDT--QSPEDIAVRQVEIVSEDFHARYLVKEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A   L+G HDFT+F +        IRTI    +  
Sbjct: 119 KPRSPFRRHYASYFPYPLDLEKIQRALPDLLGTHDFTSFCASGSSIEDKIRTIYEAKMEV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NETKDELLFTFRGNGFLYKMIRILVGTLLKIGNGRLPEDSIPDIIAKKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLYEVKY 247


>gi|322807772|emb|CBZ05347.1| tRNA pseudouridine synthase A [Clostridium botulinum H04402 065]
          Length = 246

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EKAI  +T E + V GA RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGANYCGWQKQKNEKFITLQGTLEKAISNITKEKIEVIGASRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             + +F    +  P  L K +N  L     I +L+      +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYICNFFTNTKIPPENLQKVINNNL--PPDIVVLSSEEASSEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM++A+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 SSQPIAIGRNYIFQFKDKLNIDNMKMASRYFIGTHDFSAFKTKGSSIKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG+L  +G  K     ++  ++++DR + G   P  G
Sbjct: 179 KKGDFIKFIITGDGFLYNMVRIIVGTLIEIGLNKRKPEYIKYVIKSKDRTKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|257088682|ref|ZP_05583043.1| tRNA pseudouridine synthase [Enterococcus faecalis CH188]
 gi|256997494|gb|EEU84014.1| tRNA pseudouridine synthase [Enterococcus faecalis CH188]
 gi|315160761|gb|EFU04778.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0645]
 gi|315579360|gb|EFU91551.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0630]
          Length = 249

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLVRMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|254496537|ref|ZP_05109407.1| tRNA pseudouridine synthase A [Legionella drancourtii LLAP12]
 gi|254354236|gb|EET12901.1| tRNA pseudouridine synthase A [Legionella drancourtii LLAP12]
          Length = 262

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  +++EY+GS Y GWQ Q    ++Q ++E A+  V    + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALVLEYDGSHYHGWQAQTGLHTVQQALEHALSKVADCPISVVCAGRTDTGVHATNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD  +E          N++L  S  + +     + + F+AR+SA  R Y Y I     
Sbjct: 61  VHFDTDKERSIRAWIHGANSFL--SKDVCVKWGKELSETFNARYSATARRYRYVIYNGAI 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             AL +       + LD   M  AAQ L+G +DFT+FRS+ CQ+++P+R I    V    
Sbjct: 119 RPALLRSNVTWQYRQLDHRLMHQAAQLLLGENDFTSFRSVECQSNTPMRNIHKLQVTRTN 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           +L+ I + A +FLH  +R+  G L  VG GK   + +++ L+A+DR+     AP  GLY 
Sbjct: 179 DLVIIDITANAFLHHMVRNIAGVLIAVGSGKHPVSWVDEVLKARDRRLGAETAPAYGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VQVTY 243


>gi|225570923|ref|ZP_03779946.1| hypothetical protein CLOHYLEM_07027 [Clostridium hylemonae DSM
           15053]
 gi|225160385|gb|EEG73004.1| hypothetical protein CLOHYLEM_07027 [Clostridium hylemonae DSM
           15053]
          Length = 282

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 77/245 (31%), Positives = 120/245 (48%), Gaps = 1/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  ++I Y+G+ Y GWQ Q NG +I+  +   +  +TGE + V GA RTDSGVHAL  V
Sbjct: 37  RRIRLVIAYDGTDYCGWQIQPNGITIEEVLNGVLTKLTGEDIHVIGASRTDSGVHALGNV 96

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A FD      P  +  ALN  L     I   +          R   + ++Y Y I     
Sbjct: 97  AVFDTASSIPPERMAYALNQRLPKDIVIVRSDEVPAGWHPRYR-DVVIKTYEYHIYNAPV 155

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L++  +  I   L+ E MR  A++L+G HDF +F ++       +RT+    ++S G
Sbjct: 156 QNPLKRRTSTHISFPLNVEKMREGAKYLIGEHDFASFCNVRTSVKDTVRTVTELRIDSDG 215

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I +R+    FL+  +R   G+L  VG G +    +++ L+A++R   G   PP GL  
Sbjct: 216 PEIIMRITGNGFLYNMVRIIAGTLIRVGRGFYEPEKVKEILEAKERTGAGVTVPPNGLVL 275

Query: 242 DSVEY 246
             ++Y
Sbjct: 276 VEIDY 280


>gi|311278721|ref|YP_003940952.1| tRNA pseudouridine synthase A [Enterobacter cloacae SCF1]
 gi|308747916|gb|ADO47668.1| tRNA pseudouridine synthase A [Enterobacter cloacae SCF1]
          Length = 270

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 93/244 (38%), Positives = 132/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E V V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPVTVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   E         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETRAERKDAAWTLGVNANL--PGDIAVRWVKYVADDFHARFSATARRYRYVIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD   M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V  +G 
Sbjct: 129 PAVLSQGVTHYHQPLDAARMQRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVERYGA 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAGNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           SV+Y
Sbjct: 249 SVDY 252


>gi|319406472|emb|CBI80113.1| tRNA pseudouridine synthase A [Bartonella sp. 1-1C]
          Length = 247

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 128/247 (51%), Positives = 169/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQKN  +IQGSIE AIF  +G+ + +  AGRTD+GVHA+ Q
Sbjct: 1   MARFKLTLEYDGSNYAGWQRQKNLRTIQGSIENAIFHFSGQKLTITTAGRTDAGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D  + W    +  ALNA+L+   + I++LN+  V   F ARF A +R YL++I+ R
Sbjct: 61  VAHIDFEKNWNTNTVRDALNAHLQKQGENIAVLNVQNVPDNFDARFCATKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W +PK LD + M  AAQ LVG+HDFTTFRS +CQA SP+RT++  D+  
Sbjct: 121 RSPPALNTKRVWWLPKPLDADAMHKAAQKLVGQHDFTTFRSAYCQAKSPVRTLERLDIQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A++R  CG +APP GL
Sbjct: 181 EGDEIFLYAQARSFLHHQIRSFAGSLMEVGIGRWTAEDLEAALHARNRARCGVVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   V+Y
Sbjct: 241 YLMKVDY 247


>gi|315151105|gb|EFT95121.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0012]
          Length = 249

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLARMNNGRSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 239 GLYLAEVRY 247


>gi|260558318|ref|ZP_05830514.1| tRNA pseudouridine synthase [Enterococcus faecium C68]
 gi|261207023|ref|ZP_05921712.1| tRNA pseudouridine synthase [Enterococcus faecium TC 6]
 gi|289565342|ref|ZP_06445792.1| tRNA pseudouridine synthase A [Enterococcus faecium D344SRF]
 gi|294615363|ref|ZP_06695236.1| tRNA pseudouridine synthase A [Enterococcus faecium E1636]
 gi|294618289|ref|ZP_06697870.1| tRNA pseudouridine synthase A [Enterococcus faecium E1679]
 gi|260075492|gb|EEW63798.1| tRNA pseudouridine synthase [Enterococcus faecium C68]
 gi|260078651|gb|EEW66353.1| tRNA pseudouridine synthase [Enterococcus faecium TC 6]
 gi|289162832|gb|EFD10682.1| tRNA pseudouridine synthase A [Enterococcus faecium D344SRF]
 gi|291591737|gb|EFF23373.1| tRNA pseudouridine synthase A [Enterococcus faecium E1636]
 gi|291595383|gb|EFF26695.1| tRNA pseudouridine synthase A [Enterococcus faecium E1679]
          Length = 248

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY  II Y+G+ + G+Q+Q NG ++Q  +EK +  +  G+ + V G+GRTD+GVHA+ 
Sbjct: 1   MVRYKAIIAYDGTNFNGFQKQPNGRTVQEEVEKTLQKMANGKEITVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     +  AL+   +  + I++  + IV + FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDYPEERPLERMRFALDT--QSPEDIAVRQVEIVSEDFHARYLVKEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A   L+G HDFT+F +        +RTI    +  
Sbjct: 119 KPRSPFRRHYASYFPYPLDLEKIQRALPDLLGTHDFTSFCASGSSIEDKVRTIYEAKMEV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NETKDELLFTFRGNGFLYKMIRILVGTLLKIGNGRLPEDSIPDIIAKKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLYEVKY 247


>gi|332290494|ref|YP_004421346.1| tRNA pseudouridine synthase A [Gallibacterium anatis UMN179]
 gi|330433390|gb|AEC18449.1| tRNA pseudouridine synthase A [Gallibacterium anatis UMN179]
          Length = 265

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + I Y+GS YFGWQ+Q++  SIQ  +E+A+  +  E + +  AGRTD+GVHA  Q
Sbjct: 1   MKKIALGISYDGSRYFGWQKQQSVQSIQNELEQALSTIANEPIEIFCAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+              N +L   + I++   + V++ FHARFSA+ R Y Y I  R 
Sbjct: 61  VIHFETSASRPLQAWIFGTNVHL--PNDIAVKWSTEVNEDFHARFSALSRRYRYIIYNRP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+           LD + M IA Q+L+G +DF++FR+  CQ+ SP R + H  V+  
Sbjct: 119 QRFAILPTGITHHHYPLDEKLMHIAGQYLLGENDFSSFRAAQCQSKSPYRNVHHLQVSRI 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + + + A +F+H  +R+ VGSL +VG+GK     ++  LQ +DR    P A   GLY
Sbjct: 179 GDYLIVDIQANAFVHHMVRNIVGSLLVVGEGKQKPEWIKWLLQQRDRSCAAPTAKAAGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVKVHY 244


>gi|257876163|ref|ZP_05655816.1| tRNA pseudouridine synthase [Enterococcus casseliflavus EC20]
 gi|257810329|gb|EEV39149.1| tRNA pseudouridine synthase [Enterococcus casseliflavus EC20]
          Length = 248

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 79/249 (31%), Positives = 125/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY   I Y+G+ + G+QRQ NG ++Q  IEK +  +  G+ + +HG+GRTD+GVHA  
Sbjct: 1   MVRYKATIAYDGTNFQGFQRQPNGRTVQEEIEKTLTKMNNGQPIQIHGSGRTDAGVHAQG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  ++     +   L+   +  + +++  + IVD  FHAR+  + ++Y +R+   
Sbjct: 61  QVIHFDFPQKRPLEKMRFGLDT--QTPEDVAVKAVEIVDDTFHARYLVVEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A    +G HDFT+F +         RTI    +  
Sbjct: 119 KPRSPFRRHYASYYPYPLDLEKIQRALPDFLGTHDFTSFCATGSSVDDKTRTIHEASMAV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NDAGDELIFTFRGDGFLYKMIRIMVGTLLKIGNGRLAPDSIPAIIAQKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 239 GLYLVHVAY 247


>gi|297182649|gb|ADI18807.1| pseudouridylate synthase [uncultured SAR11 cluster bacterium
           HF4000_37C10]
          Length = 245

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 114/246 (46%), Positives = 159/246 (64%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQ QKNG SIQ  ++ AIF  + E VVV GAGRTDSGVHAL Q
Sbjct: 1   MQRYKIKIEYDGTPFVGWQFQKNGPSIQEVLQNAIFNFSKEKVVVTGAGRTDSGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL ++         +N ++       +       K+FHARF A +R+Y Y II RQ
Sbjct: 61  VAHFDLKKKIKKKSFLPGVNQHIGNKPVTVLKINK-TSKKFHARFDAKKRTYQYTIINRQ 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +PLAL+K +AW I K LD + M+  A+ L+G HDF+TFR+  C A SPI+T+++  V   
Sbjct: 120 SPLALQKNKAWHIRKKLDVKAMKKGAKLLLGTHDFSTFRASSCGAKSPIKTMENISVKKN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I ++  +RSFL  Q+RS VGS+K +GDGKW   D +K+ ++++R +C P AP  GLY
Sbjct: 180 KDKITLKFTSRSFLQQQVRSMVGSIKYLGDGKWKLDDFKKSFKSKNRLKCAPPAPACGLY 239

Query: 241 FDSVEY 246
              ++Y
Sbjct: 240 LTKIKY 245


>gi|308270748|emb|CBX27358.1| tRNA pseudouridine synthase A [uncultured Desulfobacterium sp.]
          Length = 246

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 134/246 (54%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
             + + IEY+G+ + GWQRQ NG +IQG IEKAIF +T + + + GAGRTD+GVHAL QV
Sbjct: 3   KNFKLTIEYDGTAFNGWQRQLNGRTIQGEIEKAIFAMTKQKIALTGAGRTDAGVHALAQV 62

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A+F       P    + LN+ L     I I     V ++FH+R+ +  + Y Y+I+ R  
Sbjct: 63  ANFICDTNLEPDSFYRGLNSLL--PGDIIIKLCEQVCEKFHSRYDSKSKLYRYKILNRPL 120

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD-VNSF 180
           P A+ +   W I   LD + MR A   + G  DF  F        S IRT+   + + + 
Sbjct: 121 PSAIGRNYLWFIKSPLDLKAMREAVLFIAGTRDFKAFEGSGSPRKSTIRTVLRSELIENE 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            N+I+  + A  FL   +R+ VGSL  VG GK    D++  L ++DR++    APP GL+
Sbjct: 181 DNIIQFEIEADGFLRFMVRNIVGSLISVGLGKLKPLDIKTILDSKDRRKASATAPPGGLF 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LVKVRY 246


>gi|160941032|ref|ZP_02088370.1| hypothetical protein CLOBOL_05925 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435981|gb|EDP13748.1| hypothetical protein CLOBOL_05925 [Clostridium bolteae ATCC
           BAA-613]
          Length = 247

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 128/247 (51%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q    +I+  + +A+  +  E + V GA RTDSGVHA   
Sbjct: 1   MKRIRLVVAYDGTQYHGWQIQPGAVTIESVLNEALTQLMREPIQVIGASRTDSGVHARGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD   +  P  +C ALN  L   + I +     V   +H R     ++Y YRI+ R+
Sbjct: 61  VAVFDTESQMPPDKICMALNQRL--PEDIRVQVSEEVPSDWHPRKCTCIKTYEYRILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             + +E+  +      LD + M+ AA  L G HDF +F S+  Q +  +RT+   DV   
Sbjct: 119 INMPMERLYSHFCYYKLDVDRMQAAANMLAGEHDFKSFCSVRTQVTDTVRTVYRIDVTRN 178

Query: 181 -GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             ++I IRV    FL+  +R   G+L  VG G   + D+   L+A+DR+  GP AP  GL
Sbjct: 179 ADDIITIRVTGNGFLYNMVRIIAGTLMAVGTGHIQAEDMPSILEAKDRRAAGPTAPARGL 238

Query: 240 YFDSVEY 246
               ++Y
Sbjct: 239 TLIEMKY 245


>gi|257866559|ref|ZP_05646212.1| tRNA pseudouridine synthase [Enterococcus casseliflavus EC30]
 gi|257872925|ref|ZP_05652578.1| tRNA pseudouridine synthase [Enterococcus casseliflavus EC10]
 gi|257800517|gb|EEV29545.1| tRNA pseudouridine synthase [Enterococcus casseliflavus EC30]
 gi|257807089|gb|EEV35911.1| tRNA pseudouridine synthase [Enterococcus casseliflavus EC10]
          Length = 248

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 125/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY   I Y+G+ + G+QRQ NG ++Q  IEK +  +  G+ + + G+GRTD+GVHA  
Sbjct: 1   MVRYKATIAYDGTNFQGFQRQPNGRTVQEEIEKTLTKMNNGQPIQIQGSGRTDAGVHAQG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  ++     +   L+   +  + +++ ++ IVD  FHAR+  + ++Y +R+   
Sbjct: 61  QVIHFDFPQKRPLEKMRFGLDT--QTPEDVAVKSVEIVDDTFHARYLVVEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A    +G HDFT+F +         RTI    +  
Sbjct: 119 KPRSPFRRHYASYYPYPLDLEKIQRALPDFLGTHDFTSFCATGSSVDDKTRTIHEASMAV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NDAGDELIFTFRGDGFLYKMIRIMVGTLLKIGNGRLAPDSIPAIIAQKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 239 GLYLVHVAY 247


>gi|254293237|ref|YP_003059260.1| tRNA pseudouridine synthase A [Hirschia baltica ATCC 49814]
 gi|254041768|gb|ACT58563.1| tRNA pseudouridine synthase A [Hirschia baltica ATCC 49814]
          Length = 247

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 119/246 (48%), Positives = 158/246 (64%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IEY+GS Y GWQRQK   S+Q  +E+AI    GE V VHGAGRTD+GVHA+ Q
Sbjct: 1   MARFKLTIEYDGSPYVGWQRQKTHRSVQQVLEEAIPKFAGETVTVHGAGRTDAGVHAMGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL +E+    +  A+N ++K  + +SIL    V  +FHARFSA  R Y+YRII R+
Sbjct: 61  VAHIDLSKEFTTDKVRDAMNHFMK-DEPVSILLAEEVSDEFHARFSAYARHYIYRIIDRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A L  ++  AW     +D + M  AAQ LVG+HDF+TFR   CQA SP++T+   +V   
Sbjct: 120 ADLTFDRNLAWRAMSPVDADAMHEAAQCLVGKHDFSTFRDAQCQAESPVKTLSKIEVIRD 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I I V A SFLH Q+RS  GSL  +G GK   + +++ L A DR  CG +APP+GLY
Sbjct: 180 GDEINIYVSAPSFLHRQVRSITGSLMEIGRGKKPISWMQEILGAADRSRCGTVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LSQVDY 245


>gi|293374636|ref|ZP_06620951.1| tRNA pseudouridine synthase A [Turicibacter sanguinis PC909]
 gi|325845439|ref|ZP_08168732.1| tRNA pseudouridine synthase A [Turicibacter sp. HGF1]
 gi|292646726|gb|EFF64721.1| tRNA pseudouridine synthase A [Turicibacter sanguinis PC909]
 gi|325488545|gb|EGC90961.1| tRNA pseudouridine synthase A [Turicibacter sp. HGF1]
          Length = 258

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 130/246 (52%), Gaps = 4/246 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R    + Y+G+ + G+QRQ    ++QG IE A+  ++ + V +H +GRTD+GVHA  Q
Sbjct: 1   MKRIKCTVAYDGTLFNGYQRQPGQRTVQGEIEAALEKISKQPVTIHSSGRTDTGVHAYGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD V         +ALN+ L   + I I++   V  +FH+R+    + Y YR+ +  
Sbjct: 61  VFHFDSVVNMDGSRYVRALNSIL--PEDIYIIDSQEVHPEFHSRYHGKVKEYRYRL-SLN 117

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +++   +    SLD E MR A  +L+G H+FT+F   +      +RTI   D+   
Sbjct: 118 EYNPMKRNYVYYHRFSLDVEKMREAMTYLLGTHNFTSFCG-NLDDIDKVRTIYQADLIDE 176

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              +    V   FL   IR  VG+L  +G+GK    D++  ++A++RK  G  A P+GLY
Sbjct: 177 DGELTFIFVGNGFLRYMIRIMVGTLIQIGEGKKKPEDIKTIIEAKNRKLAGHTAKPQGLY 236

Query: 241 FDSVEY 246
              V+Y
Sbjct: 237 LQRVDY 242


>gi|268608385|ref|ZP_06142112.1| tRNA pseudouridine synthase A [Ruminococcus flavefaciens FD-1]
          Length = 257

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 125/247 (50%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + I Y G+ Y G+Q Q N  ++QG++EK +  V  E V + G  RTD+GVHA   
Sbjct: 1   MRNLKVTIAYRGTNYHGFQIQNNAVTVQGTLEKHLSKVLNEPVSITGCSRTDTGVHANMF 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
             +         +  C+ +N  L   D ISIL+   V   FHARF    + Y+Y++   +
Sbjct: 61  CFNVKTNSRISTLGFCRGVNGEL--PDDISILSCEEVPIDFHARFDCKGKEYIYKMHCSE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +         +   +  D E  R AAQ+ VG HDF++F +     S+ +RTI  F + + 
Sbjct: 119 SKDPFAPDMKFHYRRPFDIEAARKAAQYFVGTHDFSSFCADCTNVSTTVRTIYSFKIENS 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + + V    FL+  IR   G+L  V + +++  D+ + L+A+DR + G  A   GLY
Sbjct: 179 GDTVIMLVKGNGFLYNMIRIMAGTLIDVSEKRFSPDDMPRILEAKDRLQAGRTAMAHGLY 238

Query: 241 FDSVEYS 247
            + V YS
Sbjct: 239 LNRVFYS 245


>gi|92119152|ref|YP_578881.1| tRNA pseudouridine synthase A [Nitrobacter hamburgensis X14]
 gi|123264920|sp|Q1QH76|TRUA_NITHX RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|91802046|gb|ABE64421.1| tRNA pseudouridine synthase A [Nitrobacter hamburgensis X14]
          Length = 245

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 126/246 (51%), Positives = 165/246 (67%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQ Q NG S+QG++E A+  + G+ V VHGAGRTD+GVHAL Q
Sbjct: 1   MPRYKLTIEYDGGPFCGWQYQDNGPSVQGALEAAVKAICGDAVRVHGAGRTDAGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ + + P  L   LNA+L+    I +L   IV   F ARFSA+RR Y+YRI  R+
Sbjct: 61  VAHCDIAKHFAPNRLRDGLNAHLR-PHPIGVLTAEIVPDTFEARFSALRRHYVYRIANRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A LA++ G  W +P+ LD   M  AAQ L+G+HDFTTFR   CQA SP +T+D  DV   
Sbjct: 120 ANLAIDVGHVWRVPRPLDTLAMHAAAQRLIGKHDFTTFRDTECQAKSPEKTLDQLDVVRN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + I   ARSFLH+Q+RS VGSL  VG G+W++ DL  AL  + R+ CGP+APP+GLY
Sbjct: 180 GDTVTIVTSARSFLHSQVRSMVGSLVWVGHGRWSADDLSNALAERRREACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LVRVDY 245


>gi|296104004|ref|YP_003614150.1| tRNA pseudouridine synthase A [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058463|gb|ADF63201.1| tRNA pseudouridine synthase A [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 270

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 133/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 10  HKVALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPINVLCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L     I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 70  VHFETTAVRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYVIYNQRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V+ FG
Sbjct: 128 RPAVLSQGVTHFYEPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHINVSRFG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGAGHQPESWIAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            SV+Y
Sbjct: 248 VSVDY 252


>gi|254492043|ref|ZP_05105220.1| tRNA pseudouridine synthase A [Methylophaga thiooxidans DMS010]
 gi|224462740|gb|EEF79012.1| tRNA pseudouridine synthase A [Methylophaga thiooxydans DMS010]
          Length = 259

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 101/245 (41%), Positives = 139/245 (56%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY G+ + GWQ Q N  ++QG +EKA  +V    + V  AGRTD+GVHAL QV
Sbjct: 1   MRIALGIEYAGTDFCGWQNQPNTRTVQGELEKAASVVANHSIDVFAAGRTDTGVHALNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L     I++  +  VD +F+ARF+AI+R Y Y I+ R +
Sbjct: 61  VHFDTDAIRSERGWLLGINANL--PKDINVAWMKPVDDEFNARFTAIKRRYRYLILNRLS 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+   R W     LD E M+ AA  LVG+HDF+ FR+  CQA SPI+T+D   V    
Sbjct: 119 RSAVHHNRMWWHHHPLDIERMQAAADQLVGKHDFSAFRASECQARSPIKTLDKITVRRQQ 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I + V A+SFLH  +R+ VG +  +GDG          L++ DR + G  APP+GLY 
Sbjct: 179 DCIAVDVEAKSFLHHMVRNLVGVMAAIGDGSKPVDWAGDVLRSVDRSQGGVTAPPQGLYL 238

Query: 242 DSVEY 246
             VEY
Sbjct: 239 VDVEY 243


>gi|148381387|ref|YP_001255928.1| tRNA pseudouridine synthase A [Clostridium botulinum A str. ATCC
           3502]
 gi|153931537|ref|YP_001385762.1| tRNA pseudouridine synthase A [Clostridium botulinum A str. ATCC
           19397]
 gi|153934471|ref|YP_001389169.1| tRNA pseudouridine synthase A [Clostridium botulinum A str. Hall]
 gi|148290871|emb|CAL85007.1| tRNA pseudouridine synthase [Clostridium botulinum A str. ATCC
           3502]
 gi|152927581|gb|ABS33081.1| tRNA pseudouridine synthase A [Clostridium botulinum A str. ATCC
           19397]
 gi|152930385|gb|ABS35884.1| tRNA pseudouridine synthase A [Clostridium botulinum A str. Hall]
          Length = 246

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EKAI  +T E + V GA RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGANYCGWQKQKNEKFITLQGTLEKAISNITKEKIEVIGASRTDSGVHAR 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             + +F    +  P  L K +N  L     I +L+      +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYICNFFTNTKIPPENLQKVINNIL--PPDIVVLSSEEASSEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM++A+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 SSKPIAIGRNYIFQFKDKLNIDNMKMASRYFIGTHDFSAFKTKGSSIKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG+L  +G  K     ++  ++++DR + G   P  G
Sbjct: 179 KKGDFIKFIITGDGFLYNMVRIIVGTLIEIGLNKREPEYIKYVIKSKDRTKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|325578129|ref|ZP_08148264.1| tRNA pseudouridine synthase A [Haemophilus parainfluenzae ATCC
           33392]
 gi|325159865|gb|EGC71994.1| tRNA pseudouridine synthase A [Haemophilus parainfluenzae ATCC
           33392]
          Length = 264

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y GWQRQ+   S+Q  +EKA+  V  E + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYNGKQYCGWQRQEKVRSVQEELEKALSFVANEKIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA L   D IS+    +VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETTAVRPEKAWAFGTNANL--PDDISVSWAKVVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+++P R + H +V   G
Sbjct: 119 RSAILPEGITHCHLDLDEKKMHQAGQFLLGENDFSSFRAAQCQSNTPWRNVHHLNVVRKG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G      ++  L+ +DRK   P A PEGLY 
Sbjct: 179 QYVIVDIQANAFVHHMVRNIVGSLIEVGAGNQPVEWMKWLLEQKDRKLAAPTAKPEGLYL 238

Query: 242 DSVEY 246
            +V Y
Sbjct: 239 VNVIY 243


>gi|255284006|ref|ZP_05348561.1| tRNA pseudouridine synthase A [Bryantella formatexigens DSM 14469]
 gi|255265459|gb|EET58664.1| tRNA pseudouridine synthase A [Bryantella formatexigens DSM 14469]
          Length = 245

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 127/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ Q N  +I+  +   +  + GE + V GA RTD+GVHAL  
Sbjct: 1   MKRVKLIVAYDGTNYSGWQIQPNAVTIESMLNLHLSELLGEPIRVIGASRTDAGVHALGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +  A+N  L     I I +   V   FH RF    ++Y YRI+ R+
Sbjct: 61  VAVFDTSARMPAEKISYAMNTRL--PQDIRIQDSCEVAADFHPRFCKTIKTYEYRILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +  +      LD ENMR A  +LVG HDF +  +   +  + +RTI   D+   
Sbjct: 119 FPDPTRRLYSLFYYYPLDVENMRRALAYLVGEHDFKSLCTHKEEVENTVRTIYEADIQKD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++I IR+    FL+  +R  VG+L  VG G +    +++ L A++R+  G  APP+GL 
Sbjct: 179 GDMISIRISGNGFLYNMVRIIVGTLLRVGSGYYPPEYMQELLAAKNRQAAGETAPPQGLT 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LLEIRY 244


>gi|293567901|ref|ZP_06679242.1| tRNA pseudouridine synthase A [Enterococcus faecium E1071]
 gi|291589486|gb|EFF21293.1| tRNA pseudouridine synthase A [Enterococcus faecium E1071]
          Length = 248

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY  II Y+G+ + G+Q+Q NG ++Q  +EK +  +  G+ + V G+GRTD+GVHA+ 
Sbjct: 1   MVRYKAIIAYDGTNFNGFQKQPNGRTVQEEVEKTLQKMANGKEITVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     +  AL+   +  + I++  + +V + FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDYPEERPLERMRFALDT--QSPEDIAVRQVEVVSEDFHARYLVTEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A   L+G HDFT+F +        +RTI    +  
Sbjct: 119 KPRSPFRRHYASYFPYPLDLEKIQRALPDLLGTHDFTSFCASGSSIEDKVRTIYEAKMEV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NETKDELLFTFRGNGFLYKMIRILVGTLLKIGNGRLPEDSIPAIIAKKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLYEVKY 247


>gi|229917326|ref|YP_002885972.1| tRNA pseudouridine synthase A [Exiguobacterium sp. AT1b]
 gi|259550390|sp|C4KZL4|TRUA_EXISA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|229468755|gb|ACQ70527.1| tRNA pseudouridine synthase A [Exiguobacterium sp. AT1b]
          Length = 246

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 129/246 (52%), Gaps = 4/246 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y G+Q Q NG++IQ  IE  +  +    V +  +GRTD+ VHAL Q
Sbjct: 1   MRRIKLIVAYDGTHYAGYQVQPNGNTIQAEIESVLARMHRHPVKIIASGRTDARVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E       KALNA L   D I +     +D  FHAR+ A  +   YR   RQ
Sbjct: 61  VIHFDTTLEMPAERFVKALNAML--PDDILVKQAEEMDDTFHARYGA--KRKEYRYHIRQ 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +  A  +   L  E MR A + L+G HDFT+F     +    +RTI   +V   
Sbjct: 117 TEDPFRRHYAATVTYKLSLEAMRQAMERLIGTHDFTSFSVTKAEVEDRVRTIYEAEVLEM 176

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I  R V   FL+ Q+R  VG++  VG GK+   D+ + L+A+DR+  G  APP GLY
Sbjct: 177 GDEIIFRFVGSGFLYNQVRIMVGTVIEVGRGKYQPADITQMLEAKDRRVAGITAPPHGLY 236

Query: 241 FDSVEY 246
             +V Y
Sbjct: 237 LWNVNY 242


>gi|239623391|ref|ZP_04666422.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522357|gb|EEQ62223.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 247

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 129/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q    +I+  + +A+  + GE V V GA RTDSGVHA   
Sbjct: 1   MKRVRLVVAYDGTHYHGWQIQPGKVTIESRLNEALTSLLGEPVQVIGASRTDSGVHARGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +C ALN  L   + I + +   VD  +H R     ++Y YRI+ R+
Sbjct: 61  VAVFDTSHRMPADRICMALNQRL--PEDIRVQSSEEVDPDWHPRKCRCVKTYEYRILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             + +++  +     +LD E M+ AA  LVG HDF +F S+  Q +  +RTI   +V   
Sbjct: 119 IEMPMQRFYSHFCYFNLDLEKMQKAAGLLVGEHDFKSFCSVRTQVTDTVRTIYSIEVKRD 178

Query: 181 GNLIE-IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              +  IRV    FL+  +R   G+L  VG G+    D+   L+A+DR+  GP AP  GL
Sbjct: 179 EEDMIGIRVTGNGFLYNMVRIIAGTLMAVGMGQIAPEDMGAILEARDRRAAGPTAPARGL 238

Query: 240 YFDSVEY 246
               +EY
Sbjct: 239 TLIQMEY 245


>gi|197103844|ref|YP_002129221.1| tRNA pseudouridine synthase [Phenylobacterium zucineum HLK1]
 gi|196477264|gb|ACG76792.1| tRNA pseudouridine synthase [Phenylobacterium zucineum HLK1]
          Length = 246

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 121/246 (49%), Positives = 161/246 (65%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY ++IEY+G  + G+Q Q    +IQG+IE+A+    GE + +  AGRTD+GVHA  Q
Sbjct: 2   MPRYRLLIEYDGRPFNGFQAQDGLPTIQGAIERAVKAFCGEDLRLQAAGRTDTGVHARGQ 61

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL ++W    +  ALNA+L     I++L  S+  + +HARFSA  R YLYRI+ R 
Sbjct: 62  VVHVDLAKDWPAETVRNALNAHLV-PQPIAVLEASVAPEGWHARFSAKERRYLYRILNRM 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP AL++GR W + K LD E M  AAQ LVG HDFTTFR + CQA SP++T+D   V   
Sbjct: 121 APPALDQGRVWHVKKPLDAEAMHEAAQALVGHHDFTTFRDLGCQAKSPMKTLDLASVRRE 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + +   +RSFLH Q+RS  G+L  VG G+WT  DL  AL+A+DR+ CGP+AP EGLY
Sbjct: 181 GDEVLLEFASRSFLHRQVRSMTGTLAEVGVGRWTRADLVAALEARDRRACGPVAPAEGLY 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LTGVAY 246


>gi|257885664|ref|ZP_05665317.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,501]
 gi|293553909|ref|ZP_06674515.1| tRNA pseudouridine synthase A [Enterococcus faecium E1039]
 gi|257821520|gb|EEV48650.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,501]
 gi|291601961|gb|EFF32207.1| tRNA pseudouridine synthase A [Enterococcus faecium E1039]
          Length = 248

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY  II Y+G+ + G+Q+Q NG ++Q  +EK +  +  G+ + V G+GRTD+GVHA+ 
Sbjct: 1   MVRYKAIIAYDGTNFNGFQKQPNGRTVQEEVEKTLQKMANGKEITVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     +  AL+   +  + I++  + IV + FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDYPEERPLERMRFALDT--QSPEDIAVRQVEIVSEDFHARYLVKEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A   L+G HDFT+F +        +RTI    +  
Sbjct: 119 KPRSPFRRHYASYFPYPLDLEKIQRALPDLLGTHDFTSFCASGSSIEDKVRTIYEAKMEV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NETKDELLFTFRGNGFLYKMIRILVGTLLKIGNGRLPEDSIPAIIAKKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLYEVKY 247


>gi|114769437|ref|ZP_01447063.1| tRNA pseudouridine synthase A [alpha proteobacterium HTCC2255]
 gi|114550354|gb|EAU53235.1| tRNA pseudouridine synthase A [alpha proteobacterium HTCC2255]
          Length = 255

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 112/250 (44%), Positives = 153/250 (61%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  Y GWQRQ++  S+Q +IE AI  +  E   + GAGRTD+GVHA  Q
Sbjct: 1   MPRYALKVEYDGKPYHGWQRQRDVPSVQQTIEIAISKIAPEKPEIQGAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +AHFDL + W    L +A+N +L+           + D  FHARFSA  R Y++R+++R+
Sbjct: 61  IAHFDLNKPWDSFRLSEAINYHLRPEPISITKCSIVAD-DFHARFSAKERRYVFRLLSRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIR----TIDHFD 176
           AP  ++ G  W I   LD E M+  A++LVG+HDFTTFRS  CQA SPI+          
Sbjct: 120 APAIVDVGWVWQIQHDLDLELMQEGAKYLVGKHDFTTFRSSICQAQSPIKSLKEISIKEI 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G   E  ++ARSFLH Q+RSF+G+L+ VG G W    + +AL A+DR +CGP+ PP
Sbjct: 180 SLEHGKEFEFTIIARSFLHNQVRSFIGTLERVGSGSWDPERVHEALIAKDRSKCGPVCPP 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 HGLYLAQVSY 249


>gi|260461124|ref|ZP_05809373.1| tRNA pseudouridine synthase A [Mesorhizobium opportunistum WSM2075]
 gi|259033158|gb|EEW34420.1| tRNA pseudouridine synthase A [Mesorhizobium opportunistum WSM2075]
          Length = 249

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 129/248 (52%), Positives = 173/248 (69%), Gaps = 1/248 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IEY+GS + GWQ Q +  S+Q +IE+AI    GE V +  AGRTD+GVHA  Q
Sbjct: 1   MPRFRLDIEYDGSLFAGWQHQADQPSVQQAIEEAIEKFCGEAVRLRAAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLS-IVDKQFHARFSAIRRSYLYRIITR 119
           VAH DLV+ W    +  A+NA+L+ +    ++  + +V   F ARFSA  R YLYRI+ R
Sbjct: 61  VAHVDLVKAWPGDKVRDAVNAHLQAAGARVVILKAGVVPDDFDARFSATGRHYLYRILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +AP ALEKG+ W +PK LD   M  AA+ L+GRHDFTTFRS  CQA+SP+RT++  DV+ 
Sbjct: 121 RAPSALEKGKVWWVPKRLDAGAMHEAAKILLGRHDFTTFRSTQCQANSPVRTLEQLDVSR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G++IE+R  ARSFLH Q+RS VGSLK VGDG W++ D + AL+A+DR  CG +APP+GL
Sbjct: 181 QGDMIEVRASARSFLHNQVRSMVGSLKRVGDGSWSANDFKAALEARDRAACGQVAPPDGL 240

Query: 240 YFDSVEYS 247
           +   V+YS
Sbjct: 241 FLIGVDYS 248


>gi|146293537|ref|YP_001183961.1| tRNA pseudouridine synthase A [Shewanella putrefaciens CN-32]
 gi|166229836|sp|A4Y879|TRUA_SHEPC RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|145565227|gb|ABP76162.1| tRNA pseudouridine synthase A [Shewanella putrefaciens CN-32]
 gi|319426837|gb|ADV54911.1| tRNA pseudouridine synthase A [Shewanella putrefaciens 200]
          Length = 261

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GSGYFGWQRQ    S+QG +E+A+ +V  E + +  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGSGYFGWQRQAEVDSVQGQLERALSIVANEPIGLFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFDTNAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +        ++D + M  AAQ L+G  DFT+FR++ CQ+ +P R +   +V   G
Sbjct: 119 RPGILRHGVSHYHGNIDADKMHQAAQVLLGEQDFTSFRAVQCQSKTPFRNVHCVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|157690932|ref|YP_001485394.1| tRNA pseudouridine synthase A [Bacillus pumilus SAFR-032]
 gi|166991159|sp|A8F9B7|TRUA_BACP2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157679690|gb|ABV60834.1| tRNA-pseudouridine synthase I [Bacillus pumilus SAFR-032]
          Length = 247

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 127/247 (51%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI--VVVHGAGRTDSGVHALR 59
           ++    + Y+G+ + G+Q Q    ++Q  IE A+  +  +   V +  +GRTDSGVHA  
Sbjct: 1   MKVKCTVSYDGTHFKGYQVQPGQRTVQTEIESALAKMHKQDELVPIVASGRTDSGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN+ L   D I +L    VD+ FHARFS + + Y Y++ T 
Sbjct: 61  QVIHFDTPLSIPMERWPFALNSLL--PDDIRVLKAEEVDESFHARFSVVSKEYRYKVSTE 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                  +  A   P  LD + MR AA +L+G HDFT+F + + +    +R I   +  +
Sbjct: 119 THQNVFTRQYACHFPYRLDADKMREAAGYLIGTHDFTSFCAANTEVQDKVREIYTLEWKN 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +E+RV    FL+  +R   G+L  VG GK+   +++  L A++R+  G  AP  GL
Sbjct: 179 VSDGLEMRVRGNGFLYNMVRIIAGTLLEVGSGKFHPDEIKAMLAARNREAAGKTAPSHGL 238

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 239 YLWEVFY 245


>gi|270157075|ref|ZP_06185732.1| tRNA pseudouridine synthase A [Legionella longbeachae D-4968]
 gi|289164512|ref|YP_003454650.1| tRNA-pseudouridine synthase I [Legionella longbeachae NSW150]
 gi|269989100|gb|EEZ95354.1| tRNA pseudouridine synthase A [Legionella longbeachae D-4968]
 gi|288857685|emb|CBJ11528.1| tRNA-pseudouridine synthase I [Legionella longbeachae NSW150]
          Length = 262

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  +++EY+GS Y GWQ Q    ++Q ++E A+  V    + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALVLEYDGSKYHGWQAQTGLHTVQQAVENALSKVADLPISVVCAGRTDTGVHATNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD  ++         +N++L     I +     + ++FHAR+SA  R Y Y I     
Sbjct: 61  IHFDSEKQRSIRAWIHGVNSFL--PKDICVKWGKELSEEFHARYSATARRYRYVIYNSAI 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             AL +       + LD   M  AAQ L+G +DFT+FRS+ CQ+++P+R +    VN  G
Sbjct: 119 RPALLRSNVTWQYRQLDHRLMHQAAQVLLGENDFTSFRSVECQSNTPMRNVYKLQVNRMG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           +L+ I + A +FLH  +R+  G L  VG GK     +E+ LQA+DR+     AP  GLY 
Sbjct: 179 DLVIIDITANAFLHHMVRNIAGVLIAVGSGKRPVFWVEEVLQAKDRRLGAETAPAYGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VQVNY 243


>gi|224369316|ref|YP_002603480.1| TruA1 [Desulfobacterium autotrophicum HRM2]
 gi|223692033|gb|ACN15316.1| TruA1 [Desulfobacterium autotrophicum HRM2]
          Length = 246

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 77/246 (31%), Positives = 121/246 (49%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
             + + +EY+G+ Y GWQ Q N  ++Q  IEKA+  +  + + + G+GRTD+GVHAL QV
Sbjct: 3   TNFKLTLEYDGTPYSGWQVQNNCPTVQEEIEKALSRMLNQPIRISGSGRTDAGVHALGQV 62

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A+F          L ++LN+ LK    +       VD+ FH+R+SA  + Y Y  + R+ 
Sbjct: 63  ANFQAATTIGAAQLKRSLNSLLKGPIVV--HECRKVDQSFHSRYSARAKEYHYHFLNRED 120

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHF-DVNSF 180
           P  + +   W I   L    M      + G HDF  F       S+ +RT+       + 
Sbjct: 121 PCGVGRNYVWHIRTPLSIPAMEECCPIITGTHDFKAFEGSGSPRSTTVRTLFSTGFERTA 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +    ++    FL   +R+ VG+L L G GK T  + +  L+ +DR   G  AP +GL+
Sbjct: 181 EDRFTFKIKGDGFLRFMVRNIVGTLVLAGAGKITPENFKTILEGKDRGRAGATAPAKGLF 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LVEVFY 246


>gi|253577209|ref|ZP_04854529.1| tRNA pseudouridine synthase A [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251843453|gb|EES71481.1| tRNA pseudouridine synthase A [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 261

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 92/256 (35%), Positives = 131/256 (51%), Gaps = 12/256 (4%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    M + Y+G+ YFG+Q Q  G+++Q  IE AI  +TGE V +HG+GRTD+GVHA +Q
Sbjct: 1   MRNLLMTVSYDGTNYFGFQTQPGGNTVQDHIEGAIRQLTGETVKIHGSGRTDAGVHARQQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
             HF           C ALNA L     I +L    V   FH+R SA R++Y Y I T +
Sbjct: 61  PFHFHTDSRIPVERWCLALNARL--PSDIRVLTAREVPLTFHSRHSAKRKTYRYTINTNR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P   ++   +  P  L+ + M+ +  +LVG HDFT+F S      S +RTI    +   
Sbjct: 119 FPDVFQRNYQFHHPGQLNVDAMQASLPYLVGTHDFTSFASRQSTKLSHVRTIYDARIVVD 178

Query: 181 ----------GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKEC 230
                       ++   V    FL   +R  VG+L  +G+GK T   ++  L+A+DR   
Sbjct: 179 SLAKIPGTTGQGIVHFYVTGSGFLQHMVRIIVGTLIEIGEGKRTPESIQAILEAKDRTAA 238

Query: 231 GPLAPPEGLYFDSVEY 246
           GP A  +GL   SVEY
Sbjct: 239 GPTAESKGLMLWSVEY 254


>gi|170742366|ref|YP_001771021.1| tRNA pseudouridine synthase A [Methylobacterium sp. 4-46]
 gi|238688005|sp|B0UP40|TRUA_METS4 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|168196640|gb|ACA18587.1| tRNA pseudouridine synthase A [Methylobacterium sp. 4-46]
          Length = 250

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 156/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+GSG+ GWQRQ    ++Q ++E+AI    G  V VH AGRTD+GVHA  Q
Sbjct: 1   MPRYKLVVEYDGSGFAGWQRQAADRTVQQALEEAIARFAGAPVRVHCAGRTDAGVHATHQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL R+W    +  A NA+L+  + +++++   V   F AR SA+RR Y YRI+ R+
Sbjct: 61  VVHLDLDRDWRTDTVRDASNAHLR-PEPVAVVSAERVRPDFDARHSALRRHYRYRILNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +P AL +   W +P SLD   M  AAQ L+GRHDF+ FR+  CQA+SP+RT+D  DV   
Sbjct: 120 SPPALGRAYLWHVPWSLDAHAMHAAAQTLLGRHDFSAFRAAECQANSPVRTLDQLDVARI 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I +   ARSFLH Q+R  VG+L L G G+  +  +   L ++DR  CGPLAP  GL 
Sbjct: 180 GDEILVATSARSFLHHQVRGMVGTLMLAGCGRLDAAGVRAVLDSRDRTRCGPLAPAAGLT 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTGVDY 245


>gi|266620223|ref|ZP_06113158.1| tRNA pseudouridine synthase A [Clostridium hathewayi DSM 13479]
 gi|288868186|gb|EFD00485.1| tRNA pseudouridine synthase A [Clostridium hathewayi DSM 13479]
          Length = 354

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 91/241 (37%), Positives = 126/241 (52%), Gaps = 2/241 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ Q NG +I+  + +A+  +  E V V GA RTDSGVHA   
Sbjct: 1   MKRIKLIVAYDGTNYCGWQIQNNGRTIEEVLNEALTALLHEKVAVIGASRTDSGVHAEGN 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +C ALN  L   + I +L    V   +H R     ++Y YRI+ R+
Sbjct: 61  VAVFDTENRMPADKICFALNQRL--PEDIRVLKSEEVPLTWHPRKCNCVKTYEYRILNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +   +  A+     LD E M+ AA++LVG HDFT+F +   QA   +RTI   DV   
Sbjct: 119 IEVPTLRLYAYFCYYPLDVEKMKQAAEYLVGEHDFTSFCAPRTQAEDMVRTIYSLDVGKT 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++I IRV    FL+  +R   G+L  VG G W    +E+ L A+ R   GP A   GL 
Sbjct: 179 GDMITIRVSGSGFLYNMVRIIAGTLMKVGLGVWPPEHVEEILDARSRAAAGPTAVARGLT 238

Query: 241 F 241
            
Sbjct: 239 L 239


>gi|332307082|ref|YP_004434933.1| tRNA pseudouridine synthase A [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174411|gb|AEE23665.1| tRNA pseudouridine synthase A [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 263

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G+G+ GWQRQ    S+Q  +E+A+  +  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGVEYDGAGFHGWQRQNEVISVQQHLEEALTRIANEPIRVVCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +N YL   DT+S+  +  V   FHARFSA  R Y Y I     
Sbjct: 61  VHFETNSQRPDRAWTLGINTYL--PDTVSVRWVKAVPDDFHARFSATARRYRYIIYNSTL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +       I   LD E M  AAQ LVG+HDF++FR+++CQA +  RT+ H  V   G
Sbjct: 119 RSGILANGVTHIYGDLDHELMNQAAQKLVGKHDFSSFRAVNCQAKTATRTMSHIRVKRMG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I V A +FLH  +R+  G+L  +G  +     +++ L+ +DR + G  A P GLY 
Sbjct: 179 DYIVIDVQANAFLHHMVRNITGTLVAIGHKEKPVEWVDELLEVKDRTKAGITALPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VHVTY 243


>gi|118581782|ref|YP_903032.1| tRNA pseudouridine synthase A [Pelobacter propionicus DSM 2379]
 gi|166228745|sp|A1AUF4|TRUA_PELPD RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|118504492|gb|ABL00975.1| tRNA pseudouridine synthase A [Pelobacter propionicus DSM 2379]
          Length = 244

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ Y GWQ Q NG ++Q  +E+A+  + GE V +  +GRTD+GVHA   
Sbjct: 1   MRTIKLTIEYDGTNYAGWQVQPNGLAVQQVLEEALLRLLGERVRLRSSGRTDAGVHARAM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   R           N +L   D I+IL+ +    +F     A  + Y Y I    
Sbjct: 61  VASFTTSRSLPLQAFVGGANRFL--PDDIAILSAAEAAPEFRPIQDARSKWYRYTIYNAP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +  +W + + LD + M++AA H  GRHDF  FR+ +C A + +R ID   + S 
Sbjct: 119 VRSPLRRLFSWHVREPLDTDAMQLAAHHFPGRHDFAAFRASNCAAKTTLRRIDSVTIASE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G LI I V+   FL   +R   G+L  VG G++    +   L+  DRK+ G  AP  GL 
Sbjct: 179 GELIVIDVIGEGFLKNMVRVMAGTLVDVGRGRFEPERVAWLLENPDRKKAGVTAPACGLC 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LMDVSY 244


>gi|323493306|ref|ZP_08098429.1| tRNA pseudouridine synthase A [Vibrio brasiliensis LMG 20546]
 gi|323312392|gb|EGA65533.1| tRNA pseudouridine synthase A [Vibrio brasiliensis LMG 20546]
          Length = 264

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEYNG+ YFGWQRQ+   S+Q  +E A+ +V    + V  AGRTD+GVH   QV
Sbjct: 1   MRIALCIEYNGTQYFGWQRQREVKSVQEKLEHALSIVANHPIEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD       V      NA L   D I++     V ++FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTASRKMVAWTMGANANL--PDDIAVRWAKEVPEEFHARFSATARRYRYIIFNSAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M  AAQ+L+G +DFT+FR+ HCQ+ SP R + H +V   G
Sbjct: 119 RPGILSSGVSHYHGELDEKKMHQAAQYLLGENDFTSFRATHCQSRSPWRNMMHINVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     +E  L A+DRK  G  A  EGLY 
Sbjct: 179 QYVVIDIKANAFVHHMVRNITGSLICVGRGEQEPQWIEWLLAAKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|296333145|ref|ZP_06875599.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305672848|ref|YP_003864519.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296149761|gb|EFG90656.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305411091|gb|ADM36209.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 247

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 133/247 (53%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI--VVVHGAGRTDSGVHALR 59
           +R    I Y+G  + G+Q Q    ++Q  +EKA+ ++      + V  +GRTDSGVHA  
Sbjct: 1   MRLKCTISYDGHLFNGYQVQPGKRTVQDELEKALAVLHKSKDRIPVVSSGRTDSGVHAAG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALNA L   D I++    I D  FHARFSA+++ Y Y + T 
Sbjct: 61  QVIHFDTPLSIPAEKWPYALNALL--PDDIAVKQAEIADDGFHARFSAVKKEYRYFVYTE 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P   ++  A+     L+ +NMR AA+HL+G HDFT+F ++  +    +RTI   D   
Sbjct: 119 KHPDVFKRHYAYHFSYHLNVQNMREAAKHLLGTHDFTSFCAVKTEVQDKVRTIYELDWAE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +++R+    FL+  +R   G+L   G GK +  D++  L+A+DR+  G  AP  GL
Sbjct: 179 TDDGLQMRITGSGFLYNMVRIIAGTLLDAGIGKISPDDVKSMLEAKDREAAGRTAPGHGL 238

Query: 240 YFDSVEY 246
           Y  +V Y
Sbjct: 239 YLWNVFY 245


>gi|310816231|ref|YP_003964195.1| tRNA pseudouridine synthase A [Ketogulonicigenium vulgare Y25]
 gi|308754966|gb|ADO42895.1| tRNA pseudouridine synthase A [Ketogulonicigenium vulgare Y25]
          Length = 255

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 112/250 (44%), Positives = 156/250 (62%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G  + GWQRQ    S+QG+IE A+  +      +  AGRTD+GVH   Q
Sbjct: 1   MPRYALLVEYDGRPFSGWQRQSELPSVQGAIEAALAKLEPRDHTIAAAGRTDTGVHGTGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ ++W P  L +ALN +L+    ++IL  + V   +HARFSA  R Y++R+++R+
Sbjct: 61  VAHCDMDKDWDPFRLSEALNHHLR-PAPVAILRAARVADDWHARFSAYERRYIFRLLSRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD---- 176
           APL +E G+ W +  +LD + MR  A HL+G HDFTTFRS  CQA SP++TID       
Sbjct: 120 APLTVENGQFWRVGHALDADLMRAGAAHLIGLHDFTTFRSSICQAKSPVKTIDEISITEI 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G      + ARSFLH Q+RS VG+L+ VG G W    + + L A+DR  CGP+ PP
Sbjct: 180 PRHDGTEFRFFLRARSFLHNQVRSIVGTLERVGAGAWPPEKVAEVLAARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   VEY
Sbjct: 240 QGLYLAGVEY 249


>gi|218548227|ref|YP_002382018.1| tRNA pseudouridine synthase A [Escherichia fergusonii ATCC 35469]
 gi|226708655|sp|B7LLF2|TRUA_ESCF3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|218355768|emb|CAQ88381.1| pseudouridylate synthase I [Escherichia fergusonii ATCC 35469]
 gi|324112855|gb|EGC06831.1| tRNA pseudouridine synthase A [Escherichia fergusonii B253]
 gi|325496642|gb|EGC94501.1| tRNA pseudouridine synthase A [Escherichia fergusonii ECD227]
          Length = 270

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGANNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|126208378|ref|YP_001053603.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae L20]
 gi|166228675|sp|A3N0R2|TRUA_ACTP2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|126097170|gb|ABN73998.1| tRNA pseudouridine synthase A [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 262

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ    S+Q  +E+A+ +V    + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQDEVESVQQKLEEALSIVANAPIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA L   D I++     V + FHARFSA  R Y Y I   + 
Sbjct: 61  VHFETQAIRPLQSWCFGTNANL--PDDIAVKWAVEVSEDFHARFSATARRYRYIIFNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+          +LD + M +A Q L+G +DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILPKGVSHYHYALDHQKMHVAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLNVSRLG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ V SL  VG G+     ++  L  +DR    P A  EGLY 
Sbjct: 179 NYIVVDIQANAFVHHMVRNIVESLIEVGQGRQPVEWIQWLLAQRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVHY 243


>gi|110834324|ref|YP_693183.1| tRNA pseudouridine synthase A [Alcanivorax borkumensis SK2]
 gi|123149458|sp|Q0VPI7|TRUA_ALCBS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|110647435|emb|CAL16911.1| Pseudouridylate synthase [Alcanivorax borkumensis SK2]
          Length = 267

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 91/247 (36%), Positives = 126/247 (51%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R  + IEY+G+ + GWQ Q+    ++Q  +E A+  V    V V  AGRTD+GVH   
Sbjct: 1   MTRIALGIEYDGTDFRGWQMQQSGVRTVQECLEAALSKVANHSVTVVCAGRTDAGVHGTG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD              N  L     ++I     V   FHARFSA+ R Y Y I   
Sbjct: 61  QVVHFDSDAPREMKSWIMGGNTNL--PRDVTIRWAVPVSDDFHARFSAVSRRYRYVIYNH 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
             P AL + +     + LD   MR AA +LVG HDFT +RS+HCQA SP++T+   ++  
Sbjct: 119 ARPPALYRSQVTWNHRPLDVAAMREAASYLVGHHDFTAYRSVHCQAKSPLKTLHSLELYE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G ++ +   A +FL   +R+  G L  VG GK      +  L+ +DR+     APP GL
Sbjct: 179 QGKVLVLEAHANAFLMHMVRNIAGVLMKVGAGKKPPVWAKDVLECRDRRLGAATAPPFGL 238

Query: 240 YFDSVEY 246
           Y   +EY
Sbjct: 239 YLVEIEY 245


>gi|222056725|ref|YP_002539087.1| tRNA pseudouridine synthase A [Geobacter sp. FRC-32]
 gi|254789637|sp|B9M6W5|TRUA_GEOSF RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|221566014|gb|ACM21986.1| tRNA pseudouridine synthase A [Geobacter sp. FRC-32]
          Length = 244

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQ Q NG +IQ  IE+++  + G+ V +  +GRTD+GVHAL  
Sbjct: 1   MRNIKLIIEYDGTAYCGWQLQPNGITIQQVIEESLEKMLGQSVRLQSSGRTDAGVHALGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   ++         LN  L     I+I + S V   F+ R  AI + Y Y I   +
Sbjct: 61  VAVFKTQKDLPVRAFSDGLNCLL--PPDIAIRDASEVPLSFNPRADAISKHYRYTIYNSK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +  +W +   L+ E M++ A H VG HDF  FR+ +C A + IR + H  V   
Sbjct: 119 RRSPLTRLNSWHLRGILNMELMQLGASHFVGEHDFAAFRASNCVAKTTIRRMFHVSVAKV 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ + I V    FL   +R   G+L  VG GK   + +   L   DR   G  APP+GL 
Sbjct: 179 GDSVIIDVHGSGFLKNMVRVIAGTLVAVGQGKLDPSAIPGLLAGGDRSASGITAPPQGLC 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LMEVFY 244


>gi|319407940|emb|CBI81594.1| tRNA pseudouridine synthase A [Bartonella schoenbuchensis R1]
          Length = 247

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 129/247 (52%), Positives = 169/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R+ + +EY+GS Y GWQRQ    +IQG+IE+AIF  +GE + +  AGRTD+GVHA+ Q
Sbjct: 1   MVRFKLTLEYDGSNYAGWQRQAGLRTIQGAIEQAIFNFSGEKLTIVTAGRTDAGVHAIEQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYL-KISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D  + W    +  ALNA+L +  + I++LN+  V   FHARF A +R YL++I+ R
Sbjct: 61  VAHVDFTKNWHANTVHNALNAHLQQQGENIAVLNVQNVPDSFHARFCATKRYYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W +PK L+ + M  AAQ LVG+HDFTTFRS HCQA SPIRT++  DV  
Sbjct: 121 RSPPALNVKRVWWLPKHLNADAMHEAAQKLVGQHDFTTFRSAHCQAKSPIRTLERLDVYR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A+DR  CG +APP GL
Sbjct: 181 KGEEIFLYAQARSFLHHQIRSFAGSLVKVGTGQWTAQDLEAALNAKDRARCGMVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   ++Y
Sbjct: 241 YLMKIDY 247


>gi|149377425|ref|ZP_01895168.1| tRNA pseudouridine synthase A [Marinobacter algicola DG893]
 gi|149358266|gb|EDM46745.1| tRNA pseudouridine synthase A [Marinobacter algicola DG893]
          Length = 298

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 125/245 (51%), Gaps = 3/245 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           R  +  EY+G G+ GWQ QK    S+QG + +A+  V    V +  AGRTD+GVHA  Q+
Sbjct: 18  RVAIAFEYDGRGFHGWQYQKSGVRSVQGELTQAVSKVADHPVELVCAGRTDAGVHASYQI 77

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHF+      P      +N  L     +      +    FHARFSA  R Y Y I     
Sbjct: 78  AHFETPSVRNPRSWVMGINTSLPQDIAVHWAGNGVD--DFHARFSATYRRYRYVIYNHAV 135

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +  G+     + LD   M  AAQ L G HDF++FR+  CQ+ SPIR ++  +V   G
Sbjct: 136 RPGILHGQVSWTFRPLDEALMHQAAQFLCGEHDFSSFRAAGCQSRSPIRFLEAIEVTRKG 195

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I V A +FLH  +R+  G+L  VG GK     + + L+A+DR   G  APP GLY 
Sbjct: 196 DFVVIDVQANAFLHHMVRNIAGALMSVGTGKQRPEWIREILEARDRTVAGVTAPPHGLYL 255

Query: 242 DSVEY 246
             V Y
Sbjct: 256 VDVGY 260


>gi|254854197|ref|ZP_05243545.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL R2-503]
 gi|300763651|ref|ZP_07073649.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL N1-017]
 gi|258607589|gb|EEW20197.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL R2-503]
 gi|300515928|gb|EFK42977.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL N1-017]
          Length = 248

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL A       IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKALQAM--TPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ +AL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISEALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|261820765|ref|YP_003258871.1| tRNA pseudouridine synthase A [Pectobacterium wasabiae WPP163]
 gi|261604778|gb|ACX87264.1| tRNA pseudouridine synthase A [Pectobacterium wasabiae WPP163]
          Length = 283

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 93/244 (38%), Positives = 133/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ + +S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 24  KIALGIEYDGSQYYGWQRQNDVASVQACLEKALSKVADEPIEVFCAGRTDAGVHGTGQVV 83

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF              +NA L     I++  +  VD+ FHARFSA  R Y Y I   +  
Sbjct: 84  HFTTQAIRKDAAWTMGVNANL--PPDIAVRWVKTVDEDFHARFSATARRYRYVIYNHRYR 141

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+           LD E M  A Q L+G +DFT+FR++ CQ+ +P R ++H  V   G+
Sbjct: 142 PAVLSHGMTHFYHPLDVERMERAGQCLLGENDFTSFRAVQCQSRTPWRNVNHLKVTRHGD 201

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            I + + A +F+H  +R+ VGSL  VG G    + + + L A+DR   G  A  EGLY  
Sbjct: 202 YIVVDIKANAFVHHMVRNIVGSLMDVGCGNRPESWIAELLVAKDRTLAGATARAEGLYLV 261

Query: 243 SVEY 246
           +V+Y
Sbjct: 262 AVDY 265


>gi|295093665|emb|CBK82756.1| pseudouridylate synthase I [Coprococcus sp. ART55/1]
          Length = 247

 Score =  192 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +I+ Y+G+ Y GWQ Q NG +++  + K +  +  E + V GA RTDSGVHAL  
Sbjct: 3   MKRVKLIVAYDGTNYCGWQVQINGITVEEVLNKTLSELCHEDIKVIGASRTDSGVHALGN 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN  L   + I I     V   FH R+    ++Y Y+I+ R+
Sbjct: 63  VAVFDTESGIPGEKFSFALNQRL--PEDIRIQESCQVADDFHPRYCDTIKTYEYKILNRR 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +  E+  +  +   LD + M+ AA  LVG HDF +F S   Q  + +RTI    ++  
Sbjct: 121 FDMPTERLYSTFVYYPLDIDKMKRAAAVLVGEHDFKSFCSSRSQVENTVRTITDITIDKA 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++I IR+    FL+  +R  VG+L  +G G W    +E  L+A+DR + GP A  +GL 
Sbjct: 181 GDMIHIRISGNGFLYNMVRIIVGTLMKIGLGIWPEDCMESILEAKDRTKAGPKAEAKGLT 240

Query: 241 FDSVEY 246
              ++Y
Sbjct: 241 LVEIKY 246


>gi|329577713|gb|EGG59139.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX1467]
          Length = 249

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 84/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGAHFHGFQKQPNERTVQEEIEKTLARMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        IRTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKIRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|237748866|ref|ZP_04579346.1| tRNA pseudouridine synthase A [Oxalobacter formigenes OXCC13]
 gi|229380228|gb|EEO30319.1| tRNA pseudouridine synthase A [Oxalobacter formigenes OXCC13]
          Length = 261

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 94/247 (38%), Positives = 132/247 (53%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + IEY+G+ + GWQ Q +G ++Q  +++AIF  T   +    AGRTD+GVHA  Q
Sbjct: 1   MKRIALGIEYDGTNWRGWQTQPDGMTVQDQLQEAIFRFTRTRISTMCAGRTDAGVHASEQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQ-FHARFSAIRRSYLYRIITR 119
           V H D   + +PV   + +NAYL  S  +         K  FHAR SA+ R Y Y I   
Sbjct: 61  VVHLDTELDRLPVSWVRGVNAYLPSSIAVRWACEVPGGKDGFHARSSAMARRYRYLIYNS 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                L K RA  + K LD   M+  A  L+G HDF+ FR+  CQ+ +P++T+   D+  
Sbjct: 121 PVRSPLWKNRAGWVFKPLDIGLMQKGAGLLLGEHDFSAFRAAECQSITPVKTVKRIDIEK 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            GNLI     A +FLH  +R+ VGSL  +G G      +++ L A+DR    P   P+GL
Sbjct: 181 QGNLIVFTFEANAFLHHMVRNIVGSLVYIGKGNHPPEWMKQLLDAKDRSLAAPTFMPDGL 240

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 241 YLSRVHY 247


>gi|262043366|ref|ZP_06016493.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039278|gb|EEW40422.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 270

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 92/244 (37%), Positives = 133/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETRAQRKDAAWTLGVNANL--PGDIAVRWVKRVPADFHARFSATARRYRYVIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V  +G 
Sbjct: 129 PAVLSHGVTHFHQPLDAERMQRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRYGA 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAGNQPESWMAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           SV+Y
Sbjct: 249 SVDY 252


>gi|227550751|ref|ZP_03980800.1| tRNA-pseudouridine synthase I [Enterococcus faecium TX1330]
 gi|257887991|ref|ZP_05667644.1| tRNA pseudouridine synthase [Enterococcus faecium 1,141,733]
 gi|257893205|ref|ZP_05672858.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,408]
 gi|257896390|ref|ZP_05676043.1| tRNA pseudouridine synthase [Enterococcus faecium Com12]
 gi|293379476|ref|ZP_06625620.1| tRNA pseudouridine synthase A [Enterococcus faecium PC4.1]
 gi|293570714|ref|ZP_06681764.1| tRNA pseudouridine synthase A [Enterococcus faecium E980]
 gi|227180069|gb|EEI61041.1| tRNA-pseudouridine synthase I [Enterococcus faecium TX1330]
 gi|257824045|gb|EEV50977.1| tRNA pseudouridine synthase [Enterococcus faecium 1,141,733]
 gi|257829584|gb|EEV56191.1| tRNA pseudouridine synthase [Enterococcus faecium 1,231,408]
 gi|257832955|gb|EEV59376.1| tRNA pseudouridine synthase [Enterococcus faecium Com12]
 gi|291609186|gb|EFF38458.1| tRNA pseudouridine synthase A [Enterococcus faecium E980]
 gi|292641999|gb|EFF60165.1| tRNA pseudouridine synthase A [Enterococcus faecium PC4.1]
          Length = 248

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY  II Y+G+ + G+Q+Q NG ++Q  +EK +  +  G+ + V G+GRTD+GVHA+ 
Sbjct: 1   MVRYKAIIAYDGTNFNGFQKQPNGRTVQEEVEKTLQKMANGKEITVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     +  AL+   +  + I++  + IV ++FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDYPEERPLERMRFALDT--QSPEDIAVRQVEIVSEEFHARYLVKEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E ++ A   L+G HDFT+F +        +RTI    +  
Sbjct: 119 KPRSPFRRHYASYFPYPLDLEKIQRALPDLLGTHDFTSFCASGSSIEDKVRTIYEAKMEV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NETKDELLFTFRGNGFLYKMIRILVGTLLKIGNGRLPEDSIPDIIAKKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLYEVKY 247


>gi|295398321|ref|ZP_06808363.1| tRNA pseudouridine synthase A [Aerococcus viridans ATCC 11563]
 gi|294973460|gb|EFG49245.1| tRNA pseudouridine synthase A [Aerococcus viridans ATCC 11563]
          Length = 285

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 133/249 (53%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R+ + ++Y+G+ + G+Q Q NG ++Q ++EKA+ L++ G  + V G+GRTDSGVHAL 
Sbjct: 1   MPRFKVTLQYDGTPFVGFQVQPNGHTVQEALEKALKLMSKGHDIQVVGSGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     + +A+N+ L   D I I  +  V+  FHARF    + Y+Y++ T 
Sbjct: 61  QVIHFDYPAEIGEEAVLRAMNSIL--DDAIRITKVERVEDDFHARFHTNGKKYIYKVDTS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV-- 177
           + P    +   +  P   D   M+ A + ++G HDF +F S     ++ +R I   +V  
Sbjct: 119 KFPSPFTRQYMYHHPYRTDVTRMQTALKDIIGVHDFKSFCSTKTDKTNFVREIYRAEVTA 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+  +R  VG+   +GDG     ++++ + A+DR E GP A   
Sbjct: 179 DPDAETLTFVFEGSGFLYNMVRILVGTTLQIGDGLRPVDEMKRLITAEDRNEAGPTAAAH 238

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 239 GLYLAEVYY 247


>gi|323977481|gb|EGB72567.1| tRNA pseudouridine synthase A [Escherichia coli TW10509]
          Length = 270

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGANNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|297545296|ref|YP_003677598.1| tRNA pseudouridine synthase A [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296843071|gb|ADH61587.1| tRNA pseudouridine synthase A [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 240

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 137/241 (56%), Gaps = 2/241 (0%)

Query: 6   MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFD 65
           ++++Y+G+ Y GWQ QKN  ++Q  ++KAI  VTGE V + GA RTD+GVHAL QVA+F 
Sbjct: 2   IVVQYDGTNYHGWQYQKNAITVQEVLQKAIKKVTGEEVNLIGASRTDTGVHALYQVANFK 61

Query: 66  LVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLAL 125
              +     L  ALN+ L   D I I     V+  FHAR+SA R+ Y Y I+ R+  +  
Sbjct: 62  TNTKIPAEKLPYALNSVL--PDDIVITQAKDVEDSFHARYSAKRKRYKYLILNRKFRMPT 119

Query: 126 EKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIE 185
            +   W I   L+ E M+ AA +L+G HDF+ F++     +S IRT+    +    + I 
Sbjct: 120 MRNYCWHISYPLNVEKMKKAATYLIGTHDFSAFKASGSSKTSTIRTVYDLIIEKNEDFIN 179

Query: 186 IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVE 245
           I + A  FL+  +R  VG+L  VG GK    ++   L ++DR + G  APP+GLY   + 
Sbjct: 180 IEIEADGFLYNMVRIIVGTLSYVGLGKIGENEVYNILASKDRTKAGITAPPQGLYLIKII 239

Query: 246 Y 246
           Y
Sbjct: 240 Y 240


>gi|91777254|ref|YP_552462.1| tRNA pseudouridine synthase A [Burkholderia xenovorans LB400]
 gi|123167830|sp|Q13S27|TRUA_BURXL RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|91689914|gb|ABE33112.1| tRNA pseudouridine synthase [Burkholderia xenovorans LB400]
          Length = 270

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+GS + GWQ Q +G+++Q  +E+A+       V    AGRTD+GVH L Q
Sbjct: 1   MKRIALGVQYDGSVFCGWQSQPHGNTVQDELERALREFAQTPVQTIVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +   V   +  N++L    TIS+     +  +FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELDRADVSWVRGTNSFL--PKTISVQWAKPMPDEFHARFSAFERTYYYVLYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +  +LD + M+ AA HL+G HDF+ FRS  CQ+ +P++ +   DV   
Sbjct: 119 VRSPMLAARAGWVHAALDVDAMQAAAAHLIGEHDFSAFRSSQCQSKTPVKHLYQIDVRQQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I  R  A +FLH  +R+ +G L  +G G+     + + L ++DR+   P   P+GLY
Sbjct: 179 GDFIHFRFRANAFLHHMVRNLMGCLVYIGRGRRPVEWMAEVLASRDREFAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|206580474|ref|YP_002237289.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae 342]
 gi|288934225|ref|YP_003438284.1| tRNA pseudouridine synthase A [Klebsiella variicola At-22]
 gi|290508428|ref|ZP_06547799.1| tRNA pseudouridine synthase A [Klebsiella sp. 1_1_55]
 gi|238057733|sp|B5XNR9|TRUA_KLEP3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|206569532|gb|ACI11308.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae 342]
 gi|288888954|gb|ADC57272.1| tRNA pseudouridine synthase A [Klebsiella variicola At-22]
 gi|289777822|gb|EFD85819.1| tRNA pseudouridine synthase A [Klebsiella sp. 1_1_55]
          Length = 270

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 133/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 10  FKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   + 
Sbjct: 70  VHFETRAQRKDAAWTLGVNANL--PGDIAVRWVKHVPADFHARFSATARRYRYVIYNHRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V  +G
Sbjct: 128 RPAVLSHGVTHFHQPLDAERMQRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRYG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGAGNQPESWMAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            SV+Y
Sbjct: 248 VSVDY 252


>gi|298293826|ref|YP_003695765.1| tRNA pseudouridine synthase A [Starkeya novella DSM 506]
 gi|296930337|gb|ADH91146.1| tRNA pseudouridine synthase A [Starkeya novella DSM 506]
          Length = 250

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 126/251 (50%), Positives = 166/251 (66%), Gaps = 6/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQ Q  G+S+QG++ +A+  +TGE V VHGAGRTD+GVHA  Q
Sbjct: 1   MPRYKLTIEYDGTPFVGWQIQAEGTSVQGALAQAVTRLTGEQVAVHGAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH +L R+W P  +  ALNA+L+    I++L+       FHARFSA  R Y+YRII R+
Sbjct: 61  VAHVELSRDWRPDTVRDALNAHLR-PHPIAVLSAERAADDFHARFSATGRRYVYRIIARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS- 179
             LALE+ RAW + + LD   M   A  LVGRHDFTTFR++ CQA+SP++T+D  +V   
Sbjct: 120 PDLALERNRAWRVLRPLDVAGMAEGAARLVGRHDFTTFRAVGCQAASPLKTLDRLEVEEV 179

Query: 180 ----FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                G  I +   ARSFLH Q+RS VG+L  VG+G WT  D+  AL+A+DR  CGP+AP
Sbjct: 180 ALEGPGMEIRVHAAARSFLHHQVRSMVGTLVKVGEGAWTPDDVTAALEAKDRTRCGPMAP 239

Query: 236 PEGLYFDSVEY 246
             GLY   V Y
Sbjct: 240 SAGLYLAEVTY 250


>gi|154250719|ref|YP_001411543.1| tRNA pseudouridine synthase A [Parvibaculum lavamentivorans DS-1]
 gi|171769555|sp|A7HPQ3|TRUA_PARL1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|154154669|gb|ABS61886.1| tRNA pseudouridine synthase A [Parvibaculum lavamentivorans DS-1]
          Length = 246

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 129/246 (52%), Positives = 170/246 (69%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+GS + GWQ Q NG S+Q  +E+ I    G+ + + GAGRTD+GVHAL Q
Sbjct: 1   MPRYKLTIEYDGSPFVGWQAQTNGRSVQQVLEEGIKGFCGQELKIFGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D      P  L  A+NA+      ++I+    V   F ARFSA++R Y+YRI+ R+
Sbjct: 61  VAHVDFETPVAPDTLRDAVNAH-MRPHPVAIVEAEEVPDSFEARFSAVKRHYMYRIVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APL L++G+AWL+ K+LD + M  AAQ LVG HDFTTFRS+ CQA SP++T+D   V+ +
Sbjct: 120 APLTLDRGQAWLVHKTLDADAMHDAAQALVGNHDFTTFRSVQCQAKSPVKTVDEISVSRY 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + IEI   ARSFLH Q+RSFVG+LK+VGDG WT   +EKAL A+DR  CGP+APP+GLY
Sbjct: 180 ADEIEIVCRARSFLHNQVRSFVGTLKMVGDGSWTRRKVEKALAAKDRAACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LLQVDY 245


>gi|220928242|ref|YP_002505151.1| tRNA pseudouridine synthase A [Clostridium cellulolyticum H10]
 gi|254789632|sp|B8I814|TRUA_CLOCE RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|219998570|gb|ACL75171.1| tRNA pseudouridine synthase A [Clostridium cellulolyticum H10]
          Length = 245

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 123/247 (49%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + IEY+G+ Y GWQ QKN  ++Q  I+KA+  + GE V V G  RTD GVHA  Q
Sbjct: 1   MRKIRLTIEYDGTNYHGWQIQKNAKTVQEVIQKALSKLLGEDVGVTGCSRTDVGVHAYGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHF    +        A+N  L   D I I N   V ++FHAR+SA  + Y Y I    
Sbjct: 61  VAHFLTDSKIPGDKFSYAINNLL--PDDIVIKNSEEVPEEFHARYSAKGKKYRYLIYNSP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+ + R+  +   L+   M+ AA +  G HDF  F++   Q  S +R I   +V   
Sbjct: 119 HASAIMRNRSCHVRPELNVAEMQKAAGYFKGEHDFLAFQATGGQVRSTVREIYGMEVYVK 178

Query: 181 GNLIEIRVV-ARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            + +    V    FL+  +R   G+L  VG GK   +++   +   DR + G  AP +GL
Sbjct: 179 EDNMISIEVSGNGFLYNMVRIIAGTLIYVGMGKLHESEIPGIIAGLDRTKAGKTAPAQGL 238

Query: 240 YFDSVEY 246
           Y   + Y
Sbjct: 239 YLVQIYY 245


>gi|90410767|ref|ZP_01218782.1| tRNA pseudouridine synthase A [Photobacterium profundum 3TCK]
 gi|90328398|gb|EAS44696.1| tRNA pseudouridine synthase A [Photobacterium profundum 3TCK]
          Length = 261

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGAKYCGWQRQVDVDSVQERLEKALSHIANKPIAVFCAGRTDTGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+  +   V     +NA+L     IS+   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDVDVDRQMVAWTIGVNAHL--PRDISVRWATPVSDDFHARFSATARRYRYIIYNNAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  AAQ+LVG HDFT+ R+  CQ+ SP R + H +V+  G
Sbjct: 119 RPAIFGIGVSHYHGHLDEKKMHEAAQYLVGEHDFTSVRASQCQSRSPWRAMKHVNVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+ T   ++  L+ +DR+  G  A   GLY 
Sbjct: 179 DFVIIDIKANAFVHHMVRNIAGSLIRVGRGQETPEWMKWVLEQKDRRVAGETAKAAGLYL 238

Query: 242 DSVEY 246
            +V+Y
Sbjct: 239 VAVDY 243


>gi|163816009|ref|ZP_02207379.1| hypothetical protein COPEUT_02189 [Coprococcus eutactus ATCC 27759]
 gi|158448819|gb|EDP25814.1| hypothetical protein COPEUT_02189 [Coprococcus eutactus ATCC 27759]
          Length = 254

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q NG +++  + K +  +  E + V GA RTDSGVHAL  
Sbjct: 10  MKRVKLVVAYDGTNYCGWQVQINGITVEEVLNKTLSELCHENIKVIGASRTDSGVHALGN 69

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD            ALN  L   + I I     V   FH R+    ++Y Y+I+ R+
Sbjct: 70  VAVFDTESGIPGEKFSFALNQRL--PEDIRIQESCQVADDFHPRYCDTIKTYEYKILNRR 127

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             +  E+  +  +   LD + M+ AA  LVG HDF +F S   Q  + +RTI    ++  
Sbjct: 128 FDMPTERLYSTFVYYPLDIDKMKRAAAVLVGEHDFNSFCSTRSQVENTVRTITDITIDKV 187

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G++I IR+    FL+  +R  VG+L  +G G W    +E  L A+DR + GP A  +GL 
Sbjct: 188 GDMIHIRISGNGFLYNMVRIIVGTLMKIGLGIWPEDCMESILAAKDRTKAGPKAEAKGLT 247

Query: 241 FDSVEY 246
              ++Y
Sbjct: 248 LVEIKY 253


>gi|325678788|ref|ZP_08158386.1| tRNA pseudouridine synthase A [Ruminococcus albus 8]
 gi|324109292|gb|EGC03510.1| tRNA pseudouridine synthase A [Ruminococcus albus 8]
          Length = 250

 Score =  191 bits (485), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 127/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  + + + Y+GSGY GWQRQ N  ++Q  +E AIF +TGE VVV G  RTD+GVHA   
Sbjct: 1   MRNFKVTLAYDGSGYHGWQRQSNALAVQEVVENAIFKLTGEKVVVQGCSRTDAGVHARMY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V   +L     P  +   LN++L   D IS++     +  FHAR+    + Y Y +   +
Sbjct: 61  VLSMELESTITPRGIQLGLNSWL--PDDISVIGCEECEAGFHARYHCKGKEYEYIVHNSR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 K  A+     +D   +  AA+  VG HDF  F S  C     +RTI  FDV   
Sbjct: 119 IKDPFLKNTAFRNTYPIDEVLLDKAAKDYVGEHDFKAFCSTACDKEITVRTIYRFDVRRE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G L+   V    FL+  +R  VG+L  + +GK  +  + + ++++DR + G   PP+GLY
Sbjct: 179 GELVIFTVAGNGFLYNMVRIMVGTLLFINEGKIAADAIPRIIESKDRTKAGKTVPPQGLY 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LNKVYY 244


>gi|239948364|ref|ZP_04700117.1| tRNA pseudouridine synthase A [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922640|gb|EER22664.1| tRNA pseudouridine synthase A [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 245

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 107/246 (43%), Positives = 152/246 (61%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQ+Q    S+Q  +E+AI+ ++GE V++ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTNLAGWQKQAGVMSVQQILEEAIYKLSGEQVILFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPHKIIAAINYF-ARPYAVGVWNCELAPNNFHARFSATSRHYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ SPI+T+   ++   
Sbjct: 120 YPSVIDLNRAWWISSPLDILAMQKAASYLLGKHDFTSFRASSCQSKSPIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNVWQAEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F   EY
Sbjct: 240 FVKAEY 245


>gi|312904650|ref|ZP_07763805.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0635]
 gi|310632002|gb|EFQ15285.1| tRNA pseudouridine synthase A [Enterococcus faecalis TX0635]
          Length = 249

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q+Q N  ++Q  IEK +  +  G  V V G+GRTD+GVHA+ 
Sbjct: 1   MPRYKAIIAYDGTHFHGFQKQPNERTVQEEIEKTLVRMNNGHSVTVFGSGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD  +E     +  AL+   +  + I++ ++  V + FHAR+  I ++Y +++   
Sbjct: 61  QVIHFDYPQERPLEKMRFALDT--QTPEDIAVRSVERVSEDFHARYHVIEKTYQFKVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  +D E ++ A   L+G HDFT+F +        +RTI    V+ 
Sbjct: 119 KPRSPFRRFYASYFPYPIDLEKIQQALPDLLGTHDFTSFCASGSSVEDKVRTIHEASVHV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+   T +   + A+DR   GP A PE
Sbjct: 179 NETGDELTFTFRGDGFLYKMIRILVGTLLKIGNGRLEPTAIPAIIAAKDRNLVGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLAEVKY 247


>gi|259417872|ref|ZP_05741791.1| tRNA pseudouridine synthase A [Silicibacter sp. TrichCH4B]
 gi|259346778|gb|EEW58592.1| tRNA pseudouridine synthase A [Silicibacter sp. TrichCH4B]
          Length = 278

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 121/250 (48%), Positives = 159/250 (63%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + +EY+G  + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 20  MPRIALKVEYHGKPFAGWQRQKDQPSVQGAIEAALAKLEPGEHTIAAAGRTDTGVHGLGQ 79

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++W P  L +ALN +LK  D I+I++ + VD  +HARFSAI R YL+RI+ R+
Sbjct: 80  VAHCDLQKDWDPFRLSEALNYHLK-PDPIAIVDAARVDDDWHARFSAIERQYLFRILMRR 138

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G+ W I   LD E M+  A  L+G HDFTTFRS  CQA+SP++T+D   V   
Sbjct: 139 APATHDAGQVWQINHRLDVEAMQAGADMLLGNHDFTTFRSSICQAASPVKTLDELRVEQV 198

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
             L    +   V ARSFLH Q+RSFVG+L+ VG G WT  D+  AL A+DR  CGP+ P 
Sbjct: 199 QGLSGPEVHFHVRARSFLHNQVRSFVGTLERVGAGAWTPEDVRDALAAKDRAACGPVCPG 258

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 259 HGLYLARVGY 268


>gi|237808326|ref|YP_002892766.1| tRNA pseudouridine synthase A [Tolumonas auensis DSM 9187]
 gi|259550489|sp|C4LF13|TRUA_TOLAT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|237500587|gb|ACQ93180.1| tRNA pseudouridine synthase A [Tolumonas auensis DSM 9187]
          Length = 261

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY G+ Y+GWQRQ+  +S+Q  +E A+  V    V +  AGRTD+GV+A  QV
Sbjct: 1   MRIALGIEYFGADYYGWQRQREVNSVQQELETALSRVANHPVEIQCAGRTDAGVNATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L   D I++    +VD  FHARFSA  R Y Y I     
Sbjct: 61  IHFDTTANRQMSAWTLGINAQL--PDDIAVRWAHVVDDNFHARFSATARRYRYIIYNEPL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           L+ + M  A Q L+G  DFT+FR+  CQ+++P R I    V+  G
Sbjct: 119 RPGILAKGVSHYYHPLNADQMNEAGQLLLGERDFTSFRAAQCQSNTPFRNIMSLSVHRAG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + + + A +FLH  +R+ +GSL LVG G+     + + L A+DR   G  A  EGLY 
Sbjct: 179 SYVILDIQANAFLHHMVRNIMGSLLLVGTGEKPKEWIGEILDAKDRTVSGATAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|209518943|ref|ZP_03267753.1| tRNA pseudouridine synthase A [Burkholderia sp. H160]
 gi|209500595|gb|EEA00641.1| tRNA pseudouridine synthase A [Burkholderia sp. H160]
          Length = 270

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+G+ + GWQ Q +G+++Q  +E+A+   T   V    AGRTD GVH L Q
Sbjct: 1   MTRIALGVQYDGAAFAGWQSQPHGNTVQDELERALREFTRTPVQTVVAGRTDRGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   + V +   +  NA+L    TI +     +   FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELDRVDISWVRGPNAFL--PKTIGVQWAKPMPDDFHARFSAFERTYYYVLYVSP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +   LD + MR+AA+HL+G HDF+ FRS  CQ+ +P + +   DV   
Sbjct: 119 VRSPMLTTRAGWVHTPLDVDAMRLAAEHLIGEHDFSAFRSSQCQSKTPFKHLYQIDVKRQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN +  R  A +FLH  +R+ +G L  +G G+  +  +   L ++ R    P   P+GLY
Sbjct: 179 GNFVHFRFRANAFLHHMVRNVMGCLIEIGSGRRPAAWMADVLASRSRDCAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|163787684|ref|ZP_02182131.1| putative tRNA pseudouridine synthase A [Flavobacteriales bacterium
           ALC-1]
 gi|159877572|gb|EDP71629.1| putative tRNA pseudouridine synthase A [Flavobacteriales bacterium
           ALC-1]
          Length = 252

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 118/245 (48%), Gaps = 4/245 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R+ + + YNG  Y GWQ Q N  S+Q  +EKA+  +    V V GAGRTD+GVHA +  
Sbjct: 1   MRFFIELSYNGKEYHGWQNQPNAISVQEVLEKALSTILKAEVSVMGAGRTDAGVHASQMF 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD  +E+    +   LN+YL     I++  +  V    HARF A  R+Y Y+I T  +
Sbjct: 61  AHFDFEKEFEYKDVVYKLNSYL--PKDIAVSTIFEVKPDAHARFEAKSRTYHYKIST--S 116

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
               +   A+ +   LD E M  A + L    DF  F   +    +    I         
Sbjct: 117 KNVFDYDFAYQVQLPLDVEAMNTACKILFEYKDFQCFSKSNTDVKTYNCDIKEAFWTQNS 176

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N +   + A  FL   +R+ VG++  +G GK    DL K + +++R E G   P  GLY 
Sbjct: 177 NQLIFTITADRFLRNMVRAIVGTMVNIGLGKLKPEDLHKIIASKNRSEAGFSVPAHGLYL 236

Query: 242 DSVEY 246
             + Y
Sbjct: 237 AKIVY 241


>gi|156933088|ref|YP_001437004.1| tRNA pseudouridine synthase A [Cronobacter sakazakii ATCC BAA-894]
 gi|166228697|sp|A7MH65|TRUA_ENTS8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|156531342|gb|ABU76168.1| hypothetical protein ESA_00898 [Cronobacter sakazakii ATCC BAA-894]
          Length = 270

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS Y+GWQRQ+   S+Q  +EKA+  V  E + V  AGRTD+GVHA  QV
Sbjct: 10  VKIALGIEYDGSKYYGWQRQQEVRSVQEKLEKALSQVANEPINVFCAGRTDAGVHATGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L     I++  +  V  +FHARFSA  R Y Y I   + 
Sbjct: 70  VHFETTAIRKDAAWTLGVNANL--PGDIAVRWVKDVPAEFHARFSATARRYRYVIYNHRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V  FG
Sbjct: 128 RPAVLSQGVTHYHLPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNLMHINVERFG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  +G G    + + + L A+DR      A  EGLY 
Sbjct: 188 AYIVVDIKANAFVHHMVRNIVGSLMEIGCGNQPESWMAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            SV+Y
Sbjct: 248 VSVDY 252


>gi|154247231|ref|YP_001418189.1| tRNA pseudouridine synthase A [Xanthobacter autotrophicus Py2]
 gi|238686729|sp|A7IKI9|TRUA_XANP2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|154161316|gb|ABS68532.1| tRNA pseudouridine synthase A [Xanthobacter autotrophicus Py2]
          Length = 245

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 125/246 (50%), Positives = 166/246 (67%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ Y GWQ Q +  ++QG++ +A     GE V V GAGRTD+GVHA  Q
Sbjct: 1   MPRYKLTIEYDGTPYAGWQIQADQQTVQGALAQAFKRFCGEDVHVAGAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R W    +  A+ A L+    I++L+   V   F ARFSA +R YLYRII R+
Sbjct: 61  VAHVDLSRHWRSDTVRDAMTAQLR-PHPIAVLSAEEVPDSFDARFSATKRHYLYRIINRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             LAL++ RAW IP+ LD + M  AAQ L+G+HDF+TFR+  CQA+SP++T+D  DV+  
Sbjct: 120 PDLALDRDRAWRIPQKLDAQAMHEAAQRLLGKHDFSTFRAAECQAASPLKTLDQLDVSRS 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I +   ARSFLH Q+RS VGSL  VG+G+W++ DLE AL+A DR  CGP+AP  GLY
Sbjct: 180 GDEIRVITSARSFLHHQVRSMVGSLMRVGEGRWSADDLEAALKAADRTRCGPMAPAAGLY 239

Query: 241 FDSVEY 246
             +V Y
Sbjct: 240 LAAVSY 245


>gi|194017442|ref|ZP_03056053.1| tRNA pseudouridine synthase A [Bacillus pumilus ATCC 7061]
 gi|194010714|gb|EDW20285.1| tRNA pseudouridine synthase A [Bacillus pumilus ATCC 7061]
          Length = 247

 Score =  191 bits (484), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 81/247 (32%), Positives = 127/247 (51%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI--VVVHGAGRTDSGVHALR 59
           ++    + Y+G+ + G+Q Q    ++Q  IE A+  +  +   + +  +GRTDSGVHA  
Sbjct: 1   MKVKCTVSYDGTHFKGYQVQPGQRTVQTEIESALARMHKQDELIPIVASGRTDSGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN+ L   D I +L    VD+ FHARFS + + Y Y++ T 
Sbjct: 61  QVIHFDTPLSIPMERWPFALNSLL--PDDIRVLKAEEVDESFHARFSVVSKEYRYKVSTE 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                  +  A   P  LD + MR AA HL+G HDFT+F + + +    +R I   +  +
Sbjct: 119 THQNVFTRQYACHFPYRLDADKMREAAGHLIGTHDFTSFCAANTEVQDKVREIYTLEWKN 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +E+RV    FL+  +R   G+L  +G GK+   +++  L A++R+  G  AP  GL
Sbjct: 179 VSDGLEMRVRGNGFLYNMVRIIAGTLLEIGSGKFHPEEIKAMLAARNREAAGKTAPSHGL 238

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 239 YLWEVFY 245


>gi|302384321|ref|YP_003820144.1| tRNA pseudouridine synthase A [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194949|gb|ADL02521.1| tRNA pseudouridine synthase A [Brevundimonas subvibrioides ATCC
           15264]
          Length = 247

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 108/246 (43%), Positives = 152/246 (61%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  Y G+Q Q    ++QG +E A+    G+ V +  AGRTDSGVHA  Q
Sbjct: 1   MPRYRLTLEYDGRPYAGFQAQDGLPTVQGVVETAVTAFCGQTVRIAAAGRTDSGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL + W    +  ALNA++       +   ++ D  +HARFSA  R YLYRI+ R 
Sbjct: 61  VAHVDLDKAWPASTVMNALNAHMVREGVAVLACEAVPD-DWHARFSATGRRYLYRILNRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              ALE+G+ W + + LD   M+  A HL+G HDFTTFR + CQ+ SP +T+D   V++ 
Sbjct: 120 GRPALERGKVWHVRRPLDVAAMQAGADHLIGHHDFTTFRDLACQSKSPEKTLDVARVSAV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + +   ARSFLH Q+RS  G+L  VG G+W+  D++ AL+A+DR  CGP++P +GLY
Sbjct: 180 GEEVHLVFEARSFLHRQVRSMTGTLVEVGLGRWSPDDVKTALEARDRTACGPVSPSDGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LTGVAY 245


>gi|114706822|ref|ZP_01439722.1| tRNA pseudouridine synthase A [Fulvimarina pelagi HTCC2506]
 gi|114537770|gb|EAU40894.1| tRNA pseudouridine synthase A [Fulvimarina pelagi HTCC2506]
          Length = 261

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 127/248 (51%), Positives = 167/248 (67%), Gaps = 2/248 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ Y GWQRQ +  S+Q  IE+A   + G   V+ GAGRTDSGVHA  Q
Sbjct: 1   MPRYKLTVEYDGTPYAGWQRQADEPSVQAVIEEAAHRLCGTNPVLFGAGRTDSGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL + +    +  ALNA+    + + IL+   V   F ARFSA +R Y YRI  R+
Sbjct: 61  VAHIDLPKAYAGGTVRDALNAH-MRDEPVVILSAEEVGADFDARFSARKRWYRYRIFNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS- 179
           AP A+ +G+ W + K LD E M  AAQ L G HDFTTFRS HCQA +PIRT++  +V   
Sbjct: 120 APAAILRGKVWWVSKLLDTEAMHEAAQVLAGTHDFTTFRSTHCQAKNPIRTLEKLEVVRA 179

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I I  +A+SFLH QIRSF G+LKLVG+G+WT+TD+ +AL+A+DR  CGP+APP GL
Sbjct: 180 NGEEIHIVAMAQSFLHNQIRSFAGTLKLVGEGRWTATDVSEALKAKDRTACGPVAPPYGL 239

Query: 240 YFDSVEYS 247
           Y  ++EY+
Sbjct: 240 YLTAIEYT 247


>gi|168181898|ref|ZP_02616562.1| tRNA pseudouridine synthase A [Clostridium botulinum Bf]
 gi|237796908|ref|YP_002864460.1| tRNA pseudouridine synthase A [Clostridium botulinum Ba4 str. 657]
 gi|182674803|gb|EDT86764.1| tRNA pseudouridine synthase A [Clostridium botulinum Bf]
 gi|229262719|gb|ACQ53752.1| tRNA pseudouridine synthase A [Clostridium botulinum Ba4 str. 657]
          Length = 246

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 134/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EKAI  +T E + V G  RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGANYCGWQKQKNEKFITLQGTLEKAISNITKEKIEVIGVSRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             V +F    +  P  L K +N  L     I +L+      +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYVCNFFTNTKIPPENLQKVINNNL--PADIVVLSSEEASNEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM++A+++ +G HDF+ F++      + +RTI  F++N
Sbjct: 119 SSQPIAIGRNYIFQFKDKLNIDNMKMASRYFIGTHDFSAFKTKGSSIKTSVRTISKFEIN 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG+L  +G  K     ++  ++++DR + G   P  G
Sbjct: 179 KKGDFIKFIITGDGFLYNMVRIIVGTLIEIGLNKREPEYIKYVIKSKDRTKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|323143617|ref|ZP_08078294.1| tRNA pseudouridine synthase A [Succinatimonas hippei YIT 12066]
 gi|322416680|gb|EFY07337.1| tRNA pseudouridine synthase A [Succinatimonas hippei YIT 12066]
          Length = 261

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY G  Y G+QRQ N  ++QG +EKA+ ++  E V +  AGRTD+GV+A  QV
Sbjct: 1   MRVALGVEYEGWNYAGFQRQPNAVTVQGELEKALSIIADEPVSLVCAGRTDAGVNATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            H D+ ++     L    N  L     I+I    IV + FHARFSA  R Y Y I     
Sbjct: 61  IHIDITKDRSEKALLLGTNTKL--PSDIAITWAKIVSEDFHARFSARARRYRYIIQNTMH 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +      +     D E M+ AA+ L+G HDF +F+    Q+SS  R + + +++  G
Sbjct: 119 RPGVLNKGVSVYHGDYDIELMQKAAKILIGEHDFASFKGADEQSSSTFRCVHYIEISRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I   + A +FL+  +R+ VGSL LVG    ++   E+A +A++R   GP A P+GLY 
Sbjct: 179 PFIVFDIAANAFLNHMVRNIVGSLLLVGSKVKSTAWFEEAFKARNRDAAGPTAHPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|260588018|ref|ZP_05853931.1| tRNA pseudouridine synthase A [Blautia hansenii DSM 20583]
 gi|331082412|ref|ZP_08331538.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260541545|gb|EEX22114.1| tRNA pseudouridine synthase A [Blautia hansenii DSM 20583]
 gi|330400898|gb|EGG80499.1| tRNA pseudouridine synthase A [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 244

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 132/246 (53%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNG-SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + Y + I+Y+GS Y GWQRQK+  ++IQG IE  +  + G  V + GAGRTD+GVHA  Q
Sbjct: 1   MNYRLDIQYDGSRYGGWQRQKDTDNTIQGKIEDVLTKMLGTEVQIQGAGRTDAGVHAKGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F    E     +C+ LN YL   + I I  +S  +++FH+R +A  + Y YRI++  
Sbjct: 61  VANFHADCEKSCEEICQYLNEYL--PEDIEISKVSEAEERFHSRLNAKEKVYQYRIVSGI 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                E+     + ++LD   M+ AA++L G HDF +F S      S +RTI   ++   
Sbjct: 119 HKNVFERKYQCPLHETLDVNAMQEAAKYLEGTHDFKSFCSNKKMKKSSVRTIYSIEIVDL 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I      FL+  +R   G+L  VG G+    +++  L+  DRKE G  AP  GL 
Sbjct: 179 TQEIVITYTGNGFLYNMVRILTGTLIEVGRGRRKPEEMKGILEGCDRKEAGFTAPARGLT 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LLEVRY 244


>gi|67459748|ref|YP_247372.1| tRNA pseudouridine synthase A [Rickettsia felis URRWXCal2]
 gi|75535862|sp|Q4UJT2|TRUA_RICFE RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|67005281|gb|AAY62207.1| tRNA pseudouridine synthase A [Rickettsia felis URRWXCal2]
          Length = 245

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 108/246 (43%), Positives = 151/246 (61%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE V++ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTNLAGWQRQAGVISVQQILEEAIYKFSGEQVILFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKHLEPHKIITAINYF-ARPYAVGVWNCELASNNFHARFSATSRHYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ SPI+T+   ++   
Sbjct: 120 YPSVIDLNRAWWISSPLDVLTMQKAAAYLLGKHDFTSFRASSCQSKSPIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNVWQAEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F   EY
Sbjct: 240 FVKTEY 245


>gi|109897925|ref|YP_661180.1| tRNA pseudouridine synthase A [Pseudoalteromonas atlantica T6c]
 gi|123064742|sp|Q15VG2|TRUA_PSEA6 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|109700206|gb|ABG40126.1| tRNA pseudouridine synthase A [Pseudoalteromonas atlantica T6c]
          Length = 263

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G+ + GWQRQ    S+Q  +E+A+  +  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGVEYDGARFHGWQRQNEVISVQQHLEEALTRIANEPIRVVCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +N YL   DTIS+  +  V + FHARFSA  R Y Y I     
Sbjct: 61  VHFETTSQRPDRAWTLGINTYL--PDTISVRWVKAVPEDFHARFSATARRYRYIIYNNTL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +       I   LD E M  AAQ LVG+HDF++FR+++CQA +  RT+ H  V   G
Sbjct: 119 RSGILANGVTHIYGDLDHELMHEAAQKLVGKHDFSSFRAVNCQAKTATRTMSHIRVKRMG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I I V A +FLH  +R+  G+L  +G  +     +++ L+ +DR + G  A P GLY 
Sbjct: 179 DYIVIDVQANAFLHHMVRNITGTLVAIGHKEKPVEWVDELLEVKDRTKAGITALPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VHVTY 243


>gi|323967759|gb|EGB63171.1| tRNA pseudouridine synthase A [Escherichia coli M863]
 gi|327252589|gb|EGE64248.1| tRNA pseudouridine synthase A [Escherichia coli STEC_7v]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|261493083|ref|ZP_05989622.1| tRNA-pseudouridine synthase I [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261311262|gb|EEY12426.1| tRNA-pseudouridine synthase I [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 279

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 136/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ+   S+Q  +E+A+ +V    V V  AGRTD+GVH   QV
Sbjct: 19  MKIALGIEYDGSRYFGWQRQEAVESVQQQLEQALSVVANSPVEVFCAGRTDAGVHGTGQV 78

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA+L   D I++     V++ FHARFSA  R Y Y I  ++ 
Sbjct: 79  VHFETQANRPLQSWCFGTNAHL--PDDIAVKWAVAVNEDFHARFSATARRYRYIIFNQKL 136

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD   M  A Q+L+G +DF++FR+  CQ+++P R I H +V+  G
Sbjct: 137 RSAILPKGVTHFHFPLDERKMHQAGQYLLGENDFSSFRAAKCQSNTPWRNIHHLNVSRQG 196

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + + + A +F+H  +R+ VG+L  +G GK      +  L+ +DR++  P A  EGLY 
Sbjct: 197 NYVIVDIQANAFVHHMVRNIVGTLLEIGQGKQPVEWAKWVLEQRDREKAAPTAKAEGLYL 256

Query: 242 DSVEY 246
             V Y
Sbjct: 257 VEVHY 261


>gi|227543592|ref|ZP_03973641.1| tRNA pseudouridine synthase A [Lactobacillus reuteri CF48-3A]
 gi|300909379|ref|ZP_07126840.1| tRNA-pseudouridine synthase I [Lactobacillus reuteri SD2112]
 gi|227186432|gb|EEI66503.1| tRNA pseudouridine synthase A [Lactobacillus reuteri CF48-3A]
 gi|300893244|gb|EFK86603.1| tRNA-pseudouridine synthase I [Lactobacillus reuteri SD2112]
          Length = 256

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 130/251 (51%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI---VVVHGAGRTDSGVHA 57
           M RY +   Y+G+ + G+Q Q N  +++ +++ A+  +       + V G+GRTD+GVHA
Sbjct: 1   MYRYKITFAYDGTNFSGFQIQPNKRTVEQTLKNAVNKIAKHPNPAIPVIGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFD+        + KALN+ L     I I    +VD  FHAR+SA R++Y YR+ 
Sbjct: 61  LNQVAHFDIPYHLSNESMRKALNSIL--PLDILIKKAELVDNDFHARYSAHRKTYRYRVD 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
             +     ++         L+ E MR AA  LVG HDFT+F +   QA S +RTI+   +
Sbjct: 119 QGEFVNPFKRNYTSHFKYPLNLEKMRKAANDLVGTHDFTSFVASGSQAKSNVRTIESITI 178

Query: 178 NSF--GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                 N +        FL+ Q+R  V  L  +G  +    D+ + L+A+DR      AP
Sbjct: 179 KRDELRNEVVFDFTGNGFLYNQVRIMVAFLLEIGSNQRPVDDVSRVLEAKDRTLARMTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY  +V+Y
Sbjct: 239 ASGLYLVNVDY 249


>gi|240849747|ref|YP_002971135.1| tRNA pseudouridine synthase A [Bartonella grahamii as4aup]
 gi|240266870|gb|ACS50458.1| tRNA pseudouridine synthase A [Bartonella grahamii as4aup]
          Length = 247

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 132/247 (53%), Positives = 169/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQ    ++QG++E+AIF  +G+ + +  AGRTD+GVHA  Q
Sbjct: 1   MPRFKLTLEYDGSNYAGWQRQAKLHTVQGALEQAIFSFSGQQLTITTAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLK-ISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D ++ W P  +  ALNA L+   + ISILN+  V   F ARFSA++R Y+++I+ R
Sbjct: 61  VAHVDFIKNWHPHTVRDALNALLRKQGEAISILNVQNVPDDFDARFSAVKRHYIFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W +PK L+ E M  AAQ LVG HDFTTFRS HCQA SPIRT+D  D+  
Sbjct: 121 RSPPALNAKRVWWLPKPLNAEAMHEAAQKLVGEHDFTTFRSAHCQAKSPIRTLDRLDIQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A+DRK CG +APP GL
Sbjct: 181 EGEEIFLYAQARSFLHHQIRSFAGSLMEVGIGRWTAQDLEAALHAKDRKHCGVVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   VEY
Sbjct: 241 YLTKVEY 247


>gi|295700767|ref|YP_003608660.1| tRNA pseudouridine synthase A [Burkholderia sp. CCGE1002]
 gi|295439980|gb|ADG19149.1| tRNA pseudouridine synthase A [Burkholderia sp. CCGE1002]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+G+ + GWQ Q +G+++Q  +E+A+   T   V    AGRTD GVH L Q
Sbjct: 1   MKRIALGVQYDGAAFAGWQSQPHGNTVQDELERALREFTRTPVQTVVAGRTDRGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   + V +   +  NA+L    TI +     +   FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELDRVDISWVRGPNAFL--PKTIGVQWAKPMPDDFHARFSAFERTYYYVLYVSP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +   LD + MR AA+HL+G HDF+ FRS  CQ+ +P + +   DV   
Sbjct: 119 VRSPMLTTRAGWVHTPLDVDAMRSAAEHLIGEHDFSAFRSSQCQSKTPFKHLYRIDVKRQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN +  R  A +FLH  +R+ +G L  +G G+  +  +   L ++ R    P   P+GLY
Sbjct: 179 GNFVHFRFRANAFLHHMVRNVMGCLIEIGSGRRPAAWMADVLASRSRDCAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|310659467|ref|YP_003937188.1| tRNA pseudouridine synthase a [Clostridium sticklandii DSM 519]
 gi|308826245|emb|CBH22283.1| tRNA pseudouridine synthase A 1 (tRNA-uridine isomerase I 1) (tRNA
           pseudouridylate synthase I 1) [Clostridium sticklandii]
          Length = 249

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 93/247 (37%), Positives = 138/247 (55%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    ++IEY+G+ Y GWQRQ N +S+Q  IEKAI+ VT +   ++G+GRTD+ VHAL Q
Sbjct: 1   MRNILILIEYDGTNYNGWQRQPNAASVQEEIEKAIYKVTKKQTDIYGSGRTDAKVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F             ALN  L   D I ILN   V ++FH+R+SA  ++Y YR++   
Sbjct: 61  VANFHTDSAIPTEKFAVALNTNL--PDDIVILNSIEVPEEFHSRYSAKVKTYRYRVLNTP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +E+  A+ + + LD + ++  A+ L+G HDF  F S      + IRTI    +   
Sbjct: 119 VRRPIERNYAYHVREDLDLDIIKTMAKLLIGEHDFKAFSSSGSSVKTTIRTIYDIKITKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            ++IE       FL+  +R  VG+L  +G  K T  D+++AL   DR   GP APP+GL+
Sbjct: 179 NDIIEFEFTGNGFLYNMVRIIVGTLIELGK-KSTRYDIQRALMTGDRGFAGPTAPPQGLF 237

Query: 241 FDSVEYS 247
              V Y+
Sbjct: 238 LKKVSYN 244


>gi|261496287|ref|ZP_05992691.1| tRNA-pseudouridine synthase I [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261308049|gb|EEY09348.1| tRNA-pseudouridine synthase I [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 279

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 137/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ+   S+Q  +E+A+ +V    V V  AGRTD+GVH   QV
Sbjct: 19  MKIALGIEYDGSRYFGWQRQEAVESVQQQLEQALSVVANSPVEVFCAGRTDAGVHGTGQV 78

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA+L   D I++     V++ FHARFSA  R Y Y I  ++ 
Sbjct: 79  VHFETQANRPLQSWCFGTNAHL--PDDIAVKWAVAVNEDFHARFSATARRYRYIIFNQKL 136

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD   M  A Q+L+G +DF++FR+  CQ+++P R I H +V+  G
Sbjct: 137 RSAILPKGVTHFHFPLDERKMHQAGQYLLGENDFSSFRAAKCQSNTPWRNIHHLNVSRQG 196

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + + + A +F+H  +R+ VG+L  +G GK +    +  L+ +DR++  P A  EGLY 
Sbjct: 197 NYVIVDIQANAFVHHMVRNIVGTLLEIGQGKQSVEWAKWVLEQRDREKAAPTAKAEGLYL 256

Query: 242 DSVEY 246
             V Y
Sbjct: 257 VEVHY 261


>gi|254362514|ref|ZP_04978619.1| tRNA-pseudouridine synthase I [Mannheimia haemolytica PHL213]
 gi|153094111|gb|EDN75015.1| tRNA-pseudouridine synthase I [Mannheimia haemolytica PHL213]
          Length = 261

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 136/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS YFGWQRQ+   S+Q  +E+A+ +V    V V  AGRTD+GVH   QV
Sbjct: 1   MKIALGIEYDGSRYFGWQRQEAVESVQQQLEQALSVVANSPVEVFCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+          C   NA+L   D I++     V++ FHARFSA  R Y Y I  ++ 
Sbjct: 61  VHFETQANRPLQSWCFGTNAHL--PDDIAVKWAVAVNEDFHARFSATARRYRYIIFNQKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD   M  A Q+L+G +DF++FR+  CQ+++P R I H +V+  G
Sbjct: 119 RSAILPKGVTHFHFPLDERKMHQAGQYLLGENDFSSFRAAKCQSNTPWRNIHHLNVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + + + A +F+H  +R+ VG+L  +G G+      +  L+ +DR++  P A  EGLY 
Sbjct: 179 NYVIVDIQANAFVHHMVRNIVGTLLEIGQGRQPVEWAKWVLEQRDREKAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VEVHY 243


>gi|308050321|ref|YP_003913887.1| tRNA pseudouridine synthase A [Ferrimonas balearica DSM 9799]
 gi|307632511|gb|ADN76813.1| tRNA pseudouridine synthase A [Ferrimonas balearica DSM 9799]
          Length = 263

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 124/245 (50%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G GYFGWQRQ+    +Q  +E AI  V    V V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGHGYFGWQRQREVVGVQERLEAAIAKVANHPVEVACAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +  P      LNA L   D I++     V   FHARFSA  R Y Y I   + 
Sbjct: 61  VHFDAQFDRRPAAWTLGLNANL--PDGIAVRWAQPVSDDFHARFSATARRYRYIIFNNRL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         LD   M  A Q L+G +DF+ FR+I CQ+ +P R I H  V   G
Sbjct: 119 RPGILRHGVSHYHHPLDEALMHQAGQQLLGENDFSAFRAIQCQSRTPWRNIHHLRVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G      + + L+ +DR      A  EGLY 
Sbjct: 179 QYVIIDIKANAFVHHMVRNIAGSLMEVGMGNRPVEWIAELLEGKDRNLAAATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|82544799|ref|YP_408746.1| tRNA pseudouridine synthase A [Shigella boydii Sb227]
 gi|123728357|sp|Q31YE0|TRUA_SHIBS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|81246210|gb|ABB66918.1| pseudouridylate synthase I [Shigella boydii Sb227]
 gi|332093646|gb|EGI98704.1| tRNA pseudouridine synthase A [Shigella boydii 3594-74]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/244 (37%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L   D I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAPRKDAAWTLGVNANL--PDDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|225026395|ref|ZP_03715587.1| hypothetical protein EUBHAL_00644 [Eubacterium hallii DSM 3353]
 gi|224956284|gb|EEG37493.1| hypothetical protein EUBHAL_00644 [Eubacterium hallii DSM 3353]
          Length = 256

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 83/254 (32%), Positives = 130/254 (51%), Gaps = 10/254 (3%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ +++ Y+G+ Y GWQ Q NG +++  + K +     E + + GA RTDSGVH+   
Sbjct: 4   MKRFKLVVAYDGTNYCGWQIQPNGITVEEVLNKTLSRFLKEEIHIIGASRTDSGVHSFGN 63

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD      P  LC ALN  L   + I I++   V   FH R+   R++Y Y I   +
Sbjct: 64  VAVFDSETTIPPEKLCFALNPQL--PEDIRIVSSEQVPGDFHPRYCDTRKTYEYHIQNGK 121

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRT--------I 172
            PL  E+  + L+   L+ + M+ A+Q+LVG HDF +F +   QA + +RT         
Sbjct: 122 IPLPTERLYSHLVIFPLNIQAMQEASQYLVGTHDFKSFCAAKTQAQTTVRTVTGIEVEAH 181

Query: 173 DHFDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGP 232
              +       + IRV    FL+  +R   G+L  VG G +    +++ L+A DR + G 
Sbjct: 182 PLSEGEYPSKKVIIRVTGEGFLYNMVRIISGTLIKVGLGVYPPEHVKQILEACDRSQAGE 241

Query: 233 LAPPEGLYFDSVEY 246
             P +GL+   +EY
Sbjct: 242 TVPAKGLFLKKIEY 255


>gi|254454857|ref|ZP_05068294.1| tRNA pseudouridine synthase A [Octadecabacter antarcticus 238]
 gi|198269263|gb|EDY93533.1| tRNA pseudouridine synthase A [Octadecabacter antarcticus 238]
          Length = 256

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 118/251 (47%), Positives = 155/251 (61%), Gaps = 6/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQRQ +  S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MPRYALKIEYDGAPFCGWQRQTSDPSVQGAIEAALAKLEPREHKIGAAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ + W    L +ALN +LK    ISI+  + V   +HARFSA+ R YL+R++ R+
Sbjct: 61  VAHCDMDKAWDAFRLSEALNFHLK-PAPISIVACAQVSDDWHARFSALERRYLFRLVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRT-----IDHF 175
           APL LE G+ W + + LD   M+  A  L+G HDFTTFRS  CQA SP+RT     +   
Sbjct: 120 APLVLEVGKVWQVGQKLDGALMQAGADRLLGHHDFTTFRSTVCQADSPMRTLDGLKVQQV 179

Query: 176 DVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                    +  V ARSFLH Q+RSFVG+L+ VG G WT  D+  AL A+DR  CGP+ P
Sbjct: 180 TRVDGAQEFQFHVRARSFLHNQVRSFVGTLERVGAGAWTPDDVTAALNARDRTACGPVCP 239

Query: 236 PEGLYFDSVEY 246
           P GLY   V Y
Sbjct: 240 PHGLYLAGVSY 250


>gi|152971246|ref|YP_001336355.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|166228703|sp|A6TC04|TRUA_KLEP7 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|150956095|gb|ABR78125.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/244 (37%), Positives = 133/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETRAQRKDAAWTLGVNANL--PGDIAVRWVKHVPADFHARFSATARRYRYVIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V  +G 
Sbjct: 129 PAVLSQGVTHFHQPLDAERMQRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRYGA 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAGNQPESWMAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           SV+Y
Sbjct: 249 SVDY 252


>gi|258646098|ref|ZP_05733567.1| tRNA pseudouridine synthase A [Dialister invisus DSM 15470]
 gi|260403476|gb|EEW97023.1| tRNA pseudouridine synthase A [Dialister invisus DSM 15470]
          Length = 265

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 114/247 (46%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + + Y G+ Y G+QRQ+N  ++Q  +E A+  +TG    ++ A RTD+GVHA  Q
Sbjct: 1   MRNIRITLAYEGTAYSGFQRQENSITVQEILETALQKLTGTKTTLYFAARTDAGVHAYGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
              F             ALN  L     I +     V   F  R +   ++Y Y +   +
Sbjct: 61  ECTFYTESSIPGDRFIFALNILL--PPDIRVTESREVPYDFSVRRNNYGKTYGYLLTEEK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 K   W   + LD   M  AA+ L G HDFT+FR  +   +SP+RTI    +   
Sbjct: 119 DCPPFFKRYTWQTGRKLDISKMEKAAEVLSGTHDFTSFRGNNSVPASPVRTIHDIRIIKK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +   I V    FL+  +R+  G+L   G GK T  DL + L+A+DRK  G  AP  GL 
Sbjct: 179 HHFFHIFVTGEGFLYHMVRNIAGALADAGTGKLTPKDLREILEAKDRKFLGATAPAHGLC 238

Query: 241 FDSVEYS 247
              V ++
Sbjct: 239 LLKVYFT 245


>gi|238895838|ref|YP_002920574.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae NTUH-K2044]
 gi|329997357|ref|ZP_08302740.1| tRNA pseudouridine synthase A [Klebsiella sp. MS 92-3]
 gi|238548156|dbj|BAH64507.1| tRNA pseudouridine synthase A [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|328539106|gb|EGF65142.1| tRNA pseudouridine synthase A [Klebsiella sp. MS 92-3]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/244 (37%), Positives = 133/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETRAQRKDAAWTLGVNANL--PGDIAVRWVKHVPADFHARFSATARRYRYVIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M+ AAQ L+G +DFT+FR++ CQ+ +P R + H +V  +G 
Sbjct: 129 PAVLSHGVTHFHQPLDAERMQRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRYGA 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG G    + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAGNQPESWMAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           SV+Y
Sbjct: 249 SVDY 252


>gi|259502563|ref|ZP_05745465.1| tRNA pseudouridine synthase A [Lactobacillus antri DSM 16041]
 gi|259169515|gb|EEW54010.1| tRNA pseudouridine synthase A [Lactobacillus antri DSM 16041]
          Length = 256

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/251 (35%), Positives = 133/251 (52%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI---VVVHGAGRTDSGVHA 57
           M RY +   Y+G+ + G+Q Q +  +++  ++ A+  +       V V G+GRTD+GVHA
Sbjct: 1   MYRYKITFAYDGANFSGFQIQPHKRTVEQVLKNAVNKIAKHPDPPVSVIGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFD+  +     + KALN+ L     I +     VD+ FHAR+SA R++Y YR+ 
Sbjct: 61  LNQVAHFDIPYQLSDEAMRKALNSLL--PLDILVKKAERVDENFHARYSAHRKTYRYRVD 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
                   ++         +D E MR+AA+  +G HDFT+F +   QA S +RT++   V
Sbjct: 119 QGDFVDPFKRNYTAHYKVPVDIEKMRLAAKDFIGEHDFTSFVASGSQAKSNVRTVEKITV 178

Query: 178 NSFGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
           N      E         FL+ QIR  V  L  VG G+   +D+++ L A+DR +    AP
Sbjct: 179 NRDPAQNEVVFEFTGNGFLYNQIRIMVAFLLEVGSGQRPVSDVKRVLAAKDRTQARMTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY  SV+Y
Sbjct: 239 ASGLYLVSVDY 249


>gi|238024257|ref|YP_002908489.1| tRNA pseudouridine synthase A [Burkholderia glumae BGR1]
 gi|237878922|gb|ACR31254.1| Pseudouridylate synthase [Burkholderia glumae BGR1]
          Length = 276

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 85/245 (34%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G+++Q ++E+A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFHGWQSQPHGNTVQDTLERALKAFARVPLQTVVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L  S  +       + + FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTELDRTAFSWVRGTNAFLPPSVAVQW--AKPMPEAFHARFAAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +   RA  +   LD E MR AA HL+G HDF++FRS  CQ+ +P++ +   D+   G
Sbjct: 119 RSPMLAARAGWVHTPLDVEAMRAAAAHLIGEHDFSSFRSSECQSKTPVKHLYQIDIRPSG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ +  L++ L A++R    P   P+GLY 
Sbjct: 179 SFIHFRFRANAFLHHMVRNLMGCLIAVGRGRYPADWLDEVLAARNRDRAAPTFAPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|152979369|ref|YP_001344998.1| tRNA pseudouridine synthase A [Actinobacillus succinogenes 130Z]
 gi|171704324|sp|A6VQ16|TRUA_ACTSZ RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|150841092|gb|ABR75063.1| tRNA pseudouridine synthase A [Actinobacillus succinogenes 130Z]
          Length = 264

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + +EYNG  YFGWQRQ+   S+Q  +EKA+  V  E + +  AGRTDSGVH   QV
Sbjct: 1   MKIALGVEYNGKRYFGWQRQEKVLSVQEELEKALSFVANEKIDLFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA L   D I++      D +FHARFSA  R Y Y I T   
Sbjct: 61  VHFETEVVRPERAWAFGTNANL--PDDIAVKWAKTADDEFHARFSATARRYRYLIYTNPL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M  A Q L+G +DF++FR+  CQ+ +P R + H  V   G
Sbjct: 119 RSAVLPEGVTHCHLPLDHEKMHEAGQFLLGENDFSSFRAAQCQSKTPWRNVHHLQVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G+     ++  L+ ++RK   P A P+GLY 
Sbjct: 179 RYIVVDIQANAFVHHMVRNIVGSLMEVGSGRQPVEWMKWLLEQRNRKLAAPTAKPQGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VRVTY 243


>gi|16804636|ref|NP_466121.1| tRNA pseudouridine synthase A [Listeria monocytogenes EGD-e]
 gi|224499270|ref|ZP_03667619.1| tRNA pseudouridine synthase A [Listeria monocytogenes Finland 1988]
 gi|224503609|ref|ZP_03671916.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL R2-561]
 gi|254829047|ref|ZP_05233734.1| truA [Listeria monocytogenes FSL N3-165]
 gi|254830971|ref|ZP_05235626.1| tRNA pseudouridine synthase A [Listeria monocytogenes 10403S]
 gi|254899951|ref|ZP_05259875.1| tRNA pseudouridine synthase A [Listeria monocytogenes J0161]
 gi|254912843|ref|ZP_05262855.1| tRNA pseudouridine synthase A [Listeria monocytogenes J2818]
 gi|254937223|ref|ZP_05268920.1| truA [Listeria monocytogenes F6900]
 gi|255029029|ref|ZP_05300980.1| tRNA pseudouridine synthase A [Listeria monocytogenes LO28]
 gi|284800516|ref|YP_003412381.1| tRNA pseudouridine synthase A [Listeria monocytogenes 08-5578]
 gi|284993702|ref|YP_003415470.1| tRNA pseudouridine synthase A [Listeria monocytogenes 08-5923]
 gi|24212550|sp|Q8Y457|TRUA_LISMO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|16412086|emb|CAD00676.1| truA [Listeria monocytogenes EGD-e]
 gi|258601456|gb|EEW14781.1| truA [Listeria monocytogenes FSL N3-165]
 gi|258609828|gb|EEW22436.1| truA [Listeria monocytogenes F6900]
 gi|284056078|gb|ADB67019.1| tRNA pseudouridine synthase A [Listeria monocytogenes 08-5578]
 gi|284059169|gb|ADB70108.1| tRNA pseudouridine synthase A [Listeria monocytogenes 08-5923]
 gi|293590841|gb|EFF99175.1| tRNA pseudouridine synthase A [Listeria monocytogenes J2818]
          Length = 248

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V V  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRVTASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ +AL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISEALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|290891783|ref|ZP_06554780.1| truA protein [Listeria monocytogenes FSL J2-071]
 gi|290558377|gb|EFD91894.1| truA protein [Listeria monocytogenes FSL J2-071]
          Length = 248

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V V  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMNKGKTVRVTASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|283832251|ref|ZP_06351992.1| tRNA pseudouridine synthase A [Citrobacter youngae ATCC 29220]
 gi|291071892|gb|EFE10001.1| tRNA pseudouridine synthase A [Citrobacter youngae ATCC 29220]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E V V  AGRTD+GVH   QV
Sbjct: 10  HKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPVSVFCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   + 
Sbjct: 70  VHFETHAVRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V  FG
Sbjct: 128 RPAVLGKGVTHYYEPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHINVERFG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            +V+Y
Sbjct: 248 VAVDY 252


>gi|46908770|ref|YP_015159.1| tRNA pseudouridine synthase A [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47093538|ref|ZP_00231299.1| tRNA pseudouridine synthase A [Listeria monocytogenes str. 4b
           H7858]
 gi|226225144|ref|YP_002759251.1| pseudouridylate synthase I [Listeria monocytogenes Clip81459]
 gi|254825041|ref|ZP_05230042.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL J1-194]
 gi|254992719|ref|ZP_05274909.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL J2-064]
 gi|255520577|ref|ZP_05387814.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL J1-175]
 gi|51316671|sp|Q71WI0|TRUA_LISMF RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|259550404|sp|C1KZ13|TRUA_LISMC RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|46882043|gb|AAT05336.1| tRNA pseudouridine synthase A [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018098|gb|EAL08870.1| tRNA pseudouridine synthase A [Listeria monocytogenes str. 4b
           H7858]
 gi|225877606|emb|CAS06320.1| Putative pseudouridylate synthase I [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|293594283|gb|EFG02044.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL J1-194]
 gi|328468084|gb|EGF39090.1| tRNA pseudouridine synthase A [Listeria monocytogenes 1816]
          Length = 248

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/249 (34%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ +AL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISEALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|319939850|ref|ZP_08014205.1| tRNA pseudouridine synthase A [Streptococcus anginosus 1_2_62CV]
 gi|319810861|gb|EFW07180.1| tRNA pseudouridine synthase A [Streptococcus anginosus 1_2_62CV]
          Length = 249

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 84/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G  + G+QRQ +  S+Q  IEK +  +  G+ V+VHGAGRTDSGVHAL 
Sbjct: 1   MTRYKAIISYDGHDFAGFQRQPHARSVQEEIEKTLTKINRGKPVIVHGAGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++     L  AL+   +  + I  +++  V++ FH+R+    + Y + +   
Sbjct: 61  QVIHFDLPQKRDEEKLRFALDT--QTPEDIDFISVEEVNEDFHSRYWKHSKIYEFIVDVG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID--HFDV 177
           +    + +  A   P  LD   ++ A   L G HDFT F +      + +RTI     D 
Sbjct: 119 RPKNPMMRHYATHFPYPLDISLIKNAIAKLEGTHDFTGFTASGTSVENKVRTITEARLDF 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +   N +        FL+ QIR+ VG+L  +G+G+     +++ L  ++R   GP A P 
Sbjct: 179 DEKRNFLIFTFSGNGFLYKQIRNMVGTLLKIGNGRMPVEQIDRILTEKNRHLAGPTAAPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|163867374|ref|YP_001608568.1| tRNA pseudouridine synthase A [Bartonella tribocorum CIP 105476]
 gi|189029992|sp|A9ILJ7|TRUA_BART1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|161017015|emb|CAK00573.1| tRNA pseudouridine synthase A [Bartonella tribocorum CIP 105476]
          Length = 247

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 129/247 (52%), Positives = 163/247 (65%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQ    +IQG++E+AIF  +G+ + +  AGRTD+GVHA  Q
Sbjct: 1   MSRFKLTLEYDGSNYAGWQRQAKLHTIQGALEQAIFRFSGQQLTITTAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIV-DKQFHARFSAIRRSYLYRIITR 119
           VAH D ++ W P  +  ALNA L+       +         F ARFSAI+R YL++I+ R
Sbjct: 61  VAHVDFIKNWPPHTVRDALNALLRQQSEAISILNVENVPDDFDARFSAIKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W IPK L+ + M  AAQ LVG+HDFTTFRS HCQA SPIRT++  D+  
Sbjct: 121 RSPPALNAKRVWWIPKPLNAQAMHEAAQKLVGQHDFTTFRSAHCQAKSPIRTLERLDIQK 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I I   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A+DRK CG +APP GL
Sbjct: 181 EGEEIFIYAKARSFLHHQIRSFAGSLMEVGIGRWTAQDLEAALHAKDRKRCGVVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   VEY
Sbjct: 241 YLTKVEY 247


>gi|91211615|ref|YP_541601.1| tRNA pseudouridine synthase A [Escherichia coli UTI89]
 gi|110642522|ref|YP_670252.1| tRNA pseudouridine synthase A [Escherichia coli 536]
 gi|117624508|ref|YP_853421.1| tRNA pseudouridine synthase A [Escherichia coli APEC O1]
 gi|157155365|ref|YP_001463662.1| tRNA pseudouridine synthase A [Escherichia coli E24377A]
 gi|191170294|ref|ZP_03031848.1| tRNA pseudouridine synthase A [Escherichia coli F11]
 gi|215487531|ref|YP_002329962.1| tRNA pseudouridine synthase A [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218559231|ref|YP_002392144.1| tRNA pseudouridine synthase A [Escherichia coli S88]
 gi|218690478|ref|YP_002398690.1| tRNA pseudouridine synthase A [Escherichia coli ED1a]
 gi|237704797|ref|ZP_04535278.1| tRNA pseudouridylate synthase I [Escherichia sp. 3_2_53FAA]
 gi|300928489|ref|ZP_07144015.1| tRNA pseudouridine synthase A [Escherichia coli MS 187-1]
 gi|300986858|ref|ZP_07177840.1| tRNA pseudouridine synthase A [Escherichia coli MS 200-1]
 gi|306814570|ref|ZP_07448732.1| tRNA pseudouridine synthase A [Escherichia coli NC101]
 gi|312967618|ref|ZP_07781833.1| tRNA pseudouridine synthase A [Escherichia coli 2362-75]
 gi|331647974|ref|ZP_08349066.1| tRNA pseudouridine synthase A [Escherichia coli M605]
 gi|331658401|ref|ZP_08359363.1| tRNA pseudouridine synthase A [Escherichia coli TA206]
 gi|331683990|ref|ZP_08384586.1| tRNA pseudouridine synthase A [Escherichia coli H299]
 gi|123049014|sp|Q0TFC8|TRUA_ECOL5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|123084414|sp|Q1R994|TRUA_ECOUT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166228696|sp|A1ADG7|TRUA_ECOK1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166991161|sp|A7ZPD3|TRUA_ECO24 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708650|sp|B7MG82|TRUA_ECO45 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254789634|sp|B7UFX6|TRUA_ECO27 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254789636|sp|B7MXZ5|TRUA_ECO81 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|91073189|gb|ABE08070.1| tRNA pseudouridylate synthase I [Escherichia coli UTI89]
 gi|110344114|gb|ABG70351.1| tRNA pseudouridine synthase A [Escherichia coli 536]
 gi|115513632|gb|ABJ01707.1| tRNA pseudouridine synthase A [Escherichia coli APEC O1]
 gi|157077395|gb|ABV17103.1| tRNA pseudouridine synthase A [Escherichia coli E24377A]
 gi|190909810|gb|EDV69395.1| tRNA pseudouridine synthase A [Escherichia coli F11]
 gi|215265603|emb|CAS10006.1| pseudouridylate synthase I [Escherichia coli O127:H6 str. E2348/69]
 gi|218366000|emb|CAR03744.1| pseudouridylate synthase I [Escherichia coli S88]
 gi|218428042|emb|CAR08961.2| pseudouridylate synthase I [Escherichia coli ED1a]
 gi|226901163|gb|EEH87422.1| tRNA pseudouridylate synthase I [Escherichia sp. 3_2_53FAA]
 gi|281179405|dbj|BAI55735.1| tRNA pseudouridine synthase A [Escherichia coli SE15]
 gi|294491901|gb|ADE90657.1| tRNA pseudouridine synthase A [Escherichia coli IHE3034]
 gi|300306347|gb|EFJ60867.1| tRNA pseudouridine synthase A [Escherichia coli MS 200-1]
 gi|300463484|gb|EFK26977.1| tRNA pseudouridine synthase A [Escherichia coli MS 187-1]
 gi|305851964|gb|EFM52416.1| tRNA pseudouridine synthase A [Escherichia coli NC101]
 gi|307626145|gb|ADN70449.1| tRNA pseudouridine synthase A [Escherichia coli UM146]
 gi|312287815|gb|EFR15720.1| tRNA pseudouridine synthase A [Escherichia coli 2362-75]
 gi|315288292|gb|EFU47691.1| tRNA pseudouridine synthase A [Escherichia coli MS 110-3]
 gi|315298147|gb|EFU57411.1| tRNA pseudouridine synthase A [Escherichia coli MS 16-3]
 gi|320196186|gb|EFW70810.1| tRNA pseudouridine synthase A [Escherichia coli WV_060327]
 gi|323187957|gb|EFZ73252.1| tRNA pseudouridine synthase A [Escherichia coli RN587/1]
 gi|323952111|gb|EGB47985.1| tRNA pseudouridine synthase A [Escherichia coli H252]
 gi|323955889|gb|EGB51643.1| tRNA pseudouridine synthase A [Escherichia coli H263]
 gi|324009238|gb|EGB78457.1| tRNA pseudouridine synthase A [Escherichia coli MS 57-2]
 gi|331043698|gb|EGI15836.1| tRNA pseudouridine synthase A [Escherichia coli M605]
 gi|331056649|gb|EGI28658.1| tRNA pseudouridine synthase A [Escherichia coli TA206]
 gi|331078942|gb|EGI50144.1| tRNA pseudouridine synthase A [Escherichia coli H299]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|325294776|ref|YP_004281290.1| tRNA pseudouridine synthase A [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065224|gb|ADY73231.1| tRNA pseudouridine synthase A [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 250

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 125/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY G+ YFGWQ      +IQG I K +  +    V + GA RTD+GVHA  Q
Sbjct: 1   MKNIKLTIEYLGTNYFGWQILPEKPTIQGEIIKVLERILQHPVKLTGASRTDAGVHAFGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F   +E     L  ALN  L     I I+++  V  +F +R  A  + Y YRI  R+
Sbjct: 61  VANFKTKKEIPLYKLQSALNGLL--PPDIKIISVEEVPLEFDSRRWAKGKRYRYRIFNRK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPI-RTIDHFDVNS 179
            P   E  R+W +P  LD   M  A + L+G  DFT+F            RT+D+ ++  
Sbjct: 119 VPSPFEYKRSWFVPYQLDISLMEKAKEFLIGTFDFTSFSKSDRNVDINPVRTVDNIEIVK 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I+     RSFL   +R  V +L  VG GK    D+++  + ++RK    LAPP+GL
Sbjct: 179 KESHIDFIFYGRSFLRHMVRIMVATLVEVGKGKLRPEDIKEIREKKNRKFAPFLAPPDGL 238

Query: 240 YFDSVEY 246
           Y + V Y
Sbjct: 239 YLEKVYY 245


>gi|320174675|gb|EFW49808.1| tRNA pseudouridine synthase A [Shigella dysenteriae CDC 74-1112]
          Length = 270

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTVPRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|114562572|ref|YP_750085.1| tRNA pseudouridine synthase A [Shewanella frigidimarina NCIMB 400]
 gi|122300225|sp|Q084R8|TRUA_SHEFN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|114333865|gb|ABI71247.1| tRNA pseudouridine synthase A [Shewanella frigidimarina NCIMB 400]
          Length = 261

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 124/245 (50%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS + GWQRQ    S+Q  IEKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 1   MRVALGIEYDGSSFCGWQRQLEVDSVQAQIEKALSYVANEPITVSCAGRTDTGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       + +NA L  S  I       VD  FHAR+SA  R Y Y I   + 
Sbjct: 61  VHFDTDVQRPMTAWTQGVNANLPDSVAIRW--AKEVDDSFHARYSATARRYRYVIYNHKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           +D   M  AAQ  VG HDFT+FR++HCQ+ +P R +   +V   G
Sbjct: 119 RPGILSAGVSHYHGDIDETLMHKAAQLFVGEHDFTSFRALHCQSKTPFRNVHQVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G      + +    ++RK   P A P GLY 
Sbjct: 179 MYVMVDIQANAFLHHMVRNIVGSLLQIGLGNQPIEWITELFALKNRKLAAPTAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|16273533|ref|NP_439786.1| tRNA pseudouridine synthase A [Haemophilus influenzae Rd KW20]
 gi|260580419|ref|ZP_05848248.1| tRNA pseudouridine synthase A [Haemophilus influenzae RdAW]
 gi|1174804|sp|P45291|TRUA_HAEIN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|1574492|gb|AAC23291.1| pseudouridylate synthase I (truA) [Haemophilus influenzae Rd KW20]
 gi|260093096|gb|EEW77030.1| tRNA pseudouridine synthase A [Haemophilus influenzae RdAW]
          Length = 269

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGTGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|193068139|ref|ZP_03049103.1| tRNA pseudouridine synthase A [Escherichia coli E110019]
 gi|192958418|gb|EDV88857.1| tRNA pseudouridine synthase A [Escherichia coli E110019]
          Length = 270

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPDSWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|51474025|ref|YP_067782.1| tRNA pseudouridine synthase A [Rickettsia typhi str. Wilmington]
 gi|62901283|sp|Q68VQ6|TRUA_RICTY RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|51460337|gb|AAU04300.1| Pseudouridine synthase [Rickettsia typhi str. Wilmington]
          Length = 245

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 108/246 (43%), Positives = 150/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+ + GWQRQ    S+Q  +E+AI+  +GE V + G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTHFSGWQRQAGVLSVQQILEEAIYKFSGEQVTLFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +AHFDL +   P  + KA+N +      + + N  +V   FHARFSA  R Y+YRI+ R 
Sbjct: 61  IAHFDLSKYLEPYKIIKAINYF-VRPYAVGVWNCELVSNNFHARFSATSRHYIYRIVNRT 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  R W I   LD   M+ AA +L+G+HDFT+FRS  CQ+ SPI+T+   ++   
Sbjct: 120 YPSVIDLNRVWWISAPLDVLAMQQAATYLLGKHDFTSFRSSSCQSKSPIKTLTEINIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W    ++  L A+DRK  GP AP  GLY
Sbjct: 180 YEEIKLYLSAPSFLHYMVRNIVGSLVLVGKNIWQVEQIKNVLDAKDRKVAGPTAPAFGLY 239

Query: 241 FDSVEY 246
           F   EY
Sbjct: 240 FIKAEY 245


>gi|330820903|ref|YP_004349765.1| Pseudouridylate synthase [Burkholderia gladioli BSR3]
 gi|327372898|gb|AEA64253.1| Pseudouridylate synthase [Burkholderia gladioli BSR3]
          Length = 277

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 84/245 (34%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q  +E+A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQSQPHGKTVQDELERALKAFALVPLQTVVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L    T+++     +   FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTDLDRSDFSWVRGTNAFL--PSTVAVQWAKPMPDSFHARFAAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +   RA  +   LD E MR AA+HL+G HDF++FRS  CQ+ +P++ +   D+ + G
Sbjct: 119 RSPMLASRAGWVHTPLDIEAMREAARHLIGEHDFSSFRSSECQSKTPVKHLYQIDIRASG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ +  + + L A++R+   P   P+GLY 
Sbjct: 179 SFIHFRFRANAFLHHMVRNLMGCLIAVGRGRYPADWMAEVLAARNRERAAPTFAPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|289579109|ref|YP_003477736.1| tRNA pseudouridine synthase A [Thermoanaerobacter italicus Ab9]
 gi|289528822|gb|ADD03174.1| tRNA pseudouridine synthase A [Thermoanaerobacter italicus Ab9]
          Length = 240

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 137/241 (56%), Gaps = 2/241 (0%)

Query: 6   MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFD 65
           ++++Y+G+ Y GWQ QKN  ++Q  ++KAI  VTGE V + GA RTD+GVHAL QVA+F 
Sbjct: 2   IVVQYDGTNYHGWQLQKNAITVQEVLQKAIKKVTGEEVNLIGASRTDTGVHALYQVANFK 61

Query: 66  LVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLAL 125
              +     L  ALN+ L   D I I     V+  FHAR+SA R+ Y Y I+ R+  +  
Sbjct: 62  TNTKMPAEKLPYALNSVL--PDDIVITQAKDVEDSFHARYSAKRKRYKYIILNRKFRMPT 119

Query: 126 EKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIE 185
            +   W I   L+ E M+ AA +L+G HDF+ F++     +S IRT+    +    + I 
Sbjct: 120 MRNYCWHISYPLNVEKMKKAATYLIGTHDFSAFKASGSSKTSTIRTVYDLIIEKNEDFIN 179

Query: 186 IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVE 245
           I + A  FL+  +R  VG+L  VG GK    ++   L ++DR + G  APP+GLY   + 
Sbjct: 180 IEIEADGFLYNMVRIIVGTLSYVGLGKIGENEVYHILASKDRTKAGITAPPQGLYLIKII 239

Query: 246 Y 246
           Y
Sbjct: 240 Y 240


>gi|62901272|sp|Q65TC8|TRUA_MANSM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
          Length = 263

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 127/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  YFGWQRQ+   S+Q  +EKA+  V  E + V  AGRTDSGVH   QV
Sbjct: 1   MKIALGIEYNGKNYFGWQRQEKVHSVQAELEKALSFVANEKIEVFCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA L   D I++     V   FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAIRPEKAWAFGTNANL--PDDIAVRWAKEVPDDFHARFSATARRYRYVLYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD   M+ A + L+G +DF++FR+  CQ+++P R I H +V   G
Sbjct: 119 RSAILPYGITHTHLDLDEHKMQEAGRFLLGENDFSSFRAAQCQSNTPWRNIHHLNVIRRG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + + + A +F+H  +R+ VGSL  VG G      +E  L  ++RK   P A  EGLY 
Sbjct: 179 NFVIVDIKANAFVHHMVRNIVGSLMEVGCGNQPPEWIEWLLAQKNRKLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VQVTY 243


>gi|54309813|ref|YP_130833.1| tRNA pseudouridine synthase A [Photobacterium profundum SS9]
 gi|51316618|sp|Q6LNU5|TRUA_PHOPR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|46914251|emb|CAG21031.1| Putative tRNA pseudouridine synthase A [Photobacterium profundum
           SS9]
          Length = 261

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y GWQRQ +  S+Q  +EKA+  +  + + V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGAKYCGWQRQVDVDSVQERLEKALSHIANKPIAVFCAGRTDTGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+  +   V     +NA+L     IS+   + V   FHARFSA  R Y Y I     
Sbjct: 61  VHFDVDVDRQMVAWTIGVNAHL--PRDISVRWATQVSDDFHARFSATARRYRYIIYNSAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  AAQ+LVG HDFT+ R+  CQ+ SP R + H +V+  G
Sbjct: 119 RPAIFGVGVSHYHGHLDEKKMHEAAQYLVGEHDFTSVRASQCQSRSPWRAMKHVNVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I + A +F+H  +R+  GSL  VG G+ T   ++  L+ +DR+  G  A   GLY 
Sbjct: 179 DFVIIDIKANAFVHHMVRNIAGSLIRVGRGQETPEWMKWVLEQKDRRVAGETAKAAGLYL 238

Query: 242 DSVEY 246
            +V+Y
Sbjct: 239 VAVDY 243


>gi|320183774|gb|EFW58608.1| tRNA pseudouridine synthase A [Shigella flexneri CDC 796-83]
          Length = 270

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 91/244 (37%), Positives = 131/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L   D I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PDDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|220924613|ref|YP_002499915.1| tRNA pseudouridine synthase A [Methylobacterium nodulans ORS 2060]
 gi|254789641|sp|B8IFQ2|TRUA_METNO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|219949220|gb|ACL59612.1| tRNA pseudouridine synthase A [Methylobacterium nodulans ORS 2060]
          Length = 254

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 156/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G+ + GWQRQ    ++Q ++E+AI       V VH AGRTD+GVHA  Q
Sbjct: 1   MPRYKLVVEYDGTAFAGWQRQAADRTVQQALEEAIERFVNRPVRVHCAGRTDAGVHASHQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H DL REW    +  A NA+L+  + +S+L+ + V   F AR SA++R Y YRI+ R+
Sbjct: 61  VVHLDLDREWRTDTVRDATNAHLR-PEPVSVLSAARVGPDFDARHSALKRHYRYRILNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +P AL +G  W +P +LD   M  AAQ L+GRHDF+ FR+  CQASSP+RT+D  DV   
Sbjct: 120 SPPALARGYVWHVPWALDAAAMHAAAQTLLGRHDFSAFRAAECQASSPLRTLDQLDVERR 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I +   ARSFLH Q+R  VG+L L G G+  +  +   L ++DR  CGPLAP  GL 
Sbjct: 180 GDEILVATSARSFLHHQVRGMVGTLMLAGSGRLDTAGVRAVLDSRDRARCGPLAPAAGLT 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LTGVDY 245


>gi|89100313|ref|ZP_01173178.1| pseudouridylate synthase I [Bacillus sp. NRRL B-14911]
 gi|89084934|gb|EAR64070.1| pseudouridylate synthase I [Bacillus sp. NRRL B-14911]
          Length = 245

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 117/247 (47%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R+   I Y+GS + G+Q Q    ++Q  +E+A+  +  G  V +  +GRTD+GVHA  
Sbjct: 1   MQRFKCKIAYDGSQFSGYQVQPGKRTVQLEVERALAKIHKGNPVKIFASGRTDAGVHARG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN+ L     I++ +     + FHARF A  + Y Y I   
Sbjct: 61  QVIHFDSPLAIPEDRWVTALNSLL--PKDIAVESTEKAAEGFHARFDACGKEYRYFIYRG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +     E+  ++  P  LD   MR AA+HL+G HDF++F +        +R I    V  
Sbjct: 119 KIRSPFERHYSYHYPHPLDIRAMREAAEHLLGTHDFSSFCASRTDVEDKVREIRKVHVEE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G ++E+      FL+  +R   G+L   G G        + +  +DR   G  AP EGL
Sbjct: 179 AGEMLELHFTGSGFLYNMVRILTGTLLEAGAGTRDPGSFPEVISGRDRSLAGKTAPAEGL 238

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 239 YLWKVFY 245


>gi|324015393|gb|EGB84612.1| tRNA pseudouridine synthase A [Escherichia coli MS 60-1]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSRYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A          + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAGLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|300897000|ref|ZP_07115479.1| tRNA pseudouridine synthase A [Escherichia coli MS 198-1]
 gi|300359181|gb|EFJ75051.1| tRNA pseudouridine synthase A [Escherichia coli MS 198-1]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|157144741|ref|YP_001452060.1| tRNA pseudouridine synthase A [Citrobacter koseri ATCC BAA-895]
 gi|166228694|sp|A8ADR1|TRUA_CITK8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157081946|gb|ABV11624.1| hypothetical protein CKO_00468 [Citrobacter koseri ATCC BAA-895]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 91/244 (37%), Positives = 131/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E V V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPVNVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V + FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKAVPEDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAILGHGVTHFYEPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHINVTRHGA 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR+     A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRRLSAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|309973317|gb|ADO96518.1| tRNA pseudouridine synthase A [Haemophilus influenzae R2846]
          Length = 269

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSAI R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSAIARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L G HDF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLFGEHDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 QYIIVDIQANAFVHHMVRNIVGSLIEVGAGNKPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|161502487|ref|YP_001569599.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189030140|sp|A9MJ57|TRUA_SALAR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|160863834|gb|ABX20457.1| hypothetical protein SARI_00531 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 92/244 (37%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPINVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+       V     +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDVAWTLGVNANL--PGDIAVRWVKAVADDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         K LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H  V   G 
Sbjct: 129 PAVLAKGVTHYYKPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHISVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|91792843|ref|YP_562494.1| tRNA pseudouridine synthase A [Shewanella denitrificans OS217]
 gi|123061034|sp|Q12P55|TRUA_SHEDO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|91714845|gb|ABE54771.1| tRNA pseudouridine synthase A [Shewanella denitrificans OS217]
          Length = 261

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS Y GWQRQ    S+Q  +EKA+ L+  E + V  AGRTD+GVH   QV
Sbjct: 1   MRVALGIEYDGSSYCGWQRQVEVDSVQAQLEKALSLIANEPIEVVCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L   DTI++  + +VD  FHARFSA  R Y Y I   + 
Sbjct: 61  VHFDTTVIRPDSAWTLGVNANL--PDTIAVRWVKLVDDSFHARFSATARRYRYVIYNHKF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L +         +D   M  AAQ L+G HDFT+FR++ CQ+ SP R++   +V   G
Sbjct: 119 RPGLLRHGLSHYHGDIDETLMHQAAQQLLGEHDFTSFRAMQCQSKSPFRSVHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VGSL  +G G      + K +  +DR++    A P GLY 
Sbjct: 179 MYIMVDIKANAFLHHMVRNIVGSLLEIGLGNQPLNWISKLIAVKDRRQAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|329890848|ref|ZP_08269191.1| tRNA pseudouridine synthase A [Brevundimonas diminuta ATCC 11568]
 gi|328846149|gb|EGF95713.1| tRNA pseudouridine synthase A [Brevundimonas diminuta ATCC 11568]
          Length = 249

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 116/246 (47%), Positives = 156/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY   +EY+GS Y G+Q Q    ++QG+IE AI   +G+ V +  AGRTD+GVHA  Q
Sbjct: 1   MPRYRFTVEYDGSAYNGFQAQLGQPTVQGAIETAITAFSGQAVRIAAAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
             H DL R+W    +  ALNA+L   + +++L+ + V   +HARF+A  R YLYRI+ R 
Sbjct: 61  TCHVDLERDWPAQTVMNALNAHLV-KEAVAVLDCTPVSDDWHARFTANGRKYLYRILNRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL++GR W + K LD E M  AAQ L+G HDFTTFR   CQ++SPI+T+D   V+  
Sbjct: 120 GRPALDRGRVWHVRKPLDAEAMHAAAQALIGLHDFTTFRDAACQSASPIKTLDVARVSRV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + +   ARSFLH Q+RS  GS+  VG G+W   DL  AL+A+DR  CGP+AP +GLY
Sbjct: 180 GEEVHLVFEARSFLHRQVRSMAGSIAEVGLGRWRPADLADALEARDRARCGPVAPSDGLY 239

Query: 241 FDSVEY 246
              V Y
Sbjct: 240 LTGVTY 245


>gi|255025629|ref|ZP_05297615.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL J2-003]
          Length = 248

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|219853559|ref|YP_002470681.1| hypothetical protein CKR_0216 [Clostridium kluyveri NBRC 12016]
 gi|219567283|dbj|BAH05267.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 247

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
               ++IEY+G+ Y GWQRQ N  +IQ  +E+AI   TGE   V G+ RTD+GVHA   V
Sbjct: 5   KNIKLVIEYDGTNYSGWQRQYNAITIQQRLEEAIEKATGEFSPVIGSSRTDAGVHARGFV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            +F    +     +   LN  L   + I++L+   VD  FH+R+    + Y Y I+T   
Sbjct: 65  CNFFTASKIPTSNIKMVLNTLL--PEDIAVLDSKEVDSSFHSRYFTTGKEYSYTIVTGDR 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P  + +   +   + LD E ++ + ++ +G HDF+ F+     A S IRTI    V    
Sbjct: 123 PPVIGRQYVYYFRRKLDIEKIKNSCEYFIGTHDFSAFKKKGSTARSSIRTIKELTVLKEK 182

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N+I+  +V   FL+  +R  +G+L  VG G+++   ++  L+++DR + G   P +GL  
Sbjct: 183 NIIKFNIVGDGFLYNMVRIIIGTLLEVGLGRFSIEYVKYILESKDRAKAGKPVPAKGLCL 242

Query: 242 DSVEY 246
           + V Y
Sbjct: 243 EKVFY 247


>gi|153008677|ref|YP_001369892.1| tRNA pseudouridine synthase A [Ochrobactrum anthropi ATCC 49188]
 gi|166228741|sp|A6WYK9|TRUA_OCHA4 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|151560565|gb|ABS14063.1| tRNA pseudouridine synthase A [Ochrobactrum anthropi ATCC 49188]
          Length = 251

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 128/248 (51%), Positives = 170/248 (68%), Gaps = 1/248 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ Y GWQRQ+NG ++Q +IE A     GE + +  AGRTD+GVHA  Q
Sbjct: 1   MPRYKLTVEYDGTPYVGWQRQENGHAVQNAIELAFKKFCGEDLTLSAAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKI-SDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V H DL ++W    +  A+NA+L +  + +SILN+      F ARFSA  R YLYRI  R
Sbjct: 61  VVHVDLTKDWGAGKVRDAVNAHLVMADERVSILNVERTTDTFDARFSARARHYLYRIHNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +APLA++  RAW + K LD E M  AA+ L+G HDFTTFR+  CQA SP++T+D  DV  
Sbjct: 121 RAPLAVDYQRAWWVQKRLDAEAMHEAAKRLLGEHDFTTFRATQCQAKSPVKTLDRLDVIR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ +E+RV ARSFLH Q+RSF GSL  VG G+WT+ DL+ AL+A+DRK CG +APP GL
Sbjct: 181 NGDYVEMRVSARSFLHNQVRSFAGSLMEVGVGRWTADDLQAALEAKDRKACGQVAPPYGL 240

Query: 240 YFDSVEYS 247
           Y   V+Y+
Sbjct: 241 YLIGVDYA 248


>gi|15802865|ref|NP_288892.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 EDL933]
 gi|15832456|ref|NP_311229.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. Sakai]
 gi|26248707|ref|NP_754747.1| tRNA pseudouridine synthase A [Escherichia coli CFT073]
 gi|82777729|ref|YP_404078.1| tRNA pseudouridine synthase A [Shigella dysenteriae Sd197]
 gi|168748172|ref|ZP_02773194.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4113]
 gi|168755075|ref|ZP_02780082.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761239|ref|ZP_02786246.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767949|ref|ZP_02792956.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4486]
 gi|168772951|ref|ZP_02797958.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4196]
 gi|168780178|ref|ZP_02805185.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4076]
 gi|168787230|ref|ZP_02812237.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. EC869]
 gi|168798493|ref|ZP_02823500.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. EC508]
 gi|170680088|ref|YP_001744518.1| tRNA pseudouridine synthase A [Escherichia coli SMS-3-5]
 gi|195935697|ref|ZP_03081079.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807895|ref|ZP_03250232.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4206]
 gi|208811862|ref|ZP_03253191.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821544|ref|ZP_03261864.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397276|ref|YP_002271727.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4115]
 gi|217327172|ref|ZP_03443255.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           TW14588]
 gi|218695917|ref|YP_002403584.1| tRNA pseudouridine synthase A [Escherichia coli 55989]
 gi|218700794|ref|YP_002408423.1| tRNA pseudouridine synthase A [Escherichia coli IAI39]
 gi|218705848|ref|YP_002413367.1| tRNA pseudouridine synthase A [Escherichia coli UMN026]
 gi|227887378|ref|ZP_04005183.1| tRNA pseudouridine synthase A [Escherichia coli 83972]
 gi|254794211|ref|YP_003079048.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           TW14359]
 gi|261223227|ref|ZP_05937508.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259223|ref|ZP_05951756.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283559|ref|YP_003500377.1| tRNA pseudouridine synthase A [Escherichia coli O55:H7 str. CB9615]
 gi|293405784|ref|ZP_06649776.1| tRNA pseudouridine synthase A [Escherichia coli FVEC1412]
 gi|293410675|ref|ZP_06654251.1| tRNA pseudouridine synthase A [Escherichia coli B354]
 gi|293415611|ref|ZP_06658254.1| tRNA pseudouridine synthase A [Escherichia coli B185]
 gi|293446655|ref|ZP_06663077.1| tRNA pseudouridine synthase A [Escherichia coli B088]
 gi|298381467|ref|ZP_06991066.1| tRNA pseudouridine synthase A [Escherichia coli FVEC1302]
 gi|300822193|ref|ZP_07102335.1| tRNA pseudouridine synthase A [Escherichia coli MS 119-7]
 gi|300936897|ref|ZP_07151784.1| tRNA pseudouridine synthase A [Escherichia coli MS 21-1]
 gi|300983542|ref|ZP_07176636.1| tRNA pseudouridine synthase A [Escherichia coli MS 45-1]
 gi|301024150|ref|ZP_07187860.1| tRNA pseudouridine synthase A [Escherichia coli MS 69-1]
 gi|301049077|ref|ZP_07196061.1| tRNA pseudouridine synthase A [Escherichia coli MS 185-1]
 gi|301303220|ref|ZP_07209345.1| tRNA pseudouridine synthase A [Escherichia coli MS 124-1]
 gi|307311121|ref|ZP_07590765.1| tRNA pseudouridine synthase A [Escherichia coli W]
 gi|309784972|ref|ZP_07679605.1| tRNA pseudouridine synthase A [Shigella dysenteriae 1617]
 gi|309793201|ref|ZP_07687629.1| tRNA pseudouridine synthase A [Escherichia coli MS 145-7]
 gi|331663835|ref|ZP_08364745.1| tRNA pseudouridine synthase A [Escherichia coli TA143]
 gi|331669017|ref|ZP_08369865.1| tRNA pseudouridine synthase A [Escherichia coli TA271]
 gi|331673820|ref|ZP_08374583.1| tRNA pseudouridine synthase A [Escherichia coli TA280]
 gi|331678264|ref|ZP_08378939.1| tRNA pseudouridine synthase A [Escherichia coli H591]
 gi|54039780|sp|P65845|TRUA_ECO57 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|54042085|sp|P65844|TRUA_ECOL6 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|123755724|sp|Q32DL8|TRUA_SHIDS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708651|sp|B7NNZ9|TRUA_ECO7I RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708653|sp|B7N5T0|TRUA_ECOLU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708654|sp|B1LLS3|TRUA_ECOSM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238057729|sp|B5YXV8|TRUA_ECO5E RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254789635|sp|B7LBH2|TRUA_ECO55 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|12516677|gb|AAG57447.1|AE005463_10 pseudouridylate synthase I [Escherichia coli O157:H7 str. EDL933]
 gi|26109112|gb|AAN81315.1|AE016763_274 tRNA pseudouridine synthase A [Escherichia coli CFT073]
 gi|13362672|dbj|BAB36625.1| pseudouridylate synthase I [Escherichia coli O157:H7 str. Sakai]
 gi|81241877|gb|ABB62587.1| pseudouridylate synthase I [Shigella dysenteriae Sd197]
 gi|170517806|gb|ACB15984.1| tRNA pseudouridine synthase A [Escherichia coli SMS-3-5]
 gi|187771144|gb|EDU34988.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017261|gb|EDU55383.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001906|gb|EDU70892.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4076]
 gi|189357607|gb|EDU76026.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362830|gb|EDU81249.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368293|gb|EDU86709.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372810|gb|EDU91226.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. EC869]
 gi|189378874|gb|EDU97290.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. EC508]
 gi|208727696|gb|EDZ77297.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733139|gb|EDZ81826.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741667|gb|EDZ89349.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158676|gb|ACI36109.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC4115]
 gi|209764788|gb|ACI80706.1| pseudouridylate synthase I [Escherichia coli]
 gi|209764790|gb|ACI80707.1| pseudouridylate synthase I [Escherichia coli]
 gi|209764792|gb|ACI80708.1| pseudouridylate synthase I [Escherichia coli]
 gi|209764796|gb|ACI80710.1| pseudouridylate synthase I [Escherichia coli]
 gi|217319539|gb|EEC27964.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352649|emb|CAU98430.1| pseudouridylate synthase I [Escherichia coli 55989]
 gi|218370780|emb|CAR18593.1| pseudouridylate synthase I [Escherichia coli IAI39]
 gi|218432945|emb|CAR13839.1| pseudouridylate synthase I [Escherichia coli UMN026]
 gi|222034074|emb|CAP76815.1| tRNA pseudouridine synthase A [Escherichia coli LF82]
 gi|227835728|gb|EEJ46194.1| tRNA pseudouridine synthase A [Escherichia coli 83972]
 gi|254593611|gb|ACT72972.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           TW14359]
 gi|284922306|emb|CBG35391.1| tRNA pseudouridine synthase A [Escherichia coli 042]
 gi|290763432|gb|ADD57393.1| tRNA pseudouridine synthase A [Escherichia coli O55:H7 str. CB9615]
 gi|291323485|gb|EFE62913.1| tRNA pseudouridine synthase A [Escherichia coli B088]
 gi|291427992|gb|EFF01019.1| tRNA pseudouridine synthase A [Escherichia coli FVEC1412]
 gi|291433259|gb|EFF06238.1| tRNA pseudouridine synthase A [Escherichia coli B185]
 gi|291471143|gb|EFF13627.1| tRNA pseudouridine synthase A [Escherichia coli B354]
 gi|298278909|gb|EFI20423.1| tRNA pseudouridine synthase A [Escherichia coli FVEC1302]
 gi|300299124|gb|EFJ55509.1| tRNA pseudouridine synthase A [Escherichia coli MS 185-1]
 gi|300396694|gb|EFJ80232.1| tRNA pseudouridine synthase A [Escherichia coli MS 69-1]
 gi|300408504|gb|EFJ92042.1| tRNA pseudouridine synthase A [Escherichia coli MS 45-1]
 gi|300458008|gb|EFK21501.1| tRNA pseudouridine synthase A [Escherichia coli MS 21-1]
 gi|300525323|gb|EFK46392.1| tRNA pseudouridine synthase A [Escherichia coli MS 119-7]
 gi|300841394|gb|EFK69154.1| tRNA pseudouridine synthase A [Escherichia coli MS 124-1]
 gi|306908627|gb|EFN39124.1| tRNA pseudouridine synthase A [Escherichia coli W]
 gi|307554380|gb|ADN47155.1| tRNA pseudouridine synthase A [Escherichia coli ABU 83972]
 gi|308123487|gb|EFO60749.1| tRNA pseudouridine synthase A [Escherichia coli MS 145-7]
 gi|308927342|gb|EFP72816.1| tRNA pseudouridine synthase A [Shigella dysenteriae 1617]
 gi|312946937|gb|ADR27764.1| tRNA pseudouridine synthase A [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315061611|gb|ADT75938.1| pseudouridylate synthase I [Escherichia coli W]
 gi|315255255|gb|EFU35223.1| tRNA pseudouridine synthase A [Escherichia coli MS 85-1]
 gi|315292275|gb|EFU51627.1| tRNA pseudouridine synthase A [Escherichia coli MS 153-1]
 gi|320192058|gb|EFW66703.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           EC1212]
 gi|320641146|gb|EFX10625.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. G5101]
 gi|320646361|gb|EFX15284.1| tRNA pseudouridine synthase A [Escherichia coli O157:H- str.
           493-89]
 gi|320651631|gb|EFX20011.1| tRNA pseudouridine synthase A [Escherichia coli O157:H- str. H
           2687]
 gi|320657383|gb|EFX25185.1| tRNA pseudouridine synthase A [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320662918|gb|EFX30242.1| tRNA pseudouridine synthase A [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667662|gb|EFX34573.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323184362|gb|EFZ69738.1| tRNA pseudouridine synthase A [Escherichia coli 1357]
 gi|323377808|gb|ADX50076.1| tRNA pseudouridine synthase A [Escherichia coli KO11]
 gi|323944831|gb|EGB40897.1| tRNA pseudouridine synthase A [Escherichia coli H120]
 gi|326339671|gb|EGD63482.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. 1125]
 gi|326344133|gb|EGD67894.1| tRNA pseudouridine synthase A [Escherichia coli O157:H7 str. 1044]
 gi|331059634|gb|EGI31611.1| tRNA pseudouridine synthase A [Escherichia coli TA143]
 gi|331064211|gb|EGI36122.1| tRNA pseudouridine synthase A [Escherichia coli TA271]
 gi|331069093|gb|EGI40485.1| tRNA pseudouridine synthase A [Escherichia coli TA280]
 gi|331074724|gb|EGI46044.1| tRNA pseudouridine synthase A [Escherichia coli H591]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|116873964|ref|YP_850745.1| tRNA pseudouridine synthase A [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123466636|sp|A0ALT4|TRUA_LISW6 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|116742842|emb|CAK21966.1| tRNA pseudouridine synthase A [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 248

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/249 (34%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQIQPNARTVQAEIEKALKKMHKGKNVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +      FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSDLDITADKFQKAL--QVMTPFDISFLTVDEAPADFHARFGTVGKEYRYIVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDIAKMKLASECLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
                  I      FL+  +R   G+L   G G+ +S D+ +AL A+DR++     APP+
Sbjct: 179 EDEETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISSEDITEALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|260582150|ref|ZP_05849944.1| tRNA pseudouridine synthase A [Haemophilus influenzae NT127]
 gi|260094782|gb|EEW78676.1| tRNA pseudouridine synthase A [Haemophilus influenzae NT127]
          Length = 269

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRQEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|319776538|ref|YP_004139026.1| tRNA pseudouridine synthase A [Haemophilus influenzae F3047]
 gi|329124048|ref|ZP_08252595.1| tRNA pseudouridine synthase A [Haemophilus aegyptius ATCC 11116]
 gi|317451129|emb|CBY87362.1| tRNA pseudouridine synthase A [Haemophilus influenzae F3047]
 gi|327467473|gb|EGF12971.1| tRNA pseudouridine synthase A [Haemophilus aegyptius ATCC 11116]
          Length = 269

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHRAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|326792573|ref|YP_004310394.1| tRNA pseudouridine synthase A [Clostridium lentocellum DSM 5427]
 gi|326543337|gb|ADZ85196.1| tRNA pseudouridine synthase A [Clostridium lentocellum DSM 5427]
          Length = 245

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 132/247 (53%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ +I+ Y+G+ Y G+ +Q N ++IQG+++ AI  +    V   GAGRTD GVHA  Q
Sbjct: 1   MKRFKLIVAYDGTNYNGFAKQPNATTIQGTLDVAIAKIVQHEVRTLGAGRTDRGVHAFAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
              FD   +     L KA+N+ L     IS+ ++  V + FH RF A R++Y Y+I+  +
Sbjct: 61  CCVFDSDTKIPADRLAKAINSQL--PADISVKSVEEVSEDFHPRFGAKRKTYRYQILNAK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                    A L P  LD E M+ AA  ++G HDF  F +        +R I   DV   
Sbjct: 119 IRDPFLYKYALLYPYELDVERMQEAANEMIGEHDFACFCAAGSTVKDTVRIIYSIDVKKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+L+ I V    FL+  +R  +G+L  V + K T   ++  +++++R+  GP  PP+GL 
Sbjct: 179 GDLVSIDVCGNGFLYNMVRIIIGTLLDVNENKITKDSIKTIIESKNRELAGPTVPPQGLT 238

Query: 241 FDSVEYS 247
             ++ Y+
Sbjct: 239 MLNIVYN 245


>gi|260869040|ref|YP_003235442.1| pseudouridylate synthase I [Escherichia coli O111:H- str. 11128]
 gi|257765396|dbj|BAI36891.1| pseudouridylate synthase I [Escherichia coli O111:H- str. 11128]
 gi|323176756|gb|EFZ62346.1| tRNA pseudouridine synthase A [Escherichia coli 1180]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVMRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|227114786|ref|ZP_03828442.1| tRNA pseudouridine synthase A [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 283

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 93/244 (38%), Positives = 133/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ + +S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 24  KIALGIEYDGSLYYGWQRQIDVASVQACLEKALSKVADEPIEVFCAGRTDAGVHGTGQVV 83

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF              +NA L     I++  +  VD+ FHARFSA  R Y Y I   +  
Sbjct: 84  HFTTHAIRKDAAWTMGVNANL--PPDIAVRWVKTVDEDFHARFSATARRYRYVIYNHRYR 141

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+           LD E M  A Q L+G +DFT+FR++ CQ+ +P R ++H  V   G+
Sbjct: 142 PAVLSRGMTHFYHPLDVERMERAGQCLLGENDFTSFRAVQCQSRTPWRYVNHLKVTRHGD 201

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            I + + A +F+H  +R+ VGSL  VG G    + + + L A+DR   G  A  EGLY  
Sbjct: 202 YIVVDIKANAFVHHMVRNIVGSLMDVGCGNRPESWIAELLAAKDRTLAGATARAEGLYLV 261

Query: 243 SVEY 246
           +V+Y
Sbjct: 262 AVDY 265


>gi|54294200|ref|YP_126615.1| tRNA pseudouridine synthase A [Legionella pneumophila str. Lens]
 gi|62901233|sp|Q5WX34|TRUA_LEGPL RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|53754032|emb|CAH15505.1| tRNA-pseudouridine synthase I [Legionella pneumophila str. Lens]
          Length = 262

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  +++EY+GS Y GWQ Q    +IQ ++E A+  V    + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALVVEYDGSQYHGWQAQTGLHTIQQAVEFALSKVADSSISVVCAGRTDTGVHATNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD  ++          N++L     I +     + + FHAR+SA+ R Y Y I     
Sbjct: 61  IHFDCEKDRSIRAWIHGANSFL--PKDICVKWGKEMPENFHARYSAVSRRYRYVIYNGAI 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L +G      + LD   M+   Q L+G +DFT+FRS+ CQ+++P+R I    V   G
Sbjct: 119 RPGLLRGNVTWQYRQLDHRLMQQGGQCLLGENDFTSFRSVECQSNTPMRNIHQLQVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           +L+ + + A +FLH  +R+  G L  VG GK     ++  L A+DRK     AP  GLY 
Sbjct: 179 DLVVLDITANAFLHHMVRNIAGVLIAVGSGKHPVGWVKDVLNAKDRKLGAETAPSYGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VQVTY 243


>gi|24113690|ref|NP_708200.1| tRNA pseudouridine synthase A [Shigella flexneri 2a str. 301]
 gi|30063744|ref|NP_837915.1| tRNA pseudouridine synthase A [Shigella flexneri 2a str. 2457T]
 gi|110806283|ref|YP_689803.1| tRNA pseudouridine synthase A [Shigella flexneri 5 str. 8401]
 gi|187733598|ref|YP_001881140.1| tRNA pseudouridine synthase A [Shigella boydii CDC 3083-94]
 gi|191168731|ref|ZP_03030509.1| tRNA pseudouridine synthase A [Escherichia coli B7A]
 gi|193062289|ref|ZP_03043384.1| tRNA pseudouridine synthase A [Escherichia coli E22]
 gi|194432876|ref|ZP_03065160.1| tRNA pseudouridine synthase A [Shigella dysenteriae 1012]
 gi|209919818|ref|YP_002293902.1| tRNA pseudouridine synthase A [Escherichia coli SE11]
 gi|218554873|ref|YP_002387786.1| tRNA pseudouridine synthase A [Escherichia coli IAI1]
 gi|256017524|ref|ZP_05431389.1| tRNA pseudouridine synthase A [Shigella sp. D9]
 gi|260844905|ref|YP_003222683.1| pseudouridylate synthase I [Escherichia coli O103:H2 str. 12009]
 gi|300818078|ref|ZP_07098290.1| tRNA pseudouridine synthase A [Escherichia coli MS 107-1]
 gi|300918510|ref|ZP_07135103.1| tRNA pseudouridine synthase A [Escherichia coli MS 115-1]
 gi|300924588|ref|ZP_07140550.1| tRNA pseudouridine synthase A [Escherichia coli MS 182-1]
 gi|301328823|ref|ZP_07221865.1| tRNA pseudouridine synthase A [Escherichia coli MS 78-1]
 gi|331653762|ref|ZP_08354763.1| tRNA pseudouridine synthase A [Escherichia coli M718]
 gi|332278531|ref|ZP_08390944.1| tRNA pseudouridine synthase A [Shigella sp. D9]
 gi|42559800|sp|Q83QR3|TRUA_SHIFL RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|122957319|sp|Q0T2G7|TRUA_SHIF8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708652|sp|B7M6J9|TRUA_ECO8A RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238057730|sp|B6I4U6|TRUA_ECOSE RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238691701|sp|B2TWA0|TRUA_SHIB3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|24052758|gb|AAN43907.1| pseudouridylate synthase I [Shigella flexneri 2a str. 301]
 gi|30041999|gb|AAP17725.1| pseudouridylate synthase I [Shigella flexneri 2a str. 2457T]
 gi|110615831|gb|ABF04498.1| pseudouridylate synthase I [Shigella flexneri 5 str. 8401]
 gi|187430590|gb|ACD09864.1| tRNA pseudouridine synthase A [Shigella boydii CDC 3083-94]
 gi|190901221|gb|EDV60992.1| tRNA pseudouridine synthase A [Escherichia coli B7A]
 gi|192931955|gb|EDV84554.1| tRNA pseudouridine synthase A [Escherichia coli E22]
 gi|194418864|gb|EDX34949.1| tRNA pseudouridine synthase A [Shigella dysenteriae 1012]
 gi|209913077|dbj|BAG78151.1| tRNA pseudouridine synthase A [Escherichia coli SE11]
 gi|218361641|emb|CAQ99237.1| pseudouridylate synthase I [Escherichia coli IAI1]
 gi|257760052|dbj|BAI31549.1| pseudouridylate synthase I [Escherichia coli O103:H2 str. 12009]
 gi|281601759|gb|ADA74743.1| tRNA pseudouridine synthase A [Shigella flexneri 2002017]
 gi|300414324|gb|EFJ97634.1| tRNA pseudouridine synthase A [Escherichia coli MS 115-1]
 gi|300419219|gb|EFK02530.1| tRNA pseudouridine synthase A [Escherichia coli MS 182-1]
 gi|300529222|gb|EFK50284.1| tRNA pseudouridine synthase A [Escherichia coli MS 107-1]
 gi|300844772|gb|EFK72532.1| tRNA pseudouridine synthase A [Escherichia coli MS 78-1]
 gi|313651142|gb|EFS15541.1| tRNA pseudouridine synthase A [Shigella flexneri 2a str. 2457T]
 gi|320178707|gb|EFW53670.1| tRNA pseudouridine synthase A [Shigella boydii ATCC 9905]
 gi|320199909|gb|EFW74498.1| tRNA pseudouridine synthase A [Escherichia coli EC4100B]
 gi|323172001|gb|EFZ57645.1| tRNA pseudouridine synthase A [Escherichia coli LT-68]
 gi|324020840|gb|EGB90059.1| tRNA pseudouridine synthase A [Escherichia coli MS 117-3]
 gi|324117804|gb|EGC11703.1| tRNA pseudouridine synthase A [Escherichia coli E1167]
 gi|331048611|gb|EGI20687.1| tRNA pseudouridine synthase A [Escherichia coli M718]
 gi|332088449|gb|EGI93567.1| tRNA pseudouridine synthase A [Shigella boydii 5216-82]
 gi|332090156|gb|EGI95255.1| tRNA pseudouridine synthase A [Shigella dysenteriae 155-74]
 gi|332100883|gb|EGJ04229.1| tRNA pseudouridine synthase A [Shigella sp. D9]
 gi|332754968|gb|EGJ85333.1| tRNA pseudouridine synthase A [Shigella flexneri 4343-70]
 gi|332755368|gb|EGJ85732.1| tRNA pseudouridine synthase A [Shigella flexneri K-671]
 gi|332756607|gb|EGJ86958.1| tRNA pseudouridine synthase A [Shigella flexneri 2747-71]
 gi|332766138|gb|EGJ96348.1| tRNA pseudouridine synthase A [Shigella flexneri 2930-71]
 gi|333001463|gb|EGK21031.1| tRNA pseudouridine synthase A [Shigella flexneri VA-6]
 gi|333001944|gb|EGK21510.1| tRNA pseudouridine synthase A [Shigella flexneri K-218]
 gi|333002687|gb|EGK22247.1| tRNA pseudouridine synthase A [Shigella flexneri K-272]
 gi|333016355|gb|EGK35686.1| tRNA pseudouridine synthase A [Shigella flexneri K-304]
 gi|333016571|gb|EGK35901.1| tRNA pseudouridine synthase A [Shigella flexneri K-227]
          Length = 270

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|217966203|ref|YP_002351881.1| tRNA pseudouridine synthase A [Listeria monocytogenes HCC23]
 gi|254789639|sp|B8DB42|TRUA_LISMH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|217335473|gb|ACK41267.1| tRNA pseudouridine synthase A [Listeria monocytogenes HCC23]
 gi|307572187|emb|CAR85366.1| tRNA pseudouridine synthase A [Listeria monocytogenes L99]
          Length = 248

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRDFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|229542172|ref|ZP_04431232.1| tRNA pseudouridine synthase A [Bacillus coagulans 36D1]
 gi|229326592|gb|EEN92267.1| tRNA pseudouridine synthase A [Bacillus coagulans 36D1]
          Length = 245

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 119/247 (48%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+GS + G+Q Q    ++Q  IEKA+  +  G  V    +GRTD+GVHA+ 
Sbjct: 1   MKRVKCTVSYDGSRFAGYQVQPGQRTVQQEIEKALATLHKGRHVKTAASGRTDAGVHAMG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN+ L     IS+   +  D  FHAR+S   + Y YRI   
Sbjct: 61  QVIHFDTDLSIPETSWPAALNSLL--PGDISVSKAAYADPAFHARYSVKEKEYRYRIYFS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                 +   A  +  SLD E M  AA+ ++G HDFT+F S   +    IRT+       
Sbjct: 119 HVRSPFKHRYALRVWYSLDIEAMEAAAETVLGTHDFTSFCSAKTEVEDKIRTLKEIRFLQ 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + + I      FL+  +R   G+L  +G GK    ++ + L+ ++R   G  APPEGL
Sbjct: 179 QDDELVICFKGNGFLYNMVRILTGTLLEIGSGKRDPGEMREILEKRNRIYAGKTAPPEGL 238

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 239 YLWKVSY 245


>gi|68249766|ref|YP_248878.1| tRNA pseudouridine synthase A [Haemophilus influenzae 86-028NP]
 gi|81335806|sp|Q4QL79|TRUA_HAEI8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|68057965|gb|AAX88218.1| tRNA pseudouridine synthase A [Haemophilus influenzae 86-028NP]
          Length = 269

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVAWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|83645231|ref|YP_433666.1| tRNA pseudouridine synthase A [Hahella chejuensis KCTC 2396]
 gi|83633274|gb|ABC29241.1| tRNA pseudouridine synthase A [Hahella chejuensis KCTC 2396]
          Length = 283

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 128/245 (52%), Gaps = 3/245 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           R  +++ Y+GS Y GWQ Q     S+Q  +E A+  V    V V  AGRTD+GVHA+ QV
Sbjct: 23  RVALVLGYDGSRYHGWQAQNSGVPSVQAEVESALAKVADHPVSVVCAGRTDAGVHAVNQV 82

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+      P      +N +L     +S+     V + FHAR++A  RSY Y I     
Sbjct: 83  VHFETKALRSPYSWAMGVNHFL--PADVSVSWAGAVPEDFHARYTATSRSYRYVIYNHPI 140

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A          + LD E+M  A  HL+G +DF+ FR   CQ+ SP R +   +V+ FG
Sbjct: 141 RPAWLNNSVTWNYRPLDVESMSAAGAHLIGENDFSAFRGSDCQSKSPFRNLTRLEVSRFG 200

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           +++ I V A +FLH  +R+  G+L  VG GK  S  +   L ++ R + G  APP GLY 
Sbjct: 201 DMVVIEVEANAFLHHMVRNISGTLMAVGTGKKPSDWVADVLASKKRSKAGVTAPPFGLYL 260

Query: 242 DSVEY 246
            SV Y
Sbjct: 261 TSVTY 265


>gi|16761293|ref|NP_456910.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29141011|ref|NP_804353.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412735|ref|YP_149810.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62180940|ref|YP_217357.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161612896|ref|YP_001586861.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167549625|ref|ZP_02343384.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168229744|ref|ZP_02654802.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168237394|ref|ZP_02662452.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168242494|ref|ZP_02667426.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168465920|ref|ZP_02699790.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168817894|ref|ZP_02829894.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443793|ref|YP_002041632.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450234|ref|YP_002046424.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194471784|ref|ZP_03077768.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194734499|ref|YP_002115439.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197248953|ref|YP_002147329.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197361669|ref|YP_002141305.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245997|ref|YP_002216441.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388490|ref|ZP_03215102.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204929209|ref|ZP_03220352.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205353481|ref|YP_002227282.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207857786|ref|YP_002244437.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213022210|ref|ZP_03336657.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213161334|ref|ZP_03347044.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213426977|ref|ZP_03359727.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213646800|ref|ZP_03376853.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852689|ref|ZP_03382221.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224583142|ref|YP_002636940.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912353|ref|ZP_04656190.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289827487|ref|ZP_06546099.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|24212558|sp|Q8Z500|TRUA_SALTI RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|62901206|sp|Q5PCV6|TRUA_SALPA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|81309634|sp|Q57LY6|TRUA_SALCH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|189030141|sp|A9N476|TRUA_SALPB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238689938|sp|B5BCH8|TRUA_SALPK RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238690009|sp|B5EZQ2|TRUA_SALA4 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238690247|sp|B4TBN7|TRUA_SALHS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238690344|sp|B5FPL2|TRUA_SALDC RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238690447|sp|B5R349|TRUA_SALEP RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238690504|sp|B5RCJ3|TRUA_SALG2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238693568|sp|B4SZP0|TRUA_SALNS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238693647|sp|B4TQA4|TRUA_SALSV RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254764863|sp|C0PZZ5|TRUA_SALPC RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|25292042|pir||AF0802 pseudouridylate synthase (EC 4.2.1.70) - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16503592|emb|CAD07600.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136636|gb|AAO68202.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126992|gb|AAV76498.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128573|gb|AAX66276.1| pseudouridylate synthase I [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161362260|gb|ABX66028.1| hypothetical protein SPAB_00602 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402456|gb|ACF62678.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408538|gb|ACF68757.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194458148|gb|EDX46987.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710001|gb|ACF89222.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195631471|gb|EDX50031.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197093145|emb|CAR58589.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197212656|gb|ACH50053.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197289616|gb|EDY28979.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197940513|gb|ACH77846.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605588|gb|EDZ04133.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204321753|gb|EDZ06952.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273262|emb|CAR38227.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325206|gb|EDZ13045.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205335762|gb|EDZ22526.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205338670|gb|EDZ25434.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205344778|gb|EDZ31542.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206709589|emb|CAR33934.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467669|gb|ACN45499.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|320086803|emb|CBY96575.1| pseudouridylate synthase I [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|322617114|gb|EFY14020.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617581|gb|EFY14480.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624790|gb|EFY21619.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630340|gb|EFY27110.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634520|gb|EFY31253.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322639231|gb|EFY35923.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640094|gb|EFY36761.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645687|gb|EFY42211.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652051|gb|EFY48414.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656223|gb|EFY52520.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659375|gb|EFY55622.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665835|gb|EFY62018.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669927|gb|EFY66068.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673912|gb|EFY70009.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678671|gb|EFY74727.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683535|gb|EFY79549.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687610|gb|EFY83580.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322715420|gb|EFZ06991.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323193556|gb|EFZ78761.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198463|gb|EFZ83565.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204575|gb|EFZ89578.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208487|gb|EFZ93426.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213625|gb|EFZ98414.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218340|gb|EGA03050.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220106|gb|EGA04572.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224520|gb|EGA08802.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323232335|gb|EGA16438.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235632|gb|EGA19716.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323241209|gb|EGA25245.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244951|gb|EGA28953.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250070|gb|EGA33964.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253854|gb|EGA37679.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323254991|gb|EGA38782.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259823|gb|EGA43455.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264157|gb|EGA47664.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270855|gb|EGA54293.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326624193|gb|EGE30538.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326628574|gb|EGE34917.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 270

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPINVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLAKGVTHYYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPESWIAELLAARDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|300691102|ref|YP_003752097.1| tRNA pseudouridylate synthase I [Ralstonia solanacearum PSI07]
 gi|299078162|emb|CBJ50805.1| tRNA pseudouridylate synthase I [Ralstonia solanacearum PSI07]
          Length = 274

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/250 (36%), Positives = 135/250 (54%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+G+ + GWQ Q +G+++Q  +E A+    G  +    AGRTD+GVHAL Q
Sbjct: 1   MTRIALGIQYDGAAFSGWQSQPHGNTVQDVLEAALRQFAGVELPTIVAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H D      P    +  NA+L    T+++     V + FHARFSA RR+Y Y +++  
Sbjct: 61  VVHLDTDLVRDPFSWVRGTNAFL--PPTVAVRWAQEVPEDFHARFSAHRRTYYYALVSGP 118

Query: 121 APLALEKGRAWLIPKSL----DCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
               L  G+A  +        D   M+ AAQ LVG HDF++FR+  CQA SP++T+   +
Sbjct: 119 TRAPLLGGKAGYVMLPPGESLDVAAMQEAAQVLVGEHDFSSFRAAECQAKSPVKTMYSAE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G  + +R+   +FLH  +R+ +G L  +G GK     + + L A+DRK   P   P
Sbjct: 179 ARGQGEWVFVRIRGSAFLHHMVRNIMGCLVAIGRGKRPVAWMGEVLAARDRKVAAPTFMP 238

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 239 DGLYLAEVGY 248


>gi|187921475|ref|YP_001890507.1| tRNA pseudouridine synthase A [Burkholderia phytofirmans PsJN]
 gi|238691591|sp|B2T9N4|TRUA_BURPP RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|187719913|gb|ACD21136.1| tRNA pseudouridine synthase A [Burkholderia phytofirmans PsJN]
          Length = 270

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+GS + GWQ Q + +++Q  +E+A+       V    AGRTD+GVH L Q
Sbjct: 1   MKRIALGVQYDGSAFCGWQSQPHRNTVQDELERALREFARTPVQTVVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +   V   +  N++L    TIS+     +  +FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELDRADVSWVRGTNSFL--PKTISVQWAKPMPDEFHARFSAFERTYYYVLYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +  SLD + M+ AA HL+G HDF+ FRS  CQA +P++ +   DV   
Sbjct: 119 VRSPMLATRAGWVHTSLDVDAMQKAAAHLLGEHDFSAFRSSQCQAKTPVKHLYQIDVKQQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +  R  A +FLH  +R+ +G L  +G G+     + + L ++DR    P   P+GLY
Sbjct: 179 GDFVHFRFRANAFLHHMVRNLMGCLVYIGGGRRPVEWMAEVLASRDRDFAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|150392126|ref|YP_001322175.1| tRNA pseudouridine synthase A [Alkaliphilus metalliredigens QYMF]
 gi|149951988|gb|ABR50516.1| tRNA pseudouridine synthase A [Alkaliphilus metalliredigens QYMF]
          Length = 255

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + IEY+G+ Y GWQ Q+N  SIQ  I KA+  VTGE +  HG+GRTD+GVHA  Q
Sbjct: 1   MRNIMIEIEYDGTNYSGWQIQQNAPSIQEEIAKALKKVTGEEITTHGSGRTDAGVHAQGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F L  +     +  ALN  L     I+IL    + + FHAR+SAI + Y Y I+   
Sbjct: 61  VASFQLHSKIPAERISFALNGKL--PRDITILEAKEMPEDFHARYSAIGKRYGYCIMNNT 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL +   + +P  LD + M+ A++ L+G HDF  F +   Q  S +R ID  + ++ 
Sbjct: 119 HGSALLRNYCYHVPYKLDLQKMKQASETLLGTHDFKGFMASGSQVKSTVRRIDEINFDTQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I I +    FL+  +R  VGSL  +G GK     L+  L+ Q+R+     AP +GLY
Sbjct: 179 GSQIWITMQGNGFLYKMVRIIVGSLVGIGTGKIKEEALQNILETQNRRVAVKTAPAQGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LQKVFY 244


>gi|16765695|ref|NP_461310.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167993057|ref|ZP_02574152.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168261608|ref|ZP_02683581.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197263425|ref|ZP_03163499.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|24212561|sp|Q8ZNB9|TRUA_SALTY RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|16420911|gb|AAL21269.1| pseudouridylate synthase I [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197241680|gb|EDY24300.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205328800|gb|EDZ15564.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205349584|gb|EDZ36215.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261247574|emb|CBG25401.1| Pseudouridine synthase I [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994470|gb|ACY89355.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158926|emb|CBW18439.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913359|dbj|BAJ37333.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222930|gb|EFX48001.1| tRNA pseudouridine synthase A ; tRNA Psi38, Psi39 and Psi40
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323130701|gb|ADX18131.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989301|gb|AEF08284.1| tRNA pseudouridine synthase A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 270

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPINVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLAKGVTHYYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPESWIAELLAARDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|301170402|emb|CBW30008.1| pseudouridylate synthase I [Haemophilus influenzae 10810]
          Length = 269

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDTEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|160935852|ref|ZP_02083227.1| hypothetical protein CLOBOL_00746 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441596|gb|EDP19306.1| hypothetical protein CLOBOL_00746 [Clostridium bolteae ATCC
           BAA-613]
          Length = 248

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 131/246 (53%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNG-SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           +   + + Y+G+ Y GWQ+Q N   +IQG +E  +  + G  V VHG+GRTD+GVHA  Q
Sbjct: 1   MNIGVWLSYDGTRYDGWQKQGNTDRTIQGKLEAVLEKLEGSPVEVHGSGRTDAGVHAESQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F L +   P  + + +N YL   + I++    ++ ++FH+R +A+R++Y Y+I T  
Sbjct: 61  VANFHLAKNMTPDEIMRYMNRYL--PEDIAVTRACVMPERFHSRLNALRKTYRYQIETAP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                E+   + + + LD   M  AA  L G HD+ +F        S IRTI+       
Sbjct: 119 KKNVFERYYYYGLGQDLDVGKMEQAAAILTGTHDYKSFCGNKKMKKSTIRTIESICFYRM 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I I      FL   +R   G+L  VG GK    ++   L+A DR   G  APPEGL+
Sbjct: 179 GSRIHISFTGNGFLQQMVRILSGTLIEVGTGKRKPEEMAAILEAGDRSMAGFTAPPEGLF 238

Query: 241 FDSVEY 246
            + VEY
Sbjct: 239 LEKVEY 244


>gi|209764794|gb|ACI80709.1| pseudouridylate synthase I [Escherichia coli]
          Length = 270

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 130/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNYRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|227530236|ref|ZP_03960285.1| tRNA pseudouridine synthase A [Lactobacillus vaginalis ATCC 49540]
 gi|227349848|gb|EEJ40139.1| tRNA pseudouridine synthase A [Lactobacillus vaginalis ATCC 49540]
          Length = 256

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 129/251 (51%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI---VVVHGAGRTDSGVHA 57
           M RY +   Y+GS + G+Q Q +  +++  ++ A+  +       + V G+GRTD+GVHA
Sbjct: 1   MYRYKITFAYDGSNFSGFQIQPHKRTVEQVLKNAVNKIAKHPTPEIPVIGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFD+        + KALN+ L     I I    +VD  FHAR+SA  ++Y YR+ 
Sbjct: 61  LNQVAHFDIPYHLSNESMRKALNSIL--PLDILIKKAELVDSDFHARYSAHNKTYRYRVD 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
             +     ++         LD   MR AA++ +G HDFT+F +   QA S +RT+   D+
Sbjct: 119 QGEFVNPFKRNYTAHFKYPLDLTLMRKAAKNFIGEHDFTSFVASGSQAKSNVRTVYKIDI 178

Query: 178 NSF--GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                 N +        FL+ QIR  V  L  +G  +    D+++ L A+DR +    AP
Sbjct: 179 KRDKLRNEVVFDFTGNGFLYNQIRIMVAFLLEIGSKQRPVDDVKRVLAAKDRTQARMTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY  SV+Y
Sbjct: 239 ASGLYLVSVDY 249


>gi|312870517|ref|ZP_07730636.1| tRNA pseudouridine synthase A [Lactobacillus oris PB013-T2-3]
 gi|311093979|gb|EFQ52304.1| tRNA pseudouridine synthase A [Lactobacillus oris PB013-T2-3]
          Length = 256

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 134/251 (53%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG---EIVVVHGAGRTDSGVHA 57
           M RY +   Y+G+ + G+Q Q +  +++  ++ A+  +       + V G+GRTD+GVHA
Sbjct: 1   MYRYKITFAYDGANFSGFQIQPHKRTVEQVLKNAVNKIAKYPDPPISVIGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFDL  +     + KALN+ L     I +     VD+ FHAR+SA R++Y YR+ 
Sbjct: 61  LNQVAHFDLPYQLSDESMRKALNSLL--PLDILVKKAERVDESFHARYSAHRKTYRYRVD 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHF-- 175
                   ++         +D + MR+AA+  +G HDFT+F +   QA S +RT++    
Sbjct: 119 QGDFVDPFKRNYTAHYKVPVDIDKMRLAAKDFIGEHDFTSFVASGSQAKSNVRTVEKITV 178

Query: 176 DVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
           D +   N +        FL+ QIR  V  L  VG G+   +D+++ L A+DR +    AP
Sbjct: 179 DRDPAQNEVVFEFTGNGFLYNQIRIMVAFLLEVGSGQRPVSDVKRVLAAKDRTQARMTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY  SV+Y
Sbjct: 239 ASGLYLVSVDY 249


>gi|50121981|ref|YP_051148.1| tRNA pseudouridine synthase A [Pectobacterium atrosepticum
           SCRI1043]
 gi|62901300|sp|Q6D2N7|TRUA_ERWCT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|49612507|emb|CAG75957.1| tRNA pseudouridine synthase A [Pectobacterium atrosepticum
           SCRI1043]
          Length = 283

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 93/244 (38%), Positives = 132/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ + +S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 24  KIALGIEYDGSQYYGWQRQIDVASVQACLEKALSKVADEPIEVLCAGRTDAGVHGTGQVV 83

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF              +NA L     I++  +  V + FHARFSA  R Y Y I   +  
Sbjct: 84  HFTTQAIRKDAAWTMGVNANL--PPDIAVRWVKAVHEDFHARFSATARRYRYIIYNHRYR 141

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+           LD E M  A Q L+G +DFT+FR++ CQ+ +P R ++H  V   GN
Sbjct: 142 PAVLSHGMTHFYHPLDVERMERAGQCLLGENDFTSFRAVQCQSRTPWRNVNHLKVTRHGN 201

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            I + + A +F+H  +R+ VGSL  VG G    + + + L A+DR   G  A  EGLY  
Sbjct: 202 YIVVDIKANAFVHHMVRNIVGSLMDVGCGNRPESWIAELLAAKDRTLAGATARAEGLYLV 261

Query: 243 SVEY 246
           +V+Y
Sbjct: 262 AVDY 265


>gi|160947056|ref|ZP_02094223.1| hypothetical protein PEPMIC_00987 [Parvimonas micra ATCC 33270]
 gi|158446190|gb|EDP23185.1| hypothetical protein PEPMIC_00987 [Parvimonas micra ATCC 33270]
          Length = 247

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + I Y+GS +FG+Q+QKN  ++QG IE A+  +T E + +  AGRTD GVH+LR 
Sbjct: 1   MRNIMLTISYDGSLFFGFQKQKNVVTVQGEIEDALKKITEENINIISAGRTDRGVHSLRH 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + +F        +    ALN +L     + +L+   V + FH+RF A  ++Y Y +   +
Sbjct: 61  IINFHTESNVGVLNFKTALNHFL--PIGVRVLDSKEVSENFHSRFDAKMKTYKYILNLDE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +        P  LD E M+ A ++ +GR  F  F        +PIR I+ F++   
Sbjct: 119 VMDPIYYNYKANFPYPLDIEKMKRAKEYFIGRKSFKAFMGPRTGNINPIREINSFEIYKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            N +   +  +SF+  Q+R  VG+L  +G G     +LE+ L ++DR   G    P GLY
Sbjct: 179 NNDLIFLIKGQSFIRNQVRIMVGTLVDIGRGLIEEDELERILDSEDRTRAGVTLSPNGLY 238

Query: 241 FDSVEY 246
              + Y
Sbjct: 239 LMEILY 244


>gi|148544665|ref|YP_001272035.1| tRNA pseudouridine synthase A [Lactobacillus reuteri DSM 20016]
 gi|184154018|ref|YP_001842359.1| tRNA pseudouridine synthase A [Lactobacillus reuteri JCM 1112]
 gi|194466922|ref|ZP_03072909.1| tRNA pseudouridine synthase A [Lactobacillus reuteri 100-23]
 gi|227363788|ref|ZP_03847895.1| tRNA pseudouridine synthase A [Lactobacillus reuteri MM2-3]
 gi|325682999|ref|ZP_08162515.1| tRNA pseudouridine synthase A [Lactobacillus reuteri MM4-1A]
 gi|166991164|sp|A5VLH4|TRUA_LACRD RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|229557996|sp|B2G8U7|TRUA_LACRJ RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|148531699|gb|ABQ83698.1| tRNA pseudouridine synthase A [Lactobacillus reuteri DSM 20016]
 gi|183225362|dbj|BAG25879.1| tRNA pseudouridine synthase A [Lactobacillus reuteri JCM 1112]
 gi|194453958|gb|EDX42855.1| tRNA pseudouridine synthase A [Lactobacillus reuteri 100-23]
 gi|227071145|gb|EEI09461.1| tRNA pseudouridine synthase A [Lactobacillus reuteri MM2-3]
 gi|324977349|gb|EGC14300.1| tRNA pseudouridine synthase A [Lactobacillus reuteri MM4-1A]
          Length = 256

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 131/251 (52%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI---VVVHGAGRTDSGVHA 57
           M RY +   Y+G+ + G+Q Q N  +++ +++ A+  +       + V G+GRTD+GVHA
Sbjct: 1   MYRYKITFAYDGTNFSGFQIQPNKRTVEQTLKNAVNKIAKHPTPAIPVIGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFD+        + KALN+ L     I I    +VD  FHAR+SA R++Y YR+ 
Sbjct: 61  LNQVAHFDIPYHLSNESMRKALNSIL--PLDILIKKAELVDNDFHARYSAHRKTYRYRVD 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
             +     ++         L+ E MR AA  LVG HDFT+F +   QA S +RTI++  +
Sbjct: 119 QGEFVNPFKRNYTSHFKYPLNLEKMRKAADDLVGTHDFTSFVASGSQAKSNVRTIENITI 178

Query: 178 NSF--GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                 N +        FL+ Q+R  V  L  +G  +    D+ + L+A+DR      AP
Sbjct: 179 KRDEVRNEVVFDFTGNGFLYNQVRIMVAFLLEIGSNQRPVDDVSRVLKAKDRTLARMTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY  +V+Y
Sbjct: 239 ASGLYLVNVDY 249


>gi|170767244|ref|ZP_02901697.1| tRNA pseudouridine synthase A [Escherichia albertii TW07627]
 gi|170123578|gb|EDS92509.1| tRNA pseudouridine synthase A [Escherichia albertii TW07627]
          Length = 270

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHHQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|145637534|ref|ZP_01793192.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittHH]
 gi|145269340|gb|EDK09285.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittHH]
          Length = 269

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|170727324|ref|YP_001761350.1| tRNA pseudouridine synthase A [Shewanella woodyi ATCC 51908]
 gi|238688683|sp|B1KKN8|TRUA_SHEWM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|169812671|gb|ACA87255.1| tRNA pseudouridine synthase A [Shewanella woodyi ATCC 51908]
          Length = 261

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/245 (40%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ    S+Q  +E+A+  V  E + VH AGRTD+GVHA  QV
Sbjct: 1   MRVALGIEYDGSKYFGWQRQVEVDSVQAQLERALSKVANEPISVHCAGRTDTGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +N  L   D I++    +VD+ FHARFSA  R Y Y I   Q 
Sbjct: 61  VHFDTDAIRKESAWTLGVNVSL--PDDIAVRWAKVVDEDFHARFSATARRYRYMIYNYQL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         LD   M  AAQH VG HDFT+FR++HCQ+ SP R +   +V   G
Sbjct: 119 RPGILRSGVSHYRTHLDENKMHEAAQHFVGEHDFTSFRALHCQSKSPNRNVHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VGSL  +G G  +   + + L  +DR +  P A P GLY 
Sbjct: 179 MYICVDIKANAFLHHMVRNIVGSLIEIGLGHQSHEWIPELLALKDRSKAAPTAKPNGLYM 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|8569326|pdb|1DJ0|A Chain A, The Crystal Structure Of E. Coli Pseudouridine Synthase I
           At 1.5 Angstrom Resolution
 gi|8569327|pdb|1DJ0|B Chain B, The Crystal Structure Of E. Coli Pseudouridine Synthase I
           At 1.5 Angstrom Resolution
          Length = 264

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 5   KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 64

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 65  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLR 122

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 123 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 182

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 183 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 242

Query: 243 SVEY 246
           +V+Y
Sbjct: 243 AVDY 246


>gi|145639258|ref|ZP_01794864.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittII]
 gi|145271561|gb|EDK11472.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittII]
 gi|309751137|gb|ADO81121.1| tRNA pseudouridine synthase A [Haemophilus influenzae R2866]
          Length = 269

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPNKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|221307961|ref|ZP_03589808.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221312282|ref|ZP_03594087.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221317216|ref|ZP_03598510.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221321479|ref|ZP_03602773.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|255767037|ref|NP_388029.2| tRNA pseudouridine synthase A [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|321313820|ref|YP_004206107.1| tRNA pseudouridine synthase A [Bacillus subtilis BSn5]
 gi|239938721|sp|P70973|TRUA_BACSU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|225184664|emb|CAB11924.2| pseudouridylate synthase I [Bacillus subtilis subsp. subtilis str.
           168]
 gi|291482520|dbj|BAI83595.1| tRNA pseudouridine synthase A [Bacillus subtilis subsp. natto
           BEST195]
 gi|320020094|gb|ADV95080.1| tRNA pseudouridine synthase A [Bacillus subtilis BSn5]
          Length = 247

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 132/247 (53%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI--VVVHGAGRTDSGVHALR 59
           +R    I Y+G  + G+Q Q    ++Q  +EKA+ ++      + V  +GRTDSGVHA  
Sbjct: 1   MRLKCTISYDGHLFNGYQVQPGKRTVQDELEKALAVLHKSKDRIPVVSSGRTDSGVHAAG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALNA L   D I++    I D  FHARFSA+++ Y Y + T 
Sbjct: 61  QVIHFDTPLSIPAERWPYALNALL--PDDIAVKQAEIADDGFHARFSAVKKEYRYFVYTE 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P   ++  A+     L+ ++MR AA+HL+G HDFT+F +   +    +RTI   D   
Sbjct: 119 KHPDVFKRHYAYHFSYRLNVQDMREAAKHLIGTHDFTSFCAAKTEVQDKVRTIYELDWTE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +++R+    FL+  +R   G+L   G GK +  +++  L+A+DR+  G  AP  GL
Sbjct: 179 TADGLQMRITGSGFLYNMVRIIAGTLLDAGIGKISPDEVKSMLEAKDREAAGRTAPGHGL 238

Query: 240 YFDSVEY 246
           Y  +V Y
Sbjct: 239 YLWNVYY 245


>gi|257899365|ref|ZP_05679018.1| tRNA pseudouridine synthase [Enterococcus faecium Com15]
 gi|257837277|gb|EEV62351.1| tRNA pseudouridine synthase [Enterococcus faecium Com15]
          Length = 248

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M+RY  II Y+G+ + G+Q+Q NG ++Q  +EK +  +  G+ + V G+GRTD+GVHA+ 
Sbjct: 1   MVRYKAIIAYDGTNFNGFQKQPNGRTVQEEVEKTLQRMANGKEITVFGSGRTDAGVHAIG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   E     +  AL+   +  + I++  + IV ++FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDYPEERPLERMRFALDT--QSPEDIAVRKVEIVSEEFHARYLVKEKTYQFRVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   ++ A   L+G HDFT+F +        +RTI    +  
Sbjct: 119 KPRSPFRRHYASYYPYPLDLGKIQRALPDLLGTHDFTSFCASGSSIEDKVRTIYEAKMEV 178

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+     +   +  +DR   GP A PE
Sbjct: 179 NETKDELLFTFRGNGFLYKMIRILVGTLLKIGNGRLPEDSIPAIIAKKDRNAAGPTAHPE 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLYEVKY 247


>gi|150015077|ref|YP_001307331.1| tRNA pseudouridine synthase A [Clostridium beijerinckii NCIMB 8052]
 gi|189030131|sp|A6LPU5|TRUA_CLOB8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|149901542|gb|ABR32375.1| tRNA pseudouridine synthase A [Clostridium beijerinckii NCIMB 8052]
          Length = 244

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIE++GS + GWQRQ  G +IQ  IE AIF  TGE ++++G+ RTD+GVHA   
Sbjct: 1   MRNIKLIIEFDGSNFCGWQRQPKGRTIQKVIETAIFKATGEEIMINGSSRTDAGVHAREM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F            +A+N  L   + +SI+    V + FHAR+S+  ++Y Y II R 
Sbjct: 61  VANFLTNSSIPGDKFREAINTRL--PEDVSIIKSEEVSEDFHARYSSKGKTYSYTIINRY 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             L+L     +     LD   MR A ++ +GRHDF  F S      +  RTI    ++  
Sbjct: 119 ERLSLGHQYLYHYKYRLDVNEMRRACEYFIGRHDFRAFMSPGSSIKTTTRTIHDLYIDQN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I+I + A  FL+  +R  VG+L  +G+GK    +++  ++  +RK+ G   PP GL 
Sbjct: 179 GNEIKIFITADGFLYNMVRIIVGTLIKIGNGKLEVENIKDIIEEGNRKKAGMCVPPNGLI 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|145633047|ref|ZP_01788779.1| tRNA pseudouridine synthase A [Haemophilus influenzae 3655]
 gi|144986273|gb|EDJ92852.1| tRNA pseudouridine synthase A [Haemophilus influenzae 3655]
          Length = 269

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|145627788|ref|ZP_01783589.1| tRNA pseudouridine synthase A [Haemophilus influenzae 22.1-21]
 gi|144979563|gb|EDJ89222.1| tRNA pseudouridine synthase A [Haemophilus influenzae 22.1-21]
          Length = 269

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHEAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|320101703|ref|YP_004177294.1| tRNA pseudouridine synthase A [Isosphaera pallida ATCC 43644]
 gi|319748985|gb|ADV60745.1| tRNA pseudouridine synthase A [Isosphaera pallida ATCC 43644]
          Length = 275

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 92/247 (37%), Positives = 129/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M+R   +I+ Y+G+ + GWQRQ    ++Q  +E A+  +TGE V V  +GRTD+GVHAL 
Sbjct: 1   MLRTLKLILAYDGTEFSGWQRQPGHRTVQEVVESALRPLTGEPVAVTASGRTDAGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QVAHF  +    P +  KALNA L     + ++      + FHA   A  + Y Y I   
Sbjct: 61  QVAHFHTIARHPPEVFLKALNATL--PPDVRVVWAEEAPQSFHATLDAQSKRYRYVIDNG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                  +  AW + + LD   M  A Q L GRHDF +F +      S +RTI    V  
Sbjct: 119 PFADPFLRRTAWHLFRPLDAPRMNRAVQALRGRHDFRSFETNWPNRMSSVRTILDVQVRR 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +E+ V A  FL+  +RS  G+  LVG G    T + + L AQDR+  GP APP+GL
Sbjct: 179 IDHRVELEVEADGFLYNMVRSIAGTAVLVGLGDRPETFVAEVLHAQDRRLAGPTAPPQGL 238

Query: 240 YFDSVEY 246
           +   V Y
Sbjct: 239 FLLQVRY 245


>gi|261855761|ref|YP_003263044.1| tRNA pseudouridine synthase A [Halothiobacillus neapolitanus c2]
 gi|261836230|gb|ACX95997.1| tRNA pseudouridine synthase A [Halothiobacillus neapolitanus c2]
          Length = 271

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 102/246 (41%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + +EY+GS Y GWQRQ    S+Q  +E A+  V    V V  AGRTD+GVHA  Q
Sbjct: 1   MARIALTLEYDGSRYHGWQRQSEVDSVQARLETALSRVADSPVDVVCAGRTDAGVHASHQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD             +   L     ISIL+   VD +FHARFSA  RSY Y I+ R 
Sbjct: 61  VVHFDTEAIRPERAWLLGVTQSL--PSDISILSAQFVDPEFHARFSATARSYRYIILNRM 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL +GR       LD   M  A QHL+G HDF++FR+  CQ+ SP+R+I+  +++  
Sbjct: 119 TRSALHRGRITWWRGPLDESAMHEAGQHLLGEHDFSSFRAKDCQSVSPVRSIESLNIHRQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + + + A +FLH  +R+ VG+L  VG G+  +  L   LQA+DR   G  AP +GLY
Sbjct: 179 GEYVYMDITANAFLHHMVRNIVGTLLPVGAGERPADSLWDILQAKDRSAAGMTAPADGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVGVRY 244


>gi|56697975|ref|YP_168346.1| tRNA pseudouridine synthase A [Ruegeria pomeroyi DSS-3]
 gi|62901184|sp|Q5LNR0|TRUA_SILPO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|56679712|gb|AAV96378.1| tRNA pseudouridine synthase A [Ruegeria pomeroyi DSS-3]
          Length = 262

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 118/250 (47%), Positives = 159/250 (63%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY G+ + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRYALKVEYLGTPFAGWQRQKDLPSVQGAIETALARLEPGPHTIAAAGRTDAGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R+W P  L +ALN +LK    ++I   + V + +HARFSA  R YL+R++ R+
Sbjct: 61  VAHCDLTRDWDPFRLSEALNYHLK-PQPVAITAAARVAEDWHARFSATERQYLFRLLMRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G  W +   LD   M+ AA  L+GRHDFTTFRS  CQA+SP++T+D   V + 
Sbjct: 120 APATHDAGLVWQVGHRLDARAMQAAADLLLGRHDFTTFRSSICQAASPVKTLDELRVEAV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +     I   V ARSFLH Q+RSFVG+L+ VG G W   D+  AL+A+DR  CGP+ PP
Sbjct: 180 ESFSGPEIRFHVRARSFLHNQVRSFVGTLERVGAGAWAPEDVRSALEARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLARVGY 249


>gi|319897314|ref|YP_004135510.1| tRNA pseudouridine synthase a [Haemophilus influenzae F3031]
 gi|317432819|emb|CBY81184.1| tRNA pseudouridine synthase A [Haemophilus influenzae F3031]
          Length = 269

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVAWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|291614576|ref|YP_003524733.1| tRNA pseudouridine synthase A [Sideroxydans lithotrophicus ES-1]
 gi|291584688|gb|ADE12346.1| tRNA pseudouridine synthase A [Sideroxydans lithotrophicus ES-1]
          Length = 254

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 98/245 (40%), Positives = 142/245 (57%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GSGY GWQ Q +  +IQ +++ A+  + GE + +  AGRTD+GVHAL QV
Sbjct: 1   MRIALGIEYDGSGYNGWQSQPDVPNIQDTLQAALSRIAGENISIIAAGRTDTGVHALEQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD           +  NA L     +++L    V  +FHARFSA  RSY Y +I R +
Sbjct: 61  VHFDTGIVRPLASWVRGTNALL--PKDVAVLWAHPVADEFHARFSAQARSYQYVLINRPS 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G+       LD E MR+AAQ+L+G HDF+ FRS  CQA +P++T+   D+   G
Sbjct: 119 RSAVHHGKVGWFHLPLDVEAMRMAAQNLLGEHDFSAFRSSQCQAKTPVKTLAQLDIVQQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           ++I   + A +FLH  +R+ VG L  VG GK+    + + LQ ++RK   P   P+GLY 
Sbjct: 179 DIIIFNLTANAFLHHMVRNIVGCLLYVGKGKYPPQWMHELLQGRERKLAAPTFAPDGLYL 238

Query: 242 DSVEY 246
             + Y
Sbjct: 239 CHITY 243


>gi|134298133|ref|YP_001111629.1| tRNA pseudouridine synthase A [Desulfotomaculum reducens MI-1]
 gi|172044244|sp|A4J151|TRUA_DESRM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|134050833|gb|ABO48804.1| tRNA pseudouridine synthase A [Desulfotomaculum reducens MI-1]
          Length = 247

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 124/249 (49%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNG--SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + + Y+G+ Y G+Q Q+    ++IQ ++EKA+  +    + V GAGRTD+GVHA 
Sbjct: 1   MKNIKLTLAYDGTNYHGFQEQRGTGLATIQEALEKALSTIAQTPIQVIGAGRTDAGVHAQ 60

Query: 59  RQVAHFDLV-REWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
            QV +F              ALN  L     I ++    V   FHARFSA+ ++Y Y I 
Sbjct: 61  GQVVNFRSEKWPVPAEKAPLALNVLL--PGDIKVVKAEEVPMDFHARFSAVAKTYRYSIY 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
             +      +   +  P+ LD   M+  A +L+G +DF +F++        IRTI   D+
Sbjct: 119 HHRVMSPFHRYYCYHEPRRLDVNAMQEGAAYLLGTYDFKSFQAQGTPVKDTIRTIYRADI 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                +I + +    FL+  +R   G+L  +G GK    D+ K +++++R   G  APP+
Sbjct: 179 IEDAPVINLYLRGNGFLYNMVRIITGTLLNIGFGKIKPEDMVKIIESKNRTLAGTTAPPQ 238

Query: 238 GLYFDSVEY 246
           GL    VEY
Sbjct: 239 GLCLMEVEY 247


>gi|291618223|ref|YP_003520965.1| TruA [Pantoea ananatis LMG 20103]
 gi|291153253|gb|ADD77837.1| TruA [Pantoea ananatis LMG 20103]
 gi|327394617|dbj|BAK12039.1| tRNA pseudouridine synthase A TruA [Pantoea ananatis AJ13355]
          Length = 267

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ+   S+Q  +E+A+  V    V V  AGRTD+GVH   QV
Sbjct: 7   QKLALGIEYDGSRYYGWQRQQEVRSVQEKLERALSKVADHPVSVFCAGRTDAGVHGTGQV 66

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+ V +         +NA L   D I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 67  VHFETVAQRADAAWTLGVNANL--PDDIAVRWVKAVPDDFHARFSATARRYRYLIYNQRL 124

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M+ A Q L+G +DFT+FR++ CQ+ +P R + H +V   G
Sbjct: 125 RPAILGNGVTHFYYPLDVEKMQRAGQCLLGENDFTSFRAVQCQSRTPWRNVMHLNVTRHG 184

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  +G G  + + + + L A+DR      A  EGLY 
Sbjct: 185 PYVIVDIKANAFVHHMVRNIVGSLMEIGCGNQSESWMAELLAAKDRTLAAATAKAEGLYL 244

Query: 242 DSVEY 246
            +V+Y
Sbjct: 245 VAVDY 249


>gi|157161806|ref|YP_001459124.1| tRNA pseudouridine synthase A [Escherichia coli HS]
 gi|170019373|ref|YP_001724327.1| tRNA pseudouridine synthase A [Escherichia coli ATCC 8739]
 gi|188492228|ref|ZP_02999498.1| tRNA pseudouridine synthase A [Escherichia coli 53638]
 gi|194436017|ref|ZP_03068119.1| tRNA pseudouridine synthase A [Escherichia coli 101-1]
 gi|253772758|ref|YP_003035589.1| tRNA pseudouridine synthase A [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162327|ref|YP_003045435.1| tRNA pseudouridine synthase A [Escherichia coli B str. REL606]
 gi|256021997|ref|ZP_05435862.1| tRNA pseudouridine synthase A [Escherichia sp. 4_1_40B]
 gi|300948533|ref|ZP_07162627.1| tRNA pseudouridine synthase A [Escherichia coli MS 116-1]
 gi|300956414|ref|ZP_07168705.1| tRNA pseudouridine synthase A [Escherichia coli MS 175-1]
 gi|301023565|ref|ZP_07187329.1| tRNA pseudouridine synthase A [Escherichia coli MS 196-1]
 gi|301647579|ref|ZP_07247376.1| tRNA pseudouridine synthase A [Escherichia coli MS 146-1]
 gi|307138983|ref|ZP_07498339.1| tRNA pseudouridine synthase A [Escherichia coli H736]
 gi|312973422|ref|ZP_07787594.1| tRNA pseudouridine synthase A [Escherichia coli 1827-70]
 gi|331642958|ref|ZP_08344093.1| tRNA pseudouridine synthase A [Escherichia coli H736]
 gi|166991162|sp|A8A2I7|TRUA_ECOHS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|189030133|sp|B1IXM4|TRUA_ECOLC RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157067486|gb|ABV06741.1| tRNA pseudouridine synthase A [Escherichia coli HS]
 gi|169754301|gb|ACA77000.1| tRNA pseudouridine synthase A [Escherichia coli ATCC 8739]
 gi|188487427|gb|EDU62530.1| tRNA pseudouridine synthase A [Escherichia coli 53638]
 gi|194424745|gb|EDX40730.1| tRNA pseudouridine synthase A [Escherichia coli 101-1]
 gi|242377951|emb|CAQ32720.1| tRNA pseudouridine synthase I [Escherichia coli BL21(DE3)]
 gi|253323802|gb|ACT28404.1| tRNA pseudouridine synthase A [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974228|gb|ACT39899.1| tRNA pseudouridine synthase A [Escherichia coli B str. REL606]
 gi|253978395|gb|ACT44065.1| tRNA pseudouridine synthase A [Escherichia coli BL21(DE3)]
 gi|299880800|gb|EFI89011.1| tRNA pseudouridine synthase A [Escherichia coli MS 196-1]
 gi|300316763|gb|EFJ66547.1| tRNA pseudouridine synthase A [Escherichia coli MS 175-1]
 gi|300451943|gb|EFK15563.1| tRNA pseudouridine synthase A [Escherichia coli MS 116-1]
 gi|301074269|gb|EFK89075.1| tRNA pseudouridine synthase A [Escherichia coli MS 146-1]
 gi|309702630|emb|CBJ01959.1| tRNA pseudouridine synthase A [Escherichia coli ETEC H10407]
 gi|310332017|gb|EFP99252.1| tRNA pseudouridine synthase A [Escherichia coli 1827-70]
 gi|315615587|gb|EFU96219.1| tRNA pseudouridine synthase A [Escherichia coli 3431]
 gi|323936608|gb|EGB32895.1| tRNA pseudouridine synthase A [Escherichia coli E1520]
 gi|323940985|gb|EGB37172.1| tRNA pseudouridine synthase A [Escherichia coli E482]
 gi|323961391|gb|EGB57002.1| tRNA pseudouridine synthase A [Escherichia coli H489]
 gi|323973098|gb|EGB68291.1| tRNA pseudouridine synthase A [Escherichia coli TA007]
 gi|331039756|gb|EGI11976.1| tRNA pseudouridine synthase A [Escherichia coli H736]
 gi|332344100|gb|AEE57434.1| tRNA pseudouridine synthase TruA [Escherichia coli UMNK88]
          Length = 270

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|170761533|ref|YP_001788787.1| tRNA pseudouridine synthase A [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169408522|gb|ACA56933.1| tRNA pseudouridine synthase A [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 246

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 79/248 (31%), Positives = 134/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS--SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + +EY+G+ Y GWQ+QKN    ++QG++EK I  +T E V + G  RTDSGVHA 
Sbjct: 1   MKNIKLKLEYDGTNYCGWQKQKNEKFITLQGTLEKVISNITKEKVEIIGVSRTDSGVHAK 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
             V +F       P  L K +N  L     I +L+   V  +FH+RF +  ++Y Y ++ 
Sbjct: 61  GYVCNFFTNTRIPPENLQKVINNNL--PQDIVVLSSEEVSNEFHSRFCSKGKTYEYTVLN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
              P+A+ +   +     L+ +NM+IA+++ +G HDF+ F++      + +RTI+ F+++
Sbjct: 119 SPQPIAIGRNYIFQFKDKLNIDNMKIASRYFIGTHDFSAFKTKGSSVKTSVRTINEFEID 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I+  +    FL+  +R  VG L  +G  K     +E  ++++DR++ G   P  G
Sbjct: 179 KKGDFIKFTITGDGFLYNMVRIIVGILIEIGLNKREPEYVEYVIKSKDRRKAGKCVPSSG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLKEVFY 246


>gi|16130253|ref|NP_416821.1| pseudouridylate synthase I [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89109138|ref|AP_002918.1| pseudouridylate synthase I [Escherichia coli str. K-12 substr.
           W3110]
 gi|170081934|ref|YP_001731254.1| tRNA pseudouridine synthase A [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238901493|ref|YP_002927289.1| pseudouridylate synthase I [Escherichia coli BW2952]
 gi|123176|sp|P07649|TRUA_ECOLI RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; Short=PSU-I; AltName:
           Full=tRNA-uridine isomerase I
 gi|229557954|sp|B1X929|TRUA_ECODH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|259550387|sp|C4ZVL1|TRUA_ECOBW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|149242461|pdb|2NQP|A Chain A, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242462|pdb|2NQP|B Chain B, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242463|pdb|2NQP|C Chain C, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242464|pdb|2NQP|D Chain D, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242466|pdb|2NR0|A Chain A, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242467|pdb|2NR0|B Chain B, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242468|pdb|2NR0|C Chain C, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242469|pdb|2NR0|D Chain D, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|149242475|pdb|2NRE|A Chain A, Crystal Structure Of Pseudoudirinde Synthase Trua In
           Complex With Leucyl Trna
 gi|41718|emb|CAA26522.1| unnamed protein product [Escherichia coli K-12]
 gi|1788657|gb|AAC75378.1| pseudouridylate synthase I [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1799711|dbj|BAA16175.1| pseudouridylate synthase I [Escherichia coli str. K12 substr.
           W3110]
 gi|169889769|gb|ACB03476.1| tRNA pseudouridine synthase A [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238863332|gb|ACR65330.1| pseudouridylate synthase I [Escherichia coli BW2952]
 gi|260448588|gb|ACX39010.1| tRNA pseudouridine synthase A [Escherichia coli DH1]
 gi|315136953|dbj|BAJ44112.1| tRNA pseudouridine synthase A [Escherichia coli DH1]
          Length = 270

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|148828368|ref|YP_001293121.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittGG]
 gi|166228702|sp|A5UIY2|TRUA_HAEIG RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|148719610|gb|ABR00738.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittGG]
          Length = 269

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAIRPEKAWAFGTNAHL--PDDIAVAWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|292488882|ref|YP_003531769.1| pseudouridylate synthase I [Erwinia amylovora CFBP1430]
 gi|292900028|ref|YP_003539397.1| tRNA pseudouridine synthase A [Erwinia amylovora ATCC 49946]
 gi|291199876|emb|CBJ47000.1| tRNA pseudouridine synthase A [Erwinia amylovora ATCC 49946]
 gi|291554316|emb|CBA21677.1| pseudouridylate synthase I [Erwinia amylovora CFBP1430]
 gi|312173042|emb|CBX81297.1| pseudouridylate synthase I [Erwinia amylovora ATCC BAA-2158]
          Length = 271

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V    + V  AGRTD+GVH+  QV
Sbjct: 11  MKLALGIEYDGSRYYGWQRQNEVRSVQEKLEKALTRVADGPIAVFCAGRTDAGVHSTGQV 70

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I  R+ 
Sbjct: 71  VHFETTAQRKDAAWTLGVNANL--PADIAVRWVKSVPDDFHARFSATARRYRYVIYNRRL 128

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M+ A Q L+G +DFT+FR++ CQ+ +P+R + H +V+  G
Sbjct: 129 RPAILAAGVTHFYHPLDVEKMQSAGQCLLGENDFTSFRAVQCQSRTPMRNVMHLNVSRHG 188

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  +G G    + + + L A+DRK     A  EGLY 
Sbjct: 189 AYVVVDIKANAFVHHMVRNIVGSLMEIGCGNQPESWMSELLAAKDRKLAAATARAEGLYL 248

Query: 242 DSVEY 246
            +V+Y
Sbjct: 249 VAVDY 253


>gi|145641169|ref|ZP_01796749.1| tRNA pseudouridine synthase A [Haemophilus influenzae R3021]
 gi|145274006|gb|EDK13872.1| tRNA pseudouridine synthase A [Haemophilus influenzae 22.4-21]
          Length = 269

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSCIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNVIRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G HDF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEHDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNKPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|229844824|ref|ZP_04464962.1| tRNA pseudouridine synthase A [Haemophilus influenzae 6P18H1]
 gi|229812205|gb|EEP47896.1| tRNA pseudouridine synthase A [Haemophilus influenzae 6P18H1]
          Length = 269

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+     +        NA+L   D I++     VD +FHARFSAI R Y Y +   + 
Sbjct: 61  VHFETNAVRLEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSAIARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L G HDF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLFGEHDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L  ++R+   P A P+GLY 
Sbjct: 179 QYIIVDIQANAFVHHMVRNIVGSLIEVGAGNKPIEWMQWLLDQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|52425230|ref|YP_088367.1| tRNA pseudouridine synthase A [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307282|gb|AAU37782.1| TruA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 270

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 127/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  YFGWQRQ+   S+Q  +EKA+  V  E + V  AGRTDSGVH   QV
Sbjct: 8   MKIALGIEYNGKNYFGWQRQEKVHSVQAELEKALSFVANEKIEVFCAGRTDSGVHGTGQV 67

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA L   D I++     V   FHARFSA  R Y Y +   + 
Sbjct: 68  VHFETNAIRPEKAWAFGTNANL--PDDIAVRWAKEVPDDFHARFSATARRYRYVLYCNKL 125

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD   M+ A + L+G +DF++FR+  CQ+++P R I H +V   G
Sbjct: 126 RSAILPYGITHTHLDLDEHKMQEAGRFLLGENDFSSFRAAQCQSNTPWRNIHHLNVIRRG 185

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N + + + A +F+H  +R+ VGSL  VG G      +E  L  ++RK   P A  EGLY 
Sbjct: 186 NFVIVDIKANAFVHHMVRNIVGSLMEVGCGNQPPEWIEWLLAQKNRKLAAPTAKAEGLYL 245

Query: 242 DSVEY 246
             V Y
Sbjct: 246 VQVTY 250


>gi|229523210|ref|ZP_04412617.1| tRNA pseudouridine synthase A [Vibrio cholerae TM 11079-80]
 gi|229339573|gb|EEO04588.1| tRNA pseudouridine synthase A [Vibrio cholerae TM 11079-80]
          Length = 264

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQ+   S+Q ++EK++  +    V V  AGRTD+GVH   QV
Sbjct: 1   MRIALGIEYDGTHYYGWQRQREVKSVQEALEKSLSKIANHPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E   V      NA L     I++     V  +FHARFSA  R Y Y I     
Sbjct: 61  VHFDTTAERQMVAWTMGANANL--PKDIAVRWAMAVPDEFHARFSATARRYRYVIYNHVY 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M+ A Q+L+G +DFT+FR++HCQ+ SP R + H +V   G
Sbjct: 119 RPGILNSGVSHYHGELDVEKMQQAGQYLLGENDFTSFRAVHCQSRSPWRNVMHLNVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL  VG G+     ++  L  +DR      A   GLY 
Sbjct: 179 RYVVIDIKANAFVHHMVRNITGSLIAVGCGEQKPEWIQWLLAQKDRTLAAATAKAGGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|78221826|ref|YP_383573.1| tRNA pseudouridine synthase A [Geobacter metallireducens GS-15]
 gi|78193081|gb|ABB30848.1| tRNA pseudouridine synthase [Geobacter metallireducens GS-15]
          Length = 256

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +++EY+G+ Y GWQ Q NG S+Q  +E+A+  +  E V VH +GRTD+GVHA   
Sbjct: 13  MHTIKLVLEYDGTNYAGWQIQPNGISVQQVVEEALARLLKEPVRVHSSGRTDAGVHARGM 72

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   +          LNA L     I+++        F+ RF A  + Y Y I   +
Sbjct: 73  VAAFTTAKGLPMRAFSDGLNALL--PPDIAVMEALEAPDGFNPRFDAAGKHYRYTIHRGE 130

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +   W   ++LD   M   A H+VG HDF +FR+  C A + +R ID  D+   
Sbjct: 131 RRSPLCRHYVWHARETLDLAAMEKGASHMVGEHDFASFRTAGCAARTTVRRIDAVDLALE 190

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+L+ I V    FL   +R  VG+L  VG G+ ++ D+    +    +  GP APP+GL 
Sbjct: 191 GDLLHIDVKGSGFLRNMVRIMVGTLVEVGRGRRSADDVALLFRYPGERFAGPTAPPQGLC 250

Query: 241 FDSVEY 246
              V Y
Sbjct: 251 LMEVYY 256


>gi|52841533|ref|YP_095332.1| tRNA pseudouridine synthase A [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54297221|ref|YP_123590.1| tRNA pseudouridine synthase A [Legionella pneumophila str. Paris]
 gi|148358844|ref|YP_001250051.1| tRNA pseudouridine synthase A [Legionella pneumophila str. Corby]
 gi|296106890|ref|YP_003618590.1| tRNA pseudouridine synthase A [Legionella pneumophila 2300/99
           Alcoy]
 gi|62901237|sp|Q5X5Q4|TRUA_LEGPA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|62901247|sp|Q5ZVY6|TRUA_LEGPH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166228736|sp|A5IBF5|TRUA_LEGPC RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|52628644|gb|AAU27385.1| tRNA pseudouridine synthase A [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53751006|emb|CAH12417.1| tRNA-pseudouridine synthase I [Legionella pneumophila str. Paris]
 gi|148280617|gb|ABQ54705.1| tRNA pseudouridine synthase A [Legionella pneumophila str. Corby]
 gi|295648791|gb|ADG24638.1| tRNA pseudouridine synthase A [Legionella pneumophila 2300/99
           Alcoy]
          Length = 262

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  +++EY+GS Y GWQ Q    +IQ ++E A+  V    + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALVVEYDGSQYHGWQAQTGLHTIQQAVEFALSKVADSSISVVCAGRTDTGVHATNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD  ++          N +L     I +     + + FHAR+SA+ R Y Y I     
Sbjct: 61  IHFDCEKDRSIRAWIHGANTFL--PKDICVKWGKEMPENFHARYSAVSRRYRYVIYNGAI 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L +G      + LD   M+   Q L+G +DFT+FRS+ CQ+++P+R I    V   G
Sbjct: 119 RPGLLRGNVTWQYRQLDHRLMQQGGQCLLGENDFTSFRSVECQSNTPMRNIHQLQVTRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           +L+ + + A +FLH  +R+  G L  VG GK     ++  L A+DRK     AP  GLY 
Sbjct: 179 DLVVLDITANAFLHHMVRNIAGVLIAVGSGKHPVGWVKDVLNAKDRKLGAETAPSYGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VQVTY 243


>gi|258646072|ref|ZP_05733541.1| tRNA pseudouridine synthase A [Dialister invisus DSM 15470]
 gi|260403447|gb|EEW96994.1| tRNA pseudouridine synthase A [Dialister invisus DSM 15470]
          Length = 246

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 132/246 (53%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGS-SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + Y  I++Y+G+ Y GWQ+QK    +IQG +EK +  +TGE V V GAGRTD+GVH+L Q
Sbjct: 1   MNYRCIVQYDGTRYEGWQKQKRTEETIQGKLEKTLRKITGEEVQVIGAGRTDAGVHSLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F L   W    L  ALN  L     +  +  +     FH+RFS + ++Y YRI T  
Sbjct: 61  VVNFHLKGRWKAEELETALNGDLPDDIALKHMETAEER--FHSRFSTLEKTYRYRIRTST 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                E+   W   KSLD E M+ AA  L+G +DFT+F        S +R I   ++   
Sbjct: 119 EKNVFERRFVWQYGKSLDIEAMKKAAAFLIGTYDFTSFCGNKKMKKSAVRCISGIEMKEI 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              ++I      FL   +R  VG+L  VG+GK  +  +   L+++ R++ G  APP+GL 
Sbjct: 179 KGELQIDFTGDGFLQGMVRILVGTLVEVGEGKRKAESIPAILESKSREKAGFTAPPQGLI 238

Query: 241 FDSVEY 246
             SV Y
Sbjct: 239 LVSVRY 244


>gi|297521911|ref|ZP_06940297.1| tRNA pseudouridine synthase A [Escherichia coli OP50]
          Length = 259

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 5   KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 64

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 65  HFETTALRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 122

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 123 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 182

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 183 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLV 242

Query: 243 SVEY 246
           +V+Y
Sbjct: 243 AVDY 246


>gi|145630935|ref|ZP_01786711.1| tRNA pseudouridine synthase A [Haemophilus influenzae R3021]
 gi|144983402|gb|EDJ90878.1| tRNA pseudouridine synthase A [Haemophilus influenzae R3021]
          Length = 269

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSHIANEKIDIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVAWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVYHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|322418344|ref|YP_004197567.1| tRNA pseudouridine synthase A [Geobacter sp. M18]
 gi|320124731|gb|ADW12291.1| tRNA pseudouridine synthase A [Geobacter sp. M18]
          Length = 250

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 120/246 (48%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQ Q NG ++Q  +E A+  + GE   +H +GRTD+GVHA   
Sbjct: 1   MRNIKLIIEYDGTAYSGWQVQPNGVTVQAVMEDALSRMLGERTPLHASGRTDAGVHARGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   +        + LN  L     I++   + V   FH RF A  + Y Y ++   
Sbjct: 61  VACFKTGKTMPLRAFREGLNTLL--PSDIAVREAAEVPLGFHPRFDAQAKHYRYTMLLDD 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +  AW I   LD E MR A    VG HDF  FR  +C A + +R I   ++   
Sbjct: 119 LRSPLSRHTAWRIKGKLDLEAMRAACTVFVGEHDFAAFRGANCAAKTTVRRIYSMELVQE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
             L+ + +    FL   +R   G+L  VG G+  + D+ + L+  DR+  G   PP+GL 
Sbjct: 179 DRLLHLDIKGSGFLKNMVRIITGTLVDVGQGRLGAADVARLLKGGDRQNAGMTVPPQGLC 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LMRVFY 244


>gi|237732351|ref|ZP_04562832.1| tRNA pseudouridine synthase A [Citrobacter sp. 30_2]
 gi|226907890|gb|EEH93808.1| tRNA pseudouridine synthase A [Citrobacter sp. 30_2]
          Length = 270

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV
Sbjct: 10  HKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANERINVFCAGRTDAGVHGTGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   + 
Sbjct: 70  VHFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H  V  FG
Sbjct: 128 RPAVLGKGVTHYYEPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHIKVERFG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY 
Sbjct: 188 AYVVVDIKANAFVHHMVRNIVGSLMEVGANNQPESWIAELLAARDRTLAAATAKAEGLYL 247

Query: 242 DSVEY 246
            +V+Y
Sbjct: 248 VAVDY 252


>gi|24378608|ref|NP_720563.1| tRNA pseudouridine synthase A [Streptococcus mutans UA159]
 gi|38258780|sp|Q8DWH1|TRUA_STRMU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|24376463|gb|AAN57869.1|AE014860_6 putative tRNA pseudouridine synthase A [Streptococcus mutans UA159]
          Length = 249

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV-TGEIVVVHGAGRTDSGVHALR 59
           MIRY  II Y+G+ + G+QRQ    ++Q  IEK +  + +G+ V +HGAGRTD+GVHA  
Sbjct: 1   MIRYKAIISYDGTNFSGFQRQPQVRTVQEEIEKTLLRLNSGQAVKIHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++     L   L+   +  D I ++ +  V   FHAR+   R++Y + +   
Sbjct: 61  QVIHFDLPQQRDLEKLRFGLDT--QTPDDIDVIQVEQVADDFHARYQKHRKTYEFLVDLG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH--FDV 177
           +    L +  A   P  +D   ++ A + L G HDFT F +      + +RTI     + 
Sbjct: 119 RPKNPLMRHYATHFPYKVDFSVVKAAIKKLRGTHDFTGFTASGTSVENKVRTISRATVEK 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     +++ L++ DR   GP A   
Sbjct: 179 DDKTGFLIFTFTGSGFLYKQVRNMVGTLLKIGNGRMPIDQIDRILESGDRSLAGPTAASN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|84503354|ref|ZP_01001423.1| tRNA pseudouridine synthase A [Oceanicola batsensis HTCC2597]
 gi|84388264|gb|EAQ01215.1| tRNA pseudouridine synthase A [Oceanicola batsensis HTCC2597]
          Length = 255

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 110/250 (44%), Positives = 158/250 (63%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ + GWQRQ +  S+QG+IE A+  +      +  AGRTD+GVHA  Q
Sbjct: 1   MPRYALQVEYHGAPFAGWQRQADQPSVQGAIEAALARLEPGPHTIAAAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA  DL ++W P  L +ALN +L+    ++I   + V + +HARFSA+ R Y++R++ R+
Sbjct: 61  VAQCDLEKDWDPFRLSEALNHHLR-PAPVAIRACARVAEDWHARFSALERRYMFRLLMRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G  W +P  LD E +R  A HLVG HDFTTFRS+ CQA SP++T+D   +   
Sbjct: 120 APATHDAGLVWQVPHRLDPEAIRAGAAHLVGHHDFTTFRSVICQAKSPVKTLDEIRIEEH 179

Query: 181 GNLI----EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                      + ARSFLH Q+RS VG+L+ VG G+W  + + +AL+A+DR  CGP+ PP
Sbjct: 180 DGFSGPELRFHLRARSFLHNQVRSIVGTLERVGAGRWPPSRVAEALEARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLVGVGY 249


>gi|192361259|ref|YP_001982227.1| tRNA pseudouridine synthase A [Cellvibrio japonicus Ueda107]
 gi|190687424|gb|ACE85102.1| tRNA pseudouridine synthase A [Cellvibrio japonicus Ueda107]
          Length = 299

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 135/247 (54%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNG-SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R  + +EY G+ + G+Q Q NG  ++Q S+EKA+ +V  E + +  AGRTD+GVHA  
Sbjct: 28  MRRVALGVEYKGADFHGFQVQPNGVKTVQQSLEKALSIVADEPITLVCAGRTDAGVHATN 87

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD + +       + L  +L   DTI I     V   FHARFSA  R+Y Y +   
Sbjct: 88  QVIHFDTLAQRPLKAWMRGLGPHL--PDTIGIRWAQDVSPGFHARFSAQSRTYRYLMSDG 145

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
            +  AL   +     + LD   MR  A  L+G HDFT+FR+  CQA SP+R I++  +  
Sbjct: 146 ASSPALLHDQVSWSSRPLDVALMRQGAACLIGEHDFTSFRATQCQAKSPVRRIEYLHLVR 205

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G LI + + A +FLH  +R+ VG L  VG G    + +   L A+DR   G  A P GL
Sbjct: 206 RGELIVMEIRANAFLHHMVRNIVGVLMQVGAGFKKPSWVGDVLAARDRTAAGATAKPNGL 265

Query: 240 YFDSVEY 246
           Y  +V+Y
Sbjct: 266 YLVAVDY 272


>gi|157961443|ref|YP_001501477.1| tRNA pseudouridine synthase A [Shewanella pealeana ATCC 700345]
 gi|189030144|sp|A8H305|TRUA_SHEPA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157846443|gb|ABV86942.1| tRNA pseudouridine synthase A [Shewanella pealeana ATCC 700345]
          Length = 261

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 136/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ    ++Q  +EKA+ +V  E + VH AGRTD+GVHA  QV
Sbjct: 1   MRVALGIEYDGSQYFGWQRQAEVDTVQERLEKALSIVANEPIAVHCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N  L   D I++  + +VD +FHARF+A  R Y Y I   Q 
Sbjct: 61  VHFETNAIRKETAWTLGVNVNL--PDNIAVRWVKVVDDEFHARFTATARRYRYMIYNHQL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +      P  +D   M  AAQ+L+G  DFT+FR++HCQ+++P R +   +V   G
Sbjct: 119 RPGILRSGVSHYPGDIDESKMHQAAQYLLGEQDFTSFRAVHCQSNTPFRCVHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VGSL  VG G  +   +E+ L  +DR +    A P GLY 
Sbjct: 179 MYICVDIKANAFLHHMVRNIVGSLLEVGLGNQSVEWIEQLLALKDRNKAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|212637986|ref|YP_002314506.1| Pseudouridylate synthase I [Anoxybacillus flavithermus WK1]
 gi|226708641|sp|B7GJ99|TRUA_ANOFW RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|212559466|gb|ACJ32521.1| Pseudouridylate synthase I [Anoxybacillus flavithermus WK1]
          Length = 246

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 81/247 (32%), Positives = 128/247 (51%), Gaps = 4/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    I Y+G+ + G+Q Q+   ++QG +E+A+ ++  G+ V V+ +GRTD+ VHA  
Sbjct: 1   MRRIKCTIAYDGTNFAGYQIQQQKRTVQGELERALSIIHKGQFVRVYASGRTDATVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD           KALNA L   D + +   S V   FHARFS  ++ Y YR+   
Sbjct: 61  QVIHFDTPLTIPDERWPKALNALL--PDDVIVKEASEVPSSFHARFSVKKKEYRYRVWIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +  +   +   +  P  +    M  A ++L+G HDFT+F S   +    +RTI   +V  
Sbjct: 119 EKNV-FLRHYVYHHPYDVSVPAMNEALRYLIGTHDFTSFCSAKTEVDDKVRTIYEAEVVQ 177

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  +  R+V   FL+  +R  VG++  VG G+  + +++  L+ ++R   G  AP  GL
Sbjct: 178 EGEELIFRLVGNGFLYNMVRIIVGTVLEVGRGERCAEEIKTILEQKNRSVAGKTAPGHGL 237

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 238 YLWHVSY 244


>gi|157829158|ref|YP_001495400.1| tRNA pseudouridine synthase A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933887|ref|YP_001650676.1| tRNA pseudouridine synthase A [Rickettsia rickettsii str. Iowa]
 gi|166228760|sp|A8GU17|TRUA_RICRS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|189030139|sp|B0BVL0|TRUA_RICRO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157801639|gb|ABV76892.1| tRNA pseudouridine synthase A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908974|gb|ABY73270.1| tRNA pseudouridine synthase A [Rickettsia rickettsii str. Iowa]
          Length = 245

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 108/246 (43%), Positives = 150/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE V++ GAGRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTDLAGWQRQAGVMSVQQILEEAIYKFSGEQVILFGAGRTDAGVHAVGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPHKIITAINYF-VRPYAVGVWNCELAPNNFHARFSATSRYYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ SPI+T+   ++   
Sbjct: 120 YPSVIDLNRAWWISSPLDVPAMQQAAAYLLGKHDFTSFRASSCQSKSPIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNIWQAEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F    Y
Sbjct: 240 FVKAAY 245


>gi|260438183|ref|ZP_05791999.1| tRNA pseudouridine synthase A [Butyrivibrio crossotus DSM 2876]
 gi|292809373|gb|EFF68578.1| tRNA pseudouridine synthase A [Butyrivibrio crossotus DSM 2876]
          Length = 250

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 77/245 (31%), Positives = 123/245 (50%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + + Y+G+GY GWQ+Q N  +++  + KA   +  + + + GA RTD+GVH+   V
Sbjct: 1   MRVMLRVAYDGTGYSGWQKQPNAITVEEVLCKACKNLFAQDIDIIGASRTDAGVHSYGNV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A FD+        +  ALN+ L   + I ++    V + FH R    R++Y Y+I   + 
Sbjct: 61  AVFDVDTRIPAEKISYALNSRL--PEDIRVVESRQVSENFHPRHVECRKTYEYKIWNDKF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L +  +     +LD   M  A ++ +G HDFT+F S+  Q  S IR I    V    
Sbjct: 119 ENPLVRYYSHFFYGNLDIGKMNEACRYFIGLHDFTSFCSVGSQVQSKIREIYSISVEKNN 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
            LI IRV    FL+  +R   G+L  VG G+    ++ K +  ++R+  GP AP  GL  
Sbjct: 179 RLITIRVTGNGFLYNMVRIIAGTLIKVGQGQLEPAEIPKIIDGKNRELAGPTAPARGLAL 238

Query: 242 DSVEY 246
             + Y
Sbjct: 239 VEINY 243


>gi|170691065|ref|ZP_02882231.1| tRNA pseudouridine synthase A [Burkholderia graminis C4D1M]
 gi|170144314|gb|EDT12476.1| tRNA pseudouridine synthase A [Burkholderia graminis C4D1M]
          Length = 270

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+GS + GWQ Q +G+++Q  +E+A+       V    AGRTD+GVH L Q
Sbjct: 1   MKRIALGIQYDGSAFCGWQSQPHGNTVQDELERALREFAQTPVHTVVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E   V   +  N +L    TIS+     + + FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELERADVSWVRGTNTFL--PKTISVQWAKPMPEAFHARFSAFERTYYYLLYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +   LD E MR AA HL+G HDF+ FRS  CQA +PI+ +   D+   
Sbjct: 119 VRSPMLAARAGWVHTPLDIEAMRAAAAHLIGEHDFSAFRSSQCQAKTPIKHLHQIDIEQH 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +  R  A +FLH  +R+ +G L  +G  +     + + L ++DR+   P   P+GLY
Sbjct: 179 GDFVHFRFRANAFLHHMVRNLMGCLVYIGKRRRPVEWMAEVLASRDRESAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|152973988|ref|YP_001373505.1| tRNA pseudouridine synthase A [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152022740|gb|ABS20510.1| tRNA pseudouridine synthase A [Bacillus cytotoxicus NVH 391-98]
          Length = 247

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 123/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 1   MERIKCTVAYDGINFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I+ +    ++FHAR+  +++ Y YR++  
Sbjct: 61  QVIHFDTPLSLEEWQWGNALNTLL--PDDIVIVQVEKKTEEFHARYGVVKKEYRYRVLLS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  +D + +R A  + +G HDFT+F S        +RTI   D+  
Sbjct: 119 KTADVFRRNYVYQYPYPIDIQLIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIDLFE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ +  R V   FL+  +R  VG+L  VG GK     + + L  QDR+  G + P  GL
Sbjct: 179 QGDELVFRFVGNGFLYNMVRIIVGTLLSVGQGKVDPDSIPEILAKQDRRFAGKMVPGHGL 238

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 239 YLWQVNYN 246


>gi|294101662|ref|YP_003553520.1| tRNA pseudouridine synthase A [Aminobacterium colombiense DSM
           12261]
 gi|293616642|gb|ADE56796.1| tRNA pseudouridine synthase A [Aminobacterium colombiense DSM
           12261]
          Length = 271

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 90/248 (36%), Positives = 127/248 (51%), Gaps = 4/248 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY  ++ Y+G+ + GWQRQ   +S+Q S+E+A+  +    + +  AGRTD GVH+  QV
Sbjct: 1   MRYAAVVSYDGTAFCGWQRQLGVASVQQSLEEALSKLCATSIPIVAAGRTDGGVHSRGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
             F L   W P  L  A+N YL   +T+ I+ +  V++ F ARF A+ R Y Y I    A
Sbjct: 61  ISFSLPSFWEPRRLVLAINFYL--PETVRIMGVFPVEESFSARFCALWREYRYYIWHGPA 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
                  RAW      D   ++ A ++L G H+F  F  I       +RTI        G
Sbjct: 119 FPPYLAQRAWWNRWQWDKTAVKKACEYLEGTHNFKAFCPIKECPEDTVRTILRIKYLRSG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKAL--QAQDRKECGPLAPPEGL 239
           +L  I V   SFL   +RS VGSL LVG GK     +++ L  + +DR   G  AP  GL
Sbjct: 179 HLSVITVRGNSFLMNMVRSIVGSLDLVGKGKNDPEWIKELLDDEKKDRTYAGMTAPAHGL 238

Query: 240 YFDSVEYS 247
           YF  V Y+
Sbjct: 239 YFWKVCYN 246


>gi|225018926|ref|ZP_03708118.1| hypothetical protein CLOSTMETH_02877 [Clostridium methylpentosum
           DSM 5476]
 gi|224948306|gb|EEG29515.1| hypothetical protein CLOSTMETH_02877 [Clostridium methylpentosum
           DSM 5476]
          Length = 250

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 121/246 (49%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + I YNG+ Y GWQ QKN  ++Q  ++ A+  + G    V G  RTD+GVHA   
Sbjct: 3   MRNLLVKIAYNGAAYHGWQVQKNALTVQEVVQDAVEKLFGRREDVVGCSRTDTGVHANEY 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
             +    ++     + + +N  L   D +++L  + V++ FHAR+    + Y+Y+I   +
Sbjct: 63  FFNMHTEKDIPCRSVMRGMNTLL--PDDVAVLGCTEVEEDFHARYCCTGKEYIYKIWNAE 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +       +    P  LD + +  A +  +G HDF+ F S        +RTI     +  
Sbjct: 121 SRNPFLHRQCLRYPFPLDIQLLNRAMERFLGTHDFSAFCSAGSDVEDRVRTITQAHASRE 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+L+ + V    FL+  +R  VG+L  V +GK +  D+   + ++DR   G  APP GL+
Sbjct: 181 GDLVTLTVRGDGFLYNMVRILVGTLIEVQEGKLSPDDIPSVIASRDRSRAGKTAPPCGLF 240

Query: 241 FDSVEY 246
            + V Y
Sbjct: 241 LNRVFY 246


>gi|149189278|ref|ZP_01867564.1| tRNA pseudouridine synthase A [Vibrio shilonii AK1]
 gi|148836837|gb|EDL53788.1| tRNA pseudouridine synthase A [Vibrio shilonii AK1]
          Length = 267

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 137/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG+ Y+GWQRQ++ SS+Q  +EKA+ +V  + V V  AGRTD+GVH   QV
Sbjct: 1   MKVALGIEYNGANYYGWQRQRDVSSVQEELEKALSIVANQPVEVQCAGRTDAGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+      P      +NA L     I++     V ++FHARFSA  R Y Y I     
Sbjct: 61  VHFESSVIRKPAAWTMGVNANL--PKDIAVRWAKEVHEEFHARFSATARRYRYVIFNHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD E M  A Q+L+G +DFT+FR++HCQ+ SP R I H +V+  G
Sbjct: 119 RPGILSSGISHYHGELDAEKMHQAGQYLLGENDFTSFRAVHCQSRSPWRNIMHLNVSRHG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + I + A +F+H  +R+  GSL +VG G  +   +E  LQ +DRK  G  A  EGLY 
Sbjct: 179 PYVVIDIKANAFVHHMVRNITGSLIVVGKGDQSPEWIEWLLQQKDRKLAGATAKAEGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VDVDY 243


>gi|49474896|ref|YP_032937.1| tRNA pseudouridine synthase A [Bartonella henselae str. Houston-1]
 gi|51316603|sp|Q6G547|TRUA_BARHE RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|49237701|emb|CAF26890.1| tRNA pseudouridine synthase A [Bartonella henselae str. Houston-1]
          Length = 247

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 126/247 (51%), Positives = 163/247 (65%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQ    +IQ ++E+A+F  +G+ + +  AGRTD+GVHA  Q
Sbjct: 1   MPRFKLTLEYDGSNYAGWQRQAELRTIQSALEQALFHFSGQQLTITTAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISIL-NLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH D  + W    +  ALNA+L+       + ++  V   F ARFSAI+R YL++I+ R
Sbjct: 61  VAHVDFEKNWRTHTVRDALNAHLQKQGDNIAILHVQNVPDSFDARFSAIKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++P AL   R W IPK L+ + M  AAQ LVG+HDFTTFRS HCQA SPIRT++  DV  
Sbjct: 121 RSPPALNTKRVWWIPKPLNAQAMHEAAQKLVGKHDFTTFRSAHCQAKSPIRTLERLDVQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH QIRSF GSL  VG G+WT+ DLE AL A+DR  CG +APP GL
Sbjct: 181 EGEEIFLYAQARSFLHHQIRSFAGSLMEVGIGRWTTQDLEAALHAKDRTRCGMVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   VEY
Sbjct: 241 YLTKVEY 247


>gi|323529192|ref|YP_004231344.1| tRNA pseudouridine synthase A [Burkholderia sp. CCGE1001]
 gi|323386194|gb|ADX58284.1| tRNA pseudouridine synthase A [Burkholderia sp. CCGE1001]
          Length = 270

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+GS + GWQ Q +G+++Q  +E+A+       V    AGRTD+GVH L Q
Sbjct: 1   MKRIALGVQYDGSAFCGWQSQPHGNTVQDELERALREFAQTPVQTVVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E   +   +  N++L    T+S+     + + FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELERADISWVRGTNSFL--PKTVSVQWAKPMPEAFHARFSAFERTYYYVLYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  +  SLD + MR AA HL+G HDF+ FRS  CQA +P++ +   D+   
Sbjct: 119 VRSPMLAARAGWVHASLDIDAMREAAVHLIGEHDFSAFRSSQCQAKTPVKHLYQIDIQQQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +  R  A +FLH  +R+ +G L  +G G+     + + L+ +DR+   P   P+GLY
Sbjct: 179 GDFVHFRFRANAFLHHMVRNVMGCLVYIGKGRRPVQWMAEVLEGRDREWAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|167855019|ref|ZP_02477793.1| ribonuclease G [Haemophilus parasuis 29755]
 gi|167853867|gb|EDS25107.1| ribonuclease G [Haemophilus parasuis 29755]
          Length = 262

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 125/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+G  Y GWQRQ+   S+Q  +E+A+ ++      V  AGRTD+GVHA  QV
Sbjct: 1   MKIALGIEYDGRRYCGWQRQQYVDSVQQRLEEALSVIANSSCEVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD          C   NA+L     +       V   FHARFSA+ R Y Y I   + 
Sbjct: 61  VHFDTDVNRPMQSWCLGTNAHLPEDIVVKWAIG--VSDDFHARFSALARRYRYVIYNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+          SLD E M  A Q L+G +DF++FR+  CQ+ +P R + H  V+   
Sbjct: 119 RSAILPKGISHYHYSLDHEKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLIVSRHQ 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I + + A +F+H  +R+ VGSL  VG G      ++  L+ +DR    P A  EGLY 
Sbjct: 179 DYIILDIQANAFVHHMVRNIVGSLIEVGRGDKPVEWIKWLLEKRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VEVIY 243


>gi|127513234|ref|YP_001094431.1| tRNA pseudouridine synthase A [Shewanella loihica PV-4]
 gi|166229835|sp|A3QFC4|TRUA_SHELP RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|126638529|gb|ABO24172.1| tRNA pseudouridine synthase A [Shewanella loihica PV-4]
          Length = 261

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ    S+Q  +E+A+  V  E + +  AGRTD+GVHA  QV
Sbjct: 1   MRVALGIEYDGSRYFGWQRQAEVDSVQAQLERALSFVANEPISIQCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N  L   D I++     VD +FHARF+A  R Y Y I   Q 
Sbjct: 61  VHFETNAVRKESAWTLGVNVNL--PDDIAVRWAKDVDDEFHARFTATARRYRYMIYNHQF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +      P  +D   M  AAQ L+G  DFT+FR+I CQ+++P R +   +V   G
Sbjct: 119 RPGILRSGVSHYPGQIDEAKMHEAAQFLLGEQDFTSFRAIQCQSNTPFRCVHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VGSL  VG G+   + +++ L  +DR +    A P GLY 
Sbjct: 179 MYICVDIKANAFLHHMVRNIVGSLLEVGYGRQPVSWIKELLALKDRTQAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|82703035|ref|YP_412601.1| tRNA pseudouridine synthase A [Nitrosospira multiformis ATCC 25196]
 gi|82411100|gb|ABB75209.1| tRNA pseudouridine synthase A [Nitrosospira multiformis ATCC 25196]
          Length = 351

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 94/245 (38%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  M++EY+GS + GWQ Q  G+++Q ++E A+  + GE + V  AGRTD+GVHA+ QV
Sbjct: 57  VRIAMVLEYDGSNFCGWQSQPGGNTVQDAVEAALSEIAGEAIRVVTAGRTDAGVHAIYQV 116

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E       +  NA L     I++L  S     FHAR+ A+ R YLY ++    
Sbjct: 117 LHFDTRAERPMNAWVRGANALL--PSGIALLWASPTADDFHARYCALERCYLYLLLNHPV 174

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L + R       L  E+M++ AQ LVG HDF+ FR+  CQA SP+RT+   +V   G
Sbjct: 175 RPGLHQHRVGWYHHPLRLESMQMGAQMLVGEHDFSAFRAAACQAKSPVRTLTKLEVTRVG 234

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N++   + A +FLH  +R+ VG L  VG GK+    + K L+   R E  P     GLY 
Sbjct: 235 NMVAFELRANAFLHHMVRNIVGCLVYVGKGKFRPDWIGKLLENGKRSEAAPTFSASGLYL 294

Query: 242 DSVEY 246
             V Y
Sbjct: 295 AGVAY 299


>gi|186473191|ref|YP_001860533.1| tRNA pseudouridine synthase A [Burkholderia phymatum STM815]
 gi|238691329|sp|B2JQE6|TRUA_BURP8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|184195523|gb|ACC73487.1| tRNA pseudouridine synthase A [Burkholderia phymatum STM815]
          Length = 267

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 129/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+G+ + GWQ Q +G ++Q  +E+A+       +    AGRTD+GVH L Q
Sbjct: 1   MTRIALGIQYDGAAFCGWQSQPHGKTVQDELERALREFALTPLQTVVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +       +  NA+L    T+++     +   FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELDRAEFSWVRGTNAFL--PSTVAVQWAKPMPDAFHARFSAFERTYYYALYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +   RA  I   LD + MR AA  L+G HDF+ FRS  CQ+ +P++ +   D+   
Sbjct: 119 VRSPMLASRAGWIHTPLDVDAMREAAACLIGEHDFSAFRSSECQSKTPVKHLYQIDIRPQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I  R  A +FLH  +R+ +G L  VG G++ +  L + L  +DR    P   P+GLY
Sbjct: 179 GDFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPAAWLSEVLHGRDRNRAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|153001275|ref|YP_001366956.1| tRNA pseudouridine synthase A [Shewanella baltica OS185]
 gi|166229834|sp|A6WQ04|TRUA_SHEB8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|151365893|gb|ABS08893.1| tRNA pseudouridine synthase A [Shewanella baltica OS185]
          Length = 261

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+GYFGWQRQ    S+QG +E+A+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGNGYFGWQRQAEVDSVQGQLERALSIVANEPIGVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETNAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M  AAQ L+G  DFT+FR++ CQ+ +P R +   +V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADRMHQAAQALLGEQDFTSFRAVQCQSKTPFRNVHCVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|251799612|ref|YP_003014343.1| tRNA pseudouridine synthase A [Paenibacillus sp. JDR-2]
 gi|247547238|gb|ACT04257.1| tRNA pseudouridine synthase A [Paenibacillus sp. JDR-2]
          Length = 246

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M      + Y+G+ + G+Q Q  G +IQ  IE AI  +TGE +++ G+GRTD+GVHA  Q
Sbjct: 1   MRNIAATVSYDGTDFNGFQSQPYGRTIQQEIELAIKKLTGEDIIILGSGRTDAGVHANGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F             ALN  L     I IL    V + FH+R SA R++Y Y I   +
Sbjct: 61  VFNFLTESTIPAERWAIALNTRL--PKDIVILEAHEVPEAFHSRRSAKRKTYRYTIDMGK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +  A+  P  L+ E M+     LVG HDFT+F SIH      +RTI    +   
Sbjct: 119 FPDVFYRRYAFHHPTPLNVEAMQKGLSFLVGEHDFTSFTSIHSTKPHHVRTIYEAYLERE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G ++ + +    FL+  IR  +G+L  VG GK    D+ + L+ + R   GP A P GL 
Sbjct: 179 GQMLHMYMTGNGFLYNMIRIVMGTLLHVGHGKLKPEDMARILEGRKRSLAGPTAMPHGLM 238

Query: 241 FDSVEY 246
              VEY
Sbjct: 239 LMKVEY 244


>gi|229846251|ref|ZP_04466363.1| tRNA pseudouridine synthase A [Haemophilus influenzae 7P49H1]
 gi|229811255|gb|EEP46972.1| tRNA pseudouridine synthase A [Haemophilus influenzae 7P49H1]
          Length = 269

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EKA+  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKALSCIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNANL--PDDIAVAWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G HDF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGMTHCHLDLDAEKMHQAGQCLLGEHDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 QYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVIY 243


>gi|74312835|ref|YP_311254.1| tRNA pseudouridine synthase A [Shigella sonnei Ss046]
 gi|123759585|sp|Q3YZP3|TRUA_SHISS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|73856312|gb|AAZ89019.1| pseudouridylate synthase I [Shigella sonnei Ss046]
 gi|323168509|gb|EFZ54189.1| tRNA pseudouridine synthase A [Shigella sonnei 53G]
          Length = 270

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG        + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPERWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|85059597|ref|YP_455299.1| tRNA pseudouridine synthase A [Sodalis glossinidius str.
           'morsitans']
 gi|84780117|dbj|BAE74894.1| pseudouridylate synthase I [Sodalis glossinidius str. 'morsitans']
          Length = 271

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+GS Y+GWQRQ+  +S+Q  +E+A+  V  E V V+ AGRTD+GVHA  QV
Sbjct: 10  MKLALGIEYDGSAYYGWQRQQEVASVQACLERALSTVADETVTVYCAGRTDAGVHATGQV 69

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             +NA L     I++  ++ V   FHARFSA  R Y Y I     
Sbjct: 70  VHFDTRSRRPDTAWTLGVNANL--PADIAVRWVAPVTDDFHARFSATARRYRYIIYNHPL 127

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             AL           LD  +M  A Q L+G +DFT+FR++ CQ+ SP R + H  V   G
Sbjct: 128 RPALLGRGLTHYYHPLDAPSMARAGQCLLGENDFTSFRALQCQSRSPWRNVHHLYVTRQG 187

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  VG G    + +   L  +DR + G  A  EGLY 
Sbjct: 188 RYVVVDIKANAFVHHMVRNIVGSLLEVGCGNRPESWIADLLACRDRTQAGATARAEGLYL 247

Query: 242 DSVEY 246
            +V+Y
Sbjct: 248 VAVDY 252


>gi|167624561|ref|YP_001674855.1| tRNA pseudouridine synthase A [Shewanella halifaxensis HAW-EB4]
 gi|189030143|sp|B0TKZ4|TRUA_SHEHH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|167354583|gb|ABZ77196.1| tRNA pseudouridine synthase A [Shewanella halifaxensis HAW-EB4]
          Length = 261

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS YFGWQRQ    ++Q  +EKA+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRVALGIEYDGSQYFGWQRQAEVDTVQERLEKALSIVANEPIAVQCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N  L   D I++  + +VD +FHARF+A  R Y Y I   Q 
Sbjct: 61  VHFETNAVRKDTAWTLGVNVNL--PDNIAVRWVKVVDDEFHARFTATARRYRYMIYNHQL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +      P  +D   M  AAQ+L+G  DFT+FR++ CQ+++P R +   +V+  G
Sbjct: 119 RPGILRSGVSHYPGVIDEAKMHQAAQYLLGEQDFTSFRAVQCQSNTPFRCVHEVNVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VGSL  VG G      +E+ L  +DR +    A P GLY 
Sbjct: 179 MYICVDIKANAFLHHMVRNIVGSLLEVGLGNQPIEWIEQLLALKDRNKAAATAKPNGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|13474062|ref|NP_105630.1| tRNA pseudouridine synthase A [Mesorhizobium loti MAFF303099]
 gi|30913408|sp|Q98D55|TRUA_RHILO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|14024814|dbj|BAB51416.1| tRNA-pseudouridine synthase [Mesorhizobium loti MAFF303099]
          Length = 248

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 129/247 (52%), Positives = 170/247 (68%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IEY+GS + GWQ Q +  S+Q +IE+AI    GE V +  AGRTD+GVHA  Q
Sbjct: 1   MPRFRLDIEYDGSLFAGWQHQADQPSVQQAIEQAIEKFCGEAVRLRAAGRTDAGVHASAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISIL-NLSIVDKQFHARFSAIRRSYLYRIITR 119
           VAH DL + W    +  A+NA+L+ +     +   +IV   F ARFSA  R YLYRI+ R
Sbjct: 61  VAHVDLAKPWPGDKVRDAVNAHLQAAGAHVAILKAAIVPDDFDARFSATGRHYLYRILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +AP ALEKG+ W +PK LD   M  AA+ L+GRHDFTTFRS  CQA+SP+RT++  DV+ 
Sbjct: 121 RAPAALEKGKVWWVPKRLDAGAMHEAAKLLLGRHDFTTFRSTQCQANSPVRTLERLDVSR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G++IE+R  ARSFLH Q+RS VGSLK VGDG WT  +L+ AL+A+DR  CG +APP+GL
Sbjct: 181 AGDMIEVRASARSFLHNQVRSMVGSLKRVGDGGWTEAELKAALEARDRAACGQVAPPDGL 240

Query: 240 YFDSVEY 246
           +   V+Y
Sbjct: 241 FLIGVDY 247


>gi|291279383|ref|YP_003496218.1| tRNA pseudouridine synthase A [Deferribacter desulfuricans SSM1]
 gi|290754085|dbj|BAI80462.1| tRNA pseudouridine synthase A [Deferribacter desulfuricans SSM1]
          Length = 244

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +   ++EY+G+ +FGWQRQK+  ++QG IE A+  +    + + G+GRTD+GVHA+ Q
Sbjct: 1   MYKKKCVVEYDGTYFFGWQRQKDLRTVQGVIEAALSKIYKSSINIVGSGRTDTGVHAVGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF   R      +   LN+ L   + + I ++  VD  FHA+ SAI ++Y+Y+I   Q
Sbjct: 61  VFHFVSERYLENRSVLLGLNSVL--PEDVVIKHVEDVDLSFHAQKSAISKTYIYKIYNYQ 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL + RAW I  ++D + +    +   G  DF+          +P+RTI++      
Sbjct: 119 IRSALFRNRAWWIRDNIDVDLLNEYLKFFKGEKDFSAMCLKRSVPENPVRTINYIFAKRD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I I + A  FLH  +R+ VG++  +     +   +E+ L+++DRK  G  APP+GLY
Sbjct: 179 GDFINIEINANGFLHNMVRNIVGTVIDLYSDNSSPEKIEEILKSKDRKNAGRTAPPQGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LKEVFY 244


>gi|40063298|gb|AAR38116.1| tRNA pseudouridine synthase A [uncultured marine bacterium 578]
          Length = 247

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 136/246 (55%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNG-SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           ++  + +EY G+ + GWQ QK+G  ++Q  +E A+ LV    V V   GRTDSGVHA  Q
Sbjct: 1   MKIALGVEYLGTNFNGWQIQKSGIRTVQEVVESALSLVANHPVRVFCCGRTDSGVHAKEQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+              N  L     ++      VD  FHARF+A  RSY Y+I    
Sbjct: 61  VIHFETDSNRSNEAWVFGGNVNL--PSDVNFSWAKDVDDDFHARFNAYARSYEYKIHNHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              +L        P+SL+ + MR AA  L+G HDF++FR   CQA SP++T+++ D+   
Sbjct: 119 VRSSLNANYYLWEPRSLNIDEMRKAANFLIGEHDFSSFRGRLCQAKSPVKTVEYLDIIES 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + + +++ A +FLH  +R+ VG+L  +G G+  +  +   L+++DR+E GP A P+GLY
Sbjct: 179 DDNLIVKIKANAFLHHMVRNIVGTLLKIGRGERDAEWMLSVLESKDRREAGPTAEPQGLY 238

Query: 241 FDSVEY 246
           F    Y
Sbjct: 239 FIKAYY 244


>gi|197117301|ref|YP_002137728.1| tRNA pseudouridine synthase A [Geobacter bemidjiensis Bem]
 gi|238690881|sp|B5EFM8|TRUA_GEOBB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|197086661|gb|ACH37932.1| tRNA pseudouridines 38,39,40 synthase [Geobacter bemidjiensis Bem]
          Length = 250

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 86/247 (34%), Positives = 124/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQ Q NG ++Q  +++A+  + GE   +HG+GRTD+GVHA   
Sbjct: 1   MRNIKLIIEYDGTAYCGWQVQPNGRTVQEVLQEALAAMLGEKTPLHGSGRTDAGVHARGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   +        + LN  L     I++     V  +FH RF A  + Y Y I+   
Sbjct: 61  VACFKTDKAMPLRAFREGLNCLL--PGDIAVREACEVPLEFHPRFDAHAKHYRYTILLDD 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +   W +   LD + MR A    VG HDF  FR+ +C A + +R I   D+   
Sbjct: 119 LRSPLSRLTVWRLKGKLDIQAMRAACAAFVGEHDFAAFRASNCAAKTTVRRIYSMDLVQE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKE-CGPLAPPEGL 239
           G L+ + V    FL   +R   G+L  VG GK +  D+ + LQ  DR++  G   PP+GL
Sbjct: 179 GCLLHLDVKGSGFLKNMVRIITGTLIEVGQGKKSVEDVARLLQGGDRQQNSGMTVPPQGL 238

Query: 240 YFDSVEY 246
               V Y
Sbjct: 239 CLMQVYY 245


>gi|259500923|ref|ZP_05743825.1| tRNA pseudouridine synthase A [Lactobacillus iners DSM 13335]
 gi|302190624|ref|ZP_07266878.1| tRNA pseudouridine synthase A [Lactobacillus iners AB-1]
 gi|309803645|ref|ZP_07697735.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 11V1-d]
 gi|309804945|ref|ZP_07699003.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 09V1-c]
 gi|309806696|ref|ZP_07700691.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 03V1-b]
 gi|309808529|ref|ZP_07702428.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 01V1-a]
 gi|312871160|ref|ZP_07731258.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 3008A-a]
 gi|312872668|ref|ZP_07732733.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 2062A-h1]
 gi|315653995|ref|ZP_07906911.1| tRNA pseudouridine synthase A [Lactobacillus iners ATCC 55195]
 gi|259167617|gb|EEW52112.1| tRNA pseudouridine synthase A [Lactobacillus iners DSM 13335]
 gi|308164243|gb|EFO66500.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 11V1-d]
 gi|308165705|gb|EFO67930.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 09V1-c]
 gi|308166876|gb|EFO69060.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 03V1-b]
 gi|308168357|gb|EFO70476.1| tRNA pseudouridine synthase A [Lactobacillus iners LactinV 01V1-a]
 gi|311091710|gb|EFQ50089.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 2062A-h1]
 gi|311093174|gb|EFQ51520.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 3008A-a]
 gi|315488691|gb|EFU78337.1| tRNA pseudouridine synthase A [Lactobacillus iners ATCC 55195]
          Length = 260

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 89/248 (35%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY +I+ Y+G+ + G+Q+Q N  +IQG IE A+  +T G+ V+VHG+GRTD+GVHA  
Sbjct: 1   MQRYKLILAYDGTLFHGFQKQPNQRTIQGVIEDALLKMTKGKHVIVHGSGRTDAGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCK-ALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
           QV HFD     +P      ALNA   +   I  L+  +V+  FH ++S   + Y Y I  
Sbjct: 61  QVIHFDYPGNVIPAKNMLLALNAL--MPRDIIFLDSELVNDDFHVQYSTKAKWYRYIINQ 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            +      +      P  LD   M+ AA +L+G+HDFT+F +   Q    +RTI + ++ 
Sbjct: 119 SRFTDPFRRNYTGHCPYKLDMLKMKKAATYLLGKHDFTSFAASGGQIVDKVRTIFYINLE 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I + V+   FL+  +R   G L  +G G+    D+EK + A+DR++    AP  G
Sbjct: 179 QNGDEIVLDVIGDGFLYNMVRIITGLLIDIGHGQKDVEDVEKIILAKDRQKARNTAPASG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLYHVFY 246


>gi|254253654|ref|ZP_04946971.1| Pseudouridylate synthase [Burkholderia dolosa AUO158]
 gi|124898299|gb|EAY70142.1| Pseudouridylate synthase [Burkholderia dolosa AUO158]
          Length = 271

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R  + I+Y+G+ + GWQ Q +G ++Q ++E+A+       +    AGRTD+GVH L Q
Sbjct: 1   MMRIALGIQYDGAAFCGWQSQPHGKTVQDALERALAEFARVPLHTTVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +       +  NA+L  S  +       +   FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTDLDRADFSWVRGTNAFLPPSVAVQW--AKPMPDTFHARFSAFERTYYYALYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +  GRA  +   LD + MR AA HL+G HDF++FRS  CQ+ +P++ +   DV   
Sbjct: 119 VRSPMLAGRAGWVHTPLDDDAMRAAAAHLIGEHDFSSFRSSECQSKTPVKHLYQIDVRRS 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I  R  A +FLH  +R+ +G L  VG G++ +  +   L  +DR    P    +GLY
Sbjct: 179 GHFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPADWVADVLAGRDRDLAAPTFMADGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAHVGY 244


>gi|238651103|ref|YP_002916961.1| tRNA pseudouridine synthase A [Rickettsia peacockii str. Rustic]
 gi|259550439|sp|C4K2W2|TRUA_RICPU RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|238625201|gb|ACR47907.1| tRNA pseudouridine synthase A [Rickettsia peacockii str. Rustic]
          Length = 245

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 107/246 (43%), Positives = 150/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE V++ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTDLAGWQRQAGVMSVQQILEEAIYKFSGEQVILFGSGRTDAGVHAVGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPHKIITAINYF-ARPYAVGVWNCELAPNNFHARFSATSRYYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ SPI+T+   ++   
Sbjct: 120 CPSVIDLNRAWWISSPLDVPAMQQAAAYLLGKHDFTSFRASSCQSKSPIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNIWQAEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F    Y
Sbjct: 240 FVKAAY 245


>gi|255654196|ref|ZP_05399605.1| tRNA pseudouridine synthase 1 [Clostridium difficile QCD-23m63]
 gi|296449765|ref|ZP_06891534.1| tRNA-pseudouridine synthase I [Clostridium difficile NAP08]
 gi|296877828|ref|ZP_06901851.1| tRNA-pseudouridine synthase I [Clostridium difficile NAP07]
 gi|296261363|gb|EFH08189.1| tRNA-pseudouridine synthase I [Clostridium difficile NAP08]
 gi|296431170|gb|EFH16994.1| tRNA-pseudouridine synthase I [Clostridium difficile NAP07]
          Length = 243

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 128/246 (52%), Gaps = 3/246 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + I+YNG  Y GWQ+Q +   IQG+IE+AI+ +T E V + G+GRTDSGVHA+ Q
Sbjct: 1   MRNIKITIQYNGKNYCGWQKQLDSLGIQGTIERAIYDITKEKVSLIGSGRTDSGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +A+F          +  ALNA L     IS+++   V+  FH+R+SA  ++Y Y +   +
Sbjct: 61  IANFKTNSSISIESIPMALNAKL--PKDISVIDACEVNDDFHSRYSAKGKTYKYLVYNSK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +    ++ +   LD + M   A+ L+G HDF  F S        +RTI   D+   
Sbjct: 119 FRNPILSEISYQVKYELDFDKMCSEAKLLLGTHDFKGFMSSGSSVKDTVRTIYDIDIIRK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +LI   +    FL+  +R  VG+L  +G G+         +Q++ R  CG  AP +GL+
Sbjct: 179 DDLITFEISGNGFLYNMVRIIVGTLVDIGRGRIN-EPFLDIIQSKTRSRCGHTAPAQGLF 237

Query: 241 FDSVEY 246
              V Y
Sbjct: 238 LKKVHY 243


>gi|323703112|ref|ZP_08114766.1| tRNA pseudouridine synthase A [Desulfotomaculum nigrificans DSM
           574]
 gi|323531889|gb|EGB21774.1| tRNA pseudouridine synthase A [Desulfotomaculum nigrificans DSM
           574]
          Length = 245

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 130/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGS-SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M    + I+Y+GS Y GWQR  +   +IQG IE  +  +TGE + + G+GRTD+GVHAL 
Sbjct: 1   MRNIKLTIQYDGSRYRGWQRLGDTDVTIQGKIEAVLSRMTGEEIEIFGSGRTDTGVHALA 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QVA+F          +   L  YL   + I +  +  V  +FHAR++   + YLY+I   
Sbjct: 61  QVANFKTNSNMSTGEIMDYLYHYL--PEDIVVTRVEEVSDRFHARYNVKSKKYLYKIWNH 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +     +P+ L  + M+ AA  L+G HDF +FR+   +  S ++TI   D+  
Sbjct: 119 KYHDPFRRKFVHHVPEPLQIKAMQKAAAFLIGEHDFASFRASKSKKKSSVKTIYAIDIVK 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              LI+I V    FLH  +R  VG+L  VG G      +++ L  +DR   GP AP +GL
Sbjct: 179 KDPLIKITVHGNGFLHNMVRIIVGTLVEVGLGHMRPEQVKEILSKKDRSAAGPTAPAKGL 238

Query: 240 YFDSVEY 246
           Y   VEY
Sbjct: 239 YLLEVEY 245


>gi|126663837|ref|ZP_01734832.1| tRNA pseudouridine synthase A [Flavobacteria bacterium BAL38]
 gi|126624101|gb|EAZ94794.1| tRNA pseudouridine synthase A [Flavobacteria bacterium BAL38]
          Length = 248

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 116/245 (47%), Gaps = 4/245 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY +   YNG  + G+Q Q + SS+Q ++EKA+  +  E + + GAGRTDSGVHA +  
Sbjct: 1   MRYFIEFAYNGKNFHGFQSQPDASSVQETLEKALSTLFREKIAIVGAGRTDSGVHAKQMY 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHF+   E         LN++L  S  +    +  V    HARF A  R+Y Y + T + 
Sbjct: 61  AHFETELELDSEYWSHKLNSFLPPSIVVYR--IFKVTDNAHARFDASSRTYEYYMHTFKD 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
               +         +LD   M  A   L   +DF  F  +H   ++    I        G
Sbjct: 119 AFITDGSWYHSHQLNLD--KMNEACAILFEYNDFECFSKVHTDVNTFNCKISEAHWKQVG 176

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N +   + A  FL   +R+ VG++  +G GK    DL   +++++R + G   P  GLY 
Sbjct: 177 NQLIFTITADRFLRNMVRAIVGTMVNIGLGKIEVADLRTIIESKNRGKAGFSVPAHGLYL 236

Query: 242 DSVEY 246
            +V Y
Sbjct: 237 VNVRY 241


>gi|325913236|ref|ZP_08175605.1| tRNA pseudouridine synthase A [Lactobacillus iners UPII 60-B]
 gi|325477500|gb|EGC80643.1| tRNA pseudouridine synthase A [Lactobacillus iners UPII 60-B]
          Length = 260

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 89/248 (35%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY +I+ Y+G+ + G+Q+Q N  +IQG IE A+  +T G+ V+VHG+GRTD+GVHA  
Sbjct: 1   MQRYKLILAYDGTLFHGFQKQPNQRTIQGVIEDALLKMTKGKHVIVHGSGRTDAGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCK-ALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
           QV HFD     +P      ALNA   +   I  L+  +V+  FH ++S   + Y Y I  
Sbjct: 61  QVIHFDYPGNVIPAKNMLLALNAL--MPRDIIFLDSELVNDDFHVQYSTKAKWYRYIINQ 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            +      +      P  LD   M+ AA +L+G+HDFT+F +   Q    +RTI + ++ 
Sbjct: 119 SRFTDPFRRNYTGHCPYKLDMLKMKKAATYLLGKHDFTSFAASGGQIVDKVRTIFYINLE 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I + V+   FL+  +R   G L  +G G+    D+EK + A+DR++    AP  G
Sbjct: 179 QHGDEIVLDVIGDGFLYNMVRIITGLLIDIGHGQKDVEDVEKIILAKDRQKARNTAPASG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLYHVFY 246


>gi|90419798|ref|ZP_01227707.1| tRNA pseudouridine synthase A [Aurantimonas manganoxydans SI85-9A1]
 gi|90335839|gb|EAS49587.1| tRNA pseudouridine synthase A [Aurantimonas manganoxydans SI85-9A1]
          Length = 259

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 136/247 (55%), Positives = 166/247 (67%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IEY+G+ Y GWQRQK   S Q  IE A+   TGE   +  AGRTD+GVHA  Q
Sbjct: 1   MPRFKLTIEYDGTPYCGWQRQKTDLSAQEVIETAVEGFTGEAATLFAAGRTDAGVHASGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R+W P  +  ALNA+L+    ++IL+   V   F ARFSA +R YLYRI  R+
Sbjct: 61  VAHVDLRRDWEPDTVRDALNAHLR-DAPVAILSAERVADDFDARFSARKRFYLYRIFNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS- 179
           AP AL  GR W + K LD + M  AAQ LVG HDF TFRS HCQA +PIRT++  DV   
Sbjct: 120 APTALLIGRVWWVSKPLDVDAMHAAAQRLVGTHDFDTFRSAHCQAKNPIRTLEQLDVVRG 179

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I I  +A+SFLH QIRSF GSLKLVG+G W++ DL  AL+A+DRK CGP+APP+GL
Sbjct: 180 PGEEIHIHAMAQSFLHNQIRSFAGSLKLVGEGHWSAADLVAALEARDRKRCGPVAPPDGL 239

Query: 240 YFDSVEY 246
           Y   VEY
Sbjct: 240 YLTRVEY 246


>gi|194429433|ref|ZP_03061956.1| tRNA pseudouridine synthase A [Escherichia coli B171]
 gi|194412494|gb|EDX28793.1| tRNA pseudouridine synthase A [Escherichia coli B171]
 gi|195183057|dbj|BAG66617.1| pseudouridylate synthase I [Escherichia coli O111:H-]
          Length = 270

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG        + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPECWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|300776045|ref|ZP_07085904.1| tRNA-pseudouridine synthase I [Chryseobacterium gleum ATCC 35910]
 gi|300505178|gb|EFK36317.1| tRNA-pseudouridine synthase I [Chryseobacterium gleum ATCC 35910]
          Length = 250

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 86/244 (35%), Positives = 122/244 (50%), Gaps = 4/244 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           RY +   YNG  YFG+Q Q +  S+Q  +EKA+  +  E +   GAGRTD+GVHA +  A
Sbjct: 9   RYFIEFSYNGKNYFGYQIQPDAISVQEELEKALSTILREEIKTTGAGRTDTGVHAKKIFA 68

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HFD  +E +   L + LN++L     ISI  +  V   FHARF A  R+Y Y I   + P
Sbjct: 69  HFDTEKE-LDDQLPRRLNSFL--PPDISIKRIFPVKDDFHARFDATYRTYEYYISLEKNP 125

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
              E        +SLD + M  A + L    DFT+F  +     + I  I   +    G 
Sbjct: 126 FTQESA-WQHWKRSLDVDAMNEACKILFEYEDFTSFAKLKTDNKTNICKIYKAEWEQNGA 184

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            ++  V A  FL   +R+ VG++  +G GK    DL K ++ ++R   G  AP  GLY  
Sbjct: 185 ELKFTVSANRFLRNMVRAIVGTMVEIGTGKLKPEDLRKVIEDKNRNAAGTSAPGHGLYLV 244

Query: 243 SVEY 246
            V Y
Sbjct: 245 DVGY 248


>gi|323161584|gb|EFZ47470.1| tRNA pseudouridine synthase A [Escherichia coli E128010]
          Length = 270

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 90/244 (36%), Positives = 129/244 (52%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 11  KIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 70

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I   +  
Sbjct: 71  HFETTAQRKDAAWTLGVNANL--PGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLR 128

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V   G 
Sbjct: 129 PAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGP 188

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG        + + L A+DR      A  EGLY  
Sbjct: 189 YVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPECWIAELLAAKDRTLAAATAKAEGLYLV 248

Query: 243 SVEY 246
           +V+Y
Sbjct: 249 AVDY 252


>gi|16801808|ref|NP_472076.1| tRNA pseudouridine synthase A [Listeria innocua Clip11262]
 gi|24212565|sp|Q927P1|TRUA_LISIN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|16415283|emb|CAC97973.1| truA [Listeria innocua Clip11262]
 gi|313616961|gb|EFR89587.1| tRNA pseudouridine synthase A [Listeria innocua FSL S4-378]
          Length = 248

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 125/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG+FG+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFFGYQVQPNTRTVQAEIEKALEKMHKGKSVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +      FHARF  + + Y Y I   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEAPADFHARFGTVGKEYRYVIKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M+ A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDIAKMKQASERLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
                  I      FL+  +R   G+L   G G+ +  D+ KAL A DR++     APP+
Sbjct: 179 EDAETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDITKALLAHDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|77358715|ref|YP_338281.1| tRNA pseudouridine synthase A [Coxiella burnetii RSA 493]
 gi|153206765|ref|ZP_01945606.1| tRNA pseudouridine synthase A [Coxiella burnetii 'MSU Goat Q177']
 gi|154705837|ref|YP_001424337.1| tRNA pseudouridine synthase A [Coxiella burnetii Dugway 5J108-111]
 gi|161830159|ref|YP_001596814.1| tRNA pseudouridine synthase A [Coxiella burnetii RSA 331]
 gi|165918506|ref|ZP_02218592.1| tRNA pseudouridine synthase A [Coxiella burnetii RSA 334]
 gi|212212657|ref|YP_002303593.1| tRNA pseudouridine synthase A [Coxiella burnetii CbuG_Q212]
 gi|212218370|ref|YP_002305157.1| tRNA pseudouridine synthase A [Coxiella burnetii CbuK_Q154]
 gi|226708643|sp|B6J6W3|TRUA_COXB1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708644|sp|B6J0H0|TRUA_COXB2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708645|sp|A9KFZ5|TRUA_COXBN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|226708646|sp|A9ND24|TRUA_COXBR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|71066705|gb|AAZ22627.1| tRNA pseudouridine synthase A [Coxiella burnetii RSA 493]
 gi|120577128|gb|EAX33752.1| tRNA pseudouridine synthase A [Coxiella burnetii 'MSU Goat Q177']
 gi|154355123|gb|ABS76585.1| tRNA pseudouridine synthase A [Coxiella burnetii Dugway 5J108-111]
 gi|161762026|gb|ABX77668.1| tRNA pseudouridine synthase A [Coxiella burnetii RSA 331]
 gi|165917752|gb|EDR36356.1| tRNA pseudouridine synthase A [Coxiella burnetii RSA 334]
 gi|212011067|gb|ACJ18448.1| tRNA pseudouridine synthase A [Coxiella burnetii CbuG_Q212]
 gi|212012632|gb|ACJ20012.1| tRNA pseudouridine synthase A [Coxiella burnetii CbuK_Q154]
          Length = 261

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I Y+GS Y GWQ Q+   ++QG +EKA+  V    V V  AGRTD+GVHA  Q
Sbjct: 1   MARIALGIRYDGSAYHGWQVQEALKTVQGEVEKALSAVANHPVFVTCAGRTDAGVHASAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD              N+ L     ISIL    V++ FHAR+SA+ R Y Y +   +
Sbjct: 61  VAHFDTTAYRSDHAWVFGANSNL--PHDISILWAKAVEEDFHARYSAMARRYRYIVYNHE 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+ +       + LD + M+  AQ+L+G HDF++F+   CQ+ +P+R I   ++   
Sbjct: 119 IRPAILRKAIGWHYRPLDEKRMQAGAQYLIGEHDFSSFQGAGCQSRTPVRKIFQIEIYRI 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
             ++ I V A +FL   +R+  G L  +G G+      +  L+A+DR++ G   PP GLY
Sbjct: 179 RRMVVIEVQANAFLLHMVRNIAGVLIAIGSGEKHPDWAQTVLKAKDRRQGGVTVPPNGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVEVNY 244


>gi|15604687|ref|NP_221205.1| tRNA pseudouridine synthase A [Rickettsia prowazekii str. Madrid E]
 gi|3861382|emb|CAA15281.1| PSEUDOURIDYLATE SYNTHASE I (truA) [Rickettsia prowazekii]
          Length = 253

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 111/246 (45%), Positives = 152/246 (61%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+ + GWQRQ    S+Q  +E+AI+  + E V + G+GRTD+GVHA+ Q
Sbjct: 9   MYRYKITIEYLGTHFAGWQRQAGVLSVQQILEEAIYKFSSEQVTLFGSGRTDAGVHAIGQ 68

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  + KA+N +      + + N  +V   FHARFSAI R Y+YRII R 
Sbjct: 69  VAHFDLSKYLEPYKIIKAINYF-VRPYDVGVWNCELVSNNFHARFSAISRHYIYRIINRT 127

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FRS  CQ+ SPI+T+   ++   
Sbjct: 128 YPSVIDFNRAWWISSPLDILAMQKAAAYLLGKHDFTSFRSSSCQSKSPIKTLTEINIIKE 187

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L A+DRK  GP AP  GLY
Sbjct: 188 YEEIKLYISAPSFLHYMVRNIVGSLVLVGKNIWQAEQIKNVLDARDRKIAGPTAPAFGLY 247

Query: 241 FDSVEY 246
           F   EY
Sbjct: 248 FIKAEY 253


>gi|51340814|sp|Q814C2|TRUA1_BACCR RecName: Full=tRNA pseudouridine synthase A 1; AltName: Full=tRNA
           pseudouridylate synthase I 1; AltName: Full=tRNA-uridine
           isomerase I 1
          Length = 247

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q N  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 1   MDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 61  QVIHFDTPLSLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 119 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 179 QDDEIIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 238

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 239 YLWEVNYN 246


>gi|294085062|ref|YP_003551822.1| Pseudouridylate synthase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664637|gb|ADE39738.1| Pseudouridylate synthase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 254

 Score =  188 bits (476), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 120/247 (48%), Positives = 153/247 (61%), Gaps = 2/247 (0%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R   + IEY+G+ + GWQRQ NG ++Q  +E+A F  TGE + V GAGRTDSGVHAL 
Sbjct: 1   MTRRIFITIEYDGAPFVGWQRQDNGITVQQELEEAAFAFTGEKINVQGAGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QVAH D+  ++ P  + +ALNA+L  +    +     V    HARFSAI R YLYRI+ R
Sbjct: 61  QVAHLDVPEKFAPNRVMEALNAHLSHTAISVLDAY-EVPDDAHARFSAIGRRYLYRILPR 119

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P AL+ GR W   + LD + M+  A  L+GRHDF +FR+  CQA S IRT+D   V  
Sbjct: 120 RQPPALDAGRVWHHKQPLDADAMQAGADMLIGRHDFNSFRAAQCQAESSIRTLDILQVEQ 179

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
               I + V ARSFLH Q+R+  G+L LVG GKW   D++ AL A DR   GP APP GL
Sbjct: 180 VSAEIHLHVEARSFLHHQVRNIAGTLALVGTGKWQPDDVKAALAAADRSAAGPTAPPHGL 239

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 240 YLTDVFY 246


>gi|167767146|ref|ZP_02439199.1| hypothetical protein CLOSS21_01665 [Clostridium sp. SS2/1]
 gi|167711121|gb|EDS21700.1| hypothetical protein CLOSS21_01665 [Clostridium sp. SS2/1]
 gi|291559527|emb|CBL38327.1| pseudouridylate synthase I [butyrate-producing bacterium SSC/2]
          Length = 248

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 96/250 (38%), Positives = 135/250 (54%), Gaps = 6/250 (2%)

Query: 1   MIR-YCMIIEYNGSGYFGWQR---QKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M R   + IEY+GS Y GWQR     N ++IQG +E  +  +TGE V ++G+GRTD+GVH
Sbjct: 1   MKRNIRLTIEYDGSRYQGWQRLGGDSNANTIQGKLESVLSKMTGEDVNINGSGRTDAGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A  QVA+F          +   L  YL     I I+ +S   ++FH+R +A  ++YLYRI
Sbjct: 61  AYGQVANFHTDCMMSVSEIKNYLTKYL--PSDIGIVEVSEASERFHSRLNAKEKTYLYRI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
                    E+   W  P++LD + M  AA  L+G HDF  F SI     S +RTI + +
Sbjct: 119 AIPGVSNVFERKYLWYFPETLDIKKMEEAASLLIGTHDFKGFSSIKKTKKSTVRTIYNIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
           +      I+I      FLH  +R   G+L  VG GK    D+ KAL++  R + G  APP
Sbjct: 179 IKKTKKEIQISYTGNGFLHNMVRILTGTLVEVGCGKIKPEDITKALESTKRSDAGITAPP 238

Query: 237 EGLYFDSVEY 246
           +GL+  SVEY
Sbjct: 239 QGLFLVSVEY 248


>gi|297620615|ref|YP_003708752.1| tRNA pseudouridine synthase A [Waddlia chondrophila WSU 86-1044]
 gi|297375916|gb|ADI37746.1| tRNA pseudouridine synthase A [Waddlia chondrophila WSU 86-1044]
          Length = 254

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 135/249 (54%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +Y +II Y+G+ Y GWQ Q N  SIQ  +E+ + ++T     + GAGRTD+GVHA+ Q
Sbjct: 1   MKKYKLIIAYDGTQYSGWQMQPNALSIQEVLEEKLKVLTKTRTSLTGAGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHF +   + P +L  +LN    +   I I+++  V   FHAR+SA  + Y Y +    
Sbjct: 61  VAHFKVEAPFNPSLLRLSLNG--LLPKDIRIMDVEEVPLDFHARYSATNKIYYYHLNLGP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTF---RSIHCQASSPIRTIDHFDV 177
                EK  +W I  SL+ E ++    +L+G H+F+ F    +      +PIRT+    V
Sbjct: 119 VQDPFEKQYSWNITNSLNMELLKKGISYLIGTHNFSAFANEANQGAAKKNPIRTLKRISV 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                 + +     SFL+  +R+  G+L  V  GK +  +++K L+++DR+  G  AP +
Sbjct: 179 VPERIGMRLEFEGESFLYKMVRNMTGTLIDVAKGKLSPEEIKKILESKDRRNAGRAAPAK 238

Query: 238 GLYFDSVEY 246
           GL+   ++Y
Sbjct: 239 GLFLVRIDY 247


>gi|40062661|gb|AAR37582.1| tRNA pseudouridine synthase A [uncultured marine bacterium 313]
          Length = 245

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 156/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQ QKNG SIQ  ++ AIF  + E VVV GAGRTDSGVHAL Q
Sbjct: 1   MQRYKIKIEYDGTPFVGWQFQKNGQSIQEVLQNAIFNFSKEKVVVTGAGRTDSGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL ++         +N ++       +       K+FHARF A +R+Y Y II RQ
Sbjct: 61  VAHFDLKKKIKKKSFLPGINQHIGNKPVTVLKINK-TSKKFHARFDAKKRTYQYTIINRQ 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +PL L+K +AW I K LD   M+  A+ L+G HDF+TFR+  C A SPI+T+++  +   
Sbjct: 120 SPLTLQKNKAWHIRKKLDVRAMKKGAKLLLGTHDFSTFRASSCGAKSPIKTMENISIKKN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I ++ ++RSFL  Q+RS VG +K +GDGKW   D +K+ +++ R EC P AP  GLY
Sbjct: 180 KDKITLKFISRSFLQQQVRSMVGCIKYLGDGKWKLEDFKKSFKSKCRLECAPPAPASGLY 239

Query: 241 FDSVEY 246
              ++Y
Sbjct: 240 LAKIKY 245


>gi|309809150|ref|ZP_07703023.1| tRNA pseudouridine synthase A [Lactobacillus iners SPIN 2503V10-D]
 gi|308170595|gb|EFO72615.1| tRNA pseudouridine synthase A [Lactobacillus iners SPIN 2503V10-D]
          Length = 260

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 89/248 (35%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY +I+ Y+G+ + G+Q+Q N  +IQG IE A+  +T G+ V+VHG+GRTD+GVHA  
Sbjct: 1   MQRYKLILAYDGTLFHGFQKQPNQRTIQGVIEDALLKMTKGKHVIVHGSGRTDAGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCK-ALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
           QV HFD     +P      ALNA   +   I  L+  +V+  FH ++S   + Y Y I  
Sbjct: 61  QVIHFDYPGNVIPAKNMLLALNAL--MPRDIIFLDSELVNDDFHVQYSTKAKWYRYIINQ 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            +      +      P  LD   M+ AA +L+G+HDFT+F +   Q    +RTI + ++ 
Sbjct: 119 SRFTDPFRRNYTGHCPYKLDMLKMKKAATYLLGKHDFTSFAASGGQIVDKVRTIFYINLE 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I + V+   FL+  +R   G L  +G G+    D+EK + A+DR++    AP  G
Sbjct: 179 QNGDEIVLDVIGDGFLYNMVRIITGLLIDIGHGQKDVEDVEKIILAKDRQQARNTAPASG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLYHVFY 246


>gi|290579596|ref|YP_003483988.1| putative tRNA pseudouridine synthase A [Streptococcus mutans
           NN2025]
 gi|254996495|dbj|BAH87096.1| putative tRNA pseudouridine synthase A [Streptococcus mutans
           NN2025]
          Length = 249

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV-TGEIVVVHGAGRTDSGVHALR 59
           MIRY  II Y+G+ + G+QRQ    ++Q  IEK +  + +G+ V VHGAGRTD+GVHA  
Sbjct: 1   MIRYKAIISYDGTNFSGFQRQPQMRTVQEEIEKTLLRLNSGQAVKVHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++     L   L+   +  D I ++ +  V   FHAR+   R++Y + +   
Sbjct: 61  QVIHFDLPQQRDLEKLRFGLDT--QTPDDIDVIQVEQVADDFHARYQKHRKTYEFLVDLG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH--FDV 177
           +    L +  A   P  +D   ++ A + L G HDFT F +      + +RTI     + 
Sbjct: 119 RPKNPLMRHYATHFPYKVDFSVVKAAIKKLRGTHDFTGFTASGTSVENKVRTISRATVEK 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     +++ L++ DR   GP A   
Sbjct: 179 DEKTGFLIFTFTGSGFLYKQVRNMVGTLLKIGNGRMPIDQIDRILESGDRSLAGPTAASN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|313906313|ref|ZP_07839656.1| tRNA pseudouridine synthase A [Eubacterium cellulosolvens 6]
 gi|313468869|gb|EFR64228.1| tRNA pseudouridine synthase A [Eubacterium cellulosolvens 6]
          Length = 271

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 84/254 (33%), Positives = 124/254 (48%), Gaps = 10/254 (3%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +II Y+G+ Y G+Q Q NG ++Q  + +A+  +TGE +   GA RTD+GVHA   
Sbjct: 4   MKRIMLIIAYDGTNYCGFQVQPNGVTVQELVNRAVSELTGEEIRTIGASRTDAGVHARGN 63

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V  FD            ALN  L   D I +     V   FH R++   ++Y YRI+ R+
Sbjct: 64  VVVFDTKARMPGDKYSYALNPRL--PDDIKVQLSREVSPDFHPRYTDTVKTYEYRILNRR 121

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIH--CQASSPIRTIDHFDVN 178
            P    +        SLD + M+ AA++L G HDF +F++          +RTI    V 
Sbjct: 122 MPDPTRRLNTLFNYFSLDADRMQAAARYLEGTHDFRSFQASGETNPDKETVRTIYSASVT 181

Query: 179 S------FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGP 232
                    +LI  R+    FL+  +R   G+L  +G GK    D++K + A+ R   GP
Sbjct: 182 RGNAADGNEDLITFRITGNGFLYNMVRILAGTLIEIGRGKLEPEDMKKIMDARSRDAAGP 241

Query: 233 LAPPEGLYFDSVEY 246
            APP+GL    + Y
Sbjct: 242 TAPPQGLTLVEIRY 255


>gi|288959244|ref|YP_003449585.1| tRNA pseudouridine synthase A [Azospirillum sp. B510]
 gi|288911552|dbj|BAI73041.1| tRNA pseudouridine synthase A [Azospirillum sp. B510]
          Length = 245

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 120/246 (48%), Positives = 172/246 (69%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+G  + GWQRQ NG S+Q S+E+A+  ++GE+  VHG+GRTD+GVHAL Q
Sbjct: 1   MQRWKLTVEYDGRPFVGWQRQDNGPSVQQSLEEAVRRLSGEVARVHGSGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFDL + +  + L  ALN +LK +    +   ++  + FHAR ++  R+Y+YRI+ R+
Sbjct: 61  VCHFDLEKPFTALKLRDALNFHLKPAPIAVLEVEAV-TEDFHARLTSTGRAYVYRIVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLALE GRAW + + LD + M  AAQ LVG+HDF++FR+  CQA SP++T+D   V   
Sbjct: 120 APLALESGRAWHVTRPLDADAMHAAAQVLVGQHDFSSFRAALCQAKSPVKTLDRLAVERQ 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I +   ARSFLH Q+R+ VG+L+LVG GKWT+ D+ +AL+A DR + GP  PP+GLY
Sbjct: 180 GDEIRVHAAARSFLHHQVRNMVGTLELVGAGKWTADDVRRALEACDRAKAGPTCPPDGLY 239

Query: 241 FDSVEY 246
           F +  Y
Sbjct: 240 FLAARY 245


>gi|315640131|ref|ZP_07895253.1| tRNA pseudouridine synthase A [Enterococcus italicus DSM 15952]
 gi|315484108|gb|EFU74582.1| tRNA pseudouridine synthase A [Enterococcus italicus DSM 15952]
          Length = 248

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 128/248 (51%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+RY  II Y+G+ + G+QRQ  G ++Q  +E+ +  +  + +VVHG+GRTD+ VHAL Q
Sbjct: 3   MVRYKAIIAYDGTLFHGFQRQPQGRTVQEELERTLSKMASQPIVVHGSGRTDAHVHALGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD  +E     +  A++   +  + I++  + IVD+ FHAR+    + Y + +   +
Sbjct: 63  VIHFDYPKERPLEKMRFAMDT--QTPEDIAVKQVEIVDELFHARYLVQEKVYEFHVQIGK 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +  A   P  LD   +  A   L+G HDF+ F +        +RTI    +   
Sbjct: 121 PRSPFRRHYASYYPYPLDLAKIERALPDLLGTHDFSAFCASGSSVEDKVRTIYEATMVHD 180

Query: 181 GNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             L E         FL+  IR  VG+L  +G+G+   T L K + ++DR   GP A PEG
Sbjct: 181 EALSELVFTFRGDGFLYKMIRILVGTLLKIGNGRLEETSLPKIIASKDRNCAGPTAHPEG 240

Query: 239 LYFDSVEY 246
           LY   V+Y
Sbjct: 241 LYLKEVKY 248


>gi|218230830|ref|YP_002364991.1| tRNA pseudouridine synthase A [Bacillus cereus B4264]
 gi|228950690|ref|ZP_04112824.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229077443|ref|ZP_04210092.1| tRNA pseudouridine synthase A [Bacillus cereus Rock4-2]
 gi|229148551|ref|ZP_04276807.1| tRNA pseudouridine synthase A [Bacillus cereus m1550]
 gi|229176742|ref|ZP_04304146.1| tRNA pseudouridine synthase A [Bacillus cereus 172560W]
 gi|218158787|gb|ACK58779.1| tRNA pseudouridine synthase A [Bacillus cereus B4264]
 gi|228606785|gb|EEK64202.1| tRNA pseudouridine synthase A [Bacillus cereus 172560W]
 gi|228634967|gb|EEK91540.1| tRNA pseudouridine synthase A [Bacillus cereus m1550]
 gi|228705869|gb|EEL58206.1| tRNA pseudouridine synthase A [Bacillus cereus Rock4-2]
 gi|228809041|gb|EEM55526.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 252

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q N  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWINALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QNDEIIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|329297440|ref|ZP_08254776.1| tRNA pseudouridine synthase A [Plautia stali symbiont]
          Length = 270

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V    V V  AGRTD+GVH   QV
Sbjct: 8   FKLALGIEYDGSRYYGWQRQNEVRSVQEKLEKALAKVANHPVNVFCAGRTDAGVHGTGQV 67

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N+ L   D I++  +  V + FHARFSA  R Y Y I  ++ 
Sbjct: 68  VHFETTLSRADSAWTLGVNSNL--PDDIAVRWVKAVPETFHARFSATARRYRYVIYNQRL 125

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H  V   G
Sbjct: 126 RPAILGKGITHFYHPLDAEKMHRAAQALLGENDFTSFRAVQCQSRTPWRNVMHLYVTRQG 185

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  +G G    T +   L A+DR      A  EGLY 
Sbjct: 186 PYVIVDIKANAFVHYMVRNIVGSLLEIGCGNQPETWMATLLAAKDRTLAAATAKAEGLYL 245

Query: 242 DSVEY 246
            +V+Y
Sbjct: 246 VAVDY 250


>gi|289435864|ref|YP_003465736.1| tRNA pseudouridine synthase A [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172108|emb|CBH28654.1| tRNA pseudouridine synthase A [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 248

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q +  ++Q  IEKA+  +  G+ V V  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPDTRTVQAEIEKALKKMHKGKSVRVTASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +      FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDISAEKFQKAL--QVMTPFDISFLIVEEAPADFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  L+ E M++A++ LVG HDFT+F S   +  S +RT+   D   
Sbjct: 119 KVFDPFSRNFALHYPYELNLEKMKLASERLVGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EEDDTLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDITKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|30018411|ref|NP_830042.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 14579]
 gi|206972233|ref|ZP_03233180.1| tRNA pseudouridine synthase A [Bacillus cereus AH1134]
 gi|228956583|ref|ZP_04118379.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229041047|ref|ZP_04189810.1| tRNA pseudouridine synthase A [Bacillus cereus AH676]
 gi|229125659|ref|ZP_04254691.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-Cer4]
 gi|229142948|ref|ZP_04271389.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-ST24]
 gi|229188427|ref|ZP_04315475.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 10876]
 gi|296500975|ref|YP_003662675.1| tRNA pseudouridine synthase A [Bacillus thuringiensis BMB171]
 gi|29893951|gb|AAP07243.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 14579]
 gi|206732807|gb|EDZ49982.1| tRNA pseudouridine synthase A [Bacillus cereus AH1134]
 gi|228595101|gb|EEK52872.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 10876]
 gi|228640569|gb|EEK96958.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-ST24]
 gi|228657851|gb|EEL13657.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-Cer4]
 gi|228727344|gb|EEL78538.1| tRNA pseudouridine synthase A [Bacillus cereus AH676]
 gi|228803148|gb|EEM49970.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|296322027|gb|ADH04955.1| tRNA pseudouridine synthase A [Bacillus thuringiensis BMB171]
          Length = 252

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q N  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDEIIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|145635070|ref|ZP_01790776.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittAA]
 gi|145267678|gb|EDK07676.1| tRNA pseudouridine synthase A [Haemophilus influenzae PittAA]
          Length = 269

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 130/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG  Y+GWQRQ+   S+Q  +EK++  +  E + +  AGRTDSGV    QV
Sbjct: 1   MKIALGIEYNGQNYYGWQRQEKVRSVQEELEKSLSHIANEKIEIFCAGRTDSGVSGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+              NA+L   D I++     VD +FHARFSA  R Y Y +   + 
Sbjct: 61  VHFETNAVRPEKAWAFGTNAHL--PDDIAVSWAKQVDDEFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M  A Q L+G  DF++FR+  CQ+ +P R + H +V+  G
Sbjct: 119 RSAILAGGITHCHLDLDAEKMHQAGQCLLGEQDFSSFRAAQCQSHTPWRNVHHLNVSRIG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ ++R+   P A P+GLY 
Sbjct: 179 KYIIVDIQANAFVHHMVRNIVGSLIEVGAGNQPIEWMQWLLEQKNRQLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVVY 243


>gi|225387194|ref|ZP_03756958.1| hypothetical protein CLOSTASPAR_00946 [Clostridium asparagiforme
           DSM 15981]
 gi|225046673|gb|EEG56919.1| hypothetical protein CLOSTASPAR_00946 [Clostridium asparagiforme
           DSM 15981]
          Length = 259

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 124/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  +++ Y+G+ Y GWQ Q N  +I+  + KA+  +  E + V GA RTD+GVHA   
Sbjct: 7   MRRIRLVVAYDGTNYHGWQYQPNAVTIEEVLNKALTELLREPIAVIGASRTDAGVHAQGN 66

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD         +C A+N  L   + I + +   V   +H R     ++Y Y+I+ R+
Sbjct: 67  VAVFDTKNRMAADKICLAVNQRL--PEDIRVQSSEEVATDWHPRKRRCVKTYEYKILNRR 124

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD-VNS 179
             +  ++   +     LD E MR AA+ ++G HDF +F S   Q +  +RT+        
Sbjct: 125 IEMPDKRLYTYHCYYDLDLEKMRQAAEFILGEHDFKSFCSAKTQVTDTVRTVYDLKLERD 184

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             ++I IR+    FL+  +R   G+L   G G      + + L A+DR++ GP AP +GL
Sbjct: 185 QEDVITIRITGSGFLYNMVRIIAGTLLWAGTGLIRPEAVGEILAAEDRRKAGPTAPAKGL 244

Query: 240 YFDSVEY 246
               + Y
Sbjct: 245 TLIRMHY 251


>gi|24212681|sp|Q9ZCA3|TRUA_RICPR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|292572520|gb|ADE30435.1| tRNA pseudouridine synthase A [Rickettsia prowazekii Rp22]
          Length = 245

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 111/246 (45%), Positives = 152/246 (61%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+ + GWQRQ    S+Q  +E+AI+  + E V + G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTHFAGWQRQAGVLSVQQILEEAIYKFSSEQVTLFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  + KA+N +      + + N  +V   FHARFSAI R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPYKIIKAINYF-VRPYDVGVWNCELVSNNFHARFSAISRHYIYRIINRT 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FRS  CQ+ SPI+T+   ++   
Sbjct: 120 YPSVIDFNRAWWISSPLDILAMQKAAAYLLGKHDFTSFRSSSCQSKSPIKTLTEINIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L A+DRK  GP AP  GLY
Sbjct: 180 YEEIKLYISAPSFLHYMVRNIVGSLVLVGKNIWQAEQIKNVLDARDRKIAGPTAPAFGLY 239

Query: 241 FDSVEY 246
           F   EY
Sbjct: 240 FIKAEY 245


>gi|163790163|ref|ZP_02184597.1| tRNA pseudouridine synthase A [Carnobacterium sp. AT7]
 gi|159874654|gb|EDP68724.1| tRNA pseudouridine synthase A [Carnobacterium sp. AT7]
          Length = 279

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 135/247 (54%), Gaps = 5/247 (2%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGE-IVVVHGAGRTDSGVHALRQV 61
           RY MII+Y+G+ + G+Q Q N  ++QG I+KA+ ++T    +++HG+GRTDSGVHA  QV
Sbjct: 5   RYKMIIQYDGTHFAGFQIQPNDRTVQGEIQKALKIMTKGLEIIIHGSGRTDSGVHAKGQV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD         + +ALN+    +D + +  ++IVD  FHAR++   + Y YR+     
Sbjct: 65  IHFDYPILLPVENMQRALNSL--TTDELFVEKVAIVDTNFHARYNTSGKKYQYRVDLNAI 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P   ++      P  +D E ++ A + L G HDF++F + +    + +RT+    V    
Sbjct: 123 PNPFKRLYTLHHPYPIDMEKLQNALKDLEGEHDFSSFCASNSGRENKVRTVYEASVVKDI 182

Query: 182 NLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              E         FL+  +R FVG+L  + +G   + ++++ L  +DR E GP A P+GL
Sbjct: 183 FNNELIFTFSGNGFLYNMVRIFVGTLLQIANGLRPADEIKRLLAVKDRNEAGPTAKPQGL 242

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 243 YLMEVYY 249


>gi|229587225|ref|YP_002845726.1| tRNA pseudouridine synthase A [Rickettsia africae ESF-5]
 gi|259550437|sp|C3PLZ3|TRUA_RICAE RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|228022275|gb|ACP53983.1| tRNA pseudouridine synthase A [Rickettsia africae ESF-5]
          Length = 245

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 106/246 (43%), Positives = 148/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE V++ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTDLAGWQRQAGVMSVQQILEEAIYKFSGEQVILFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPHKIITAINYF-ARPYAVGVWNCELAPNNFHARFSATSRYYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ S I+T+   ++   
Sbjct: 120 YPSVIDLNRAWWISSPLDVPAMQQAAVYLLGKHDFTSFRASSCQSKSSIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W    ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNIWQVEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F    Y
Sbjct: 240 FVKTAY 245


>gi|307825597|ref|ZP_07655815.1| tRNA pseudouridine synthase A [Methylobacter tundripaludum SV96]
 gi|307733483|gb|EFO04342.1| tRNA pseudouridine synthase A [Methylobacter tundripaludum SV96]
          Length = 267

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 99/246 (40%), Positives = 136/246 (55%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + IEY+GSG+ GWQ Q +  S+Q  +E+A+  V    V V  AGRTD+GVHAL Q
Sbjct: 1   MTRIVLGIEYDGSGFSGWQWQTHQRSVQQVLEQALSKVANHPVTVQCAGRTDTGVHALEQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E          N+ L   D + I  +      FHAR+SAI R Y Y I+ R 
Sbjct: 61  VVHFDAKVERELHTWVLGGNSNL--PDDVRITWVKPAVGDFHARYSAIARFYRYVILNRP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL + +A      LD + M  AAQHL+G+HDF+TFR+  CQ+ SP R +   DV   
Sbjct: 119 IKSALLRNQATWHHNPLDADKMHRAAQHLIGKHDFSTFRAQGCQSKSPCREMYFIDVYRD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + + I + A +FLH  +R+  G L  +G GK   +  ++ L+ ++RK  G  APP GLY
Sbjct: 179 DDKVIIDISANAFLHHMVRNIAGVLMDIGAGKQDESWTQELLEVKNRKLGGVTAPPYGLY 238

Query: 241 FDSVEY 246
             +V Y
Sbjct: 239 LGAVYY 244


>gi|300703716|ref|YP_003745318.1| tRNA pseudouridylate synthase i [Ralstonia solanacearum CFBP2957]
 gi|299071379|emb|CBJ42698.1| tRNA pseudouridylate synthase I [Ralstonia solanacearum CFBP2957]
          Length = 274

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/250 (35%), Positives = 137/250 (54%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+G+ + GWQ Q +G+++Q  +E A+    G  +    AGRTD+GVHAL Q
Sbjct: 1   MTRIALGIQYDGAAFSGWQSQPHGNTVQDVLEAALRQFGGVELPTTVAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + H D      P    +  NA+L    T+++     V + FHARFSA RR+Y Y +++  
Sbjct: 61  IVHLDTDLVREPFSWVRGTNAFL--PPTVAVRWAQAVPEDFHARFSAHRRTYYYALVSGP 118

Query: 121 APLALEKGRAWLIPKSL----DCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
               L  G+A  +        D   M+ AAQ LVG HDF++FR+  CQA SP++T+   +
Sbjct: 119 TRSPLLGGKAGYVMLPPGQSLDVAAMQEAAQVLVGEHDFSSFRAAECQAKSPVKTLYSAE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
           V   G  + +R+   +FLH  +R+ +G L  +G G+  +  + + L A+DRK   P   P
Sbjct: 179 VRGQGEWVFVRIRGSAFLHHMVRNIMGCLVAIGRGRRPAAWMAEVLAARDRKAAAPTFMP 238

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 239 DGLYLAEVGY 248


>gi|315283801|ref|ZP_07871873.1| tRNA pseudouridine synthase A [Listeria marthii FSL S4-120]
 gi|313612551|gb|EFR86621.1| tRNA pseudouridine synthase A [Listeria marthii FSL S4-120]
          Length = 248

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALKKMHKGKSVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLRVEEVADDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  L+   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KVFDPFSRNFALHYPYELNLAKMKLASERLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  ++ +AL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPEEITEALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|240144416|ref|ZP_04743017.1| tRNA pseudouridine synthase A [Roseburia intestinalis L1-82]
 gi|257203524|gb|EEV01809.1| tRNA pseudouridine synthase A [Roseburia intestinalis L1-82]
          Length = 294

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 87/245 (35%), Positives = 127/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  MI+ Y+G+ Y GWQ Q NG +I+  + K +  + GE +VV GA RTDSGVH+L  +
Sbjct: 48  MRVKMIVAYDGTNYKGWQVQPNGITIEEVLNKNLSNLLGEQIVVSGASRTDSGVHSLGNI 107

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A FD         +  ALN  L   + I +     V+  +H R+   R++Y YRI+ R  
Sbjct: 108 AVFDTNTRMPADKIAFALNQRL--PEDIVVQGSCEVEDGWHPRYQNSRKTYEYRILNRTF 165

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
            +   +   +     LD E M+ AA +L G HDF +F +I  Q  + +RTI   DV   G
Sbjct: 166 RMPTRRLDTYFYHYPLDVEKMKKAASYLEGEHDFKSFCAIGAQVKTTVRTIYACDVEKEG 225

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           ++I IRV    FL+  +R   G+L  VG G      ++  L  +DR   GP AP  GL  
Sbjct: 226 DIITIRVTGNGFLYNMVRIIAGTLVQVGGGAIKPEAVKGILAKKDRSAAGPTAPAHGLTM 285

Query: 242 DSVEY 246
             +E+
Sbjct: 286 MGIEF 290


>gi|313680524|ref|YP_004058263.1| tRNA pseudouridine synthase a [Oceanithermus profundus DSM 14977]
 gi|313153239|gb|ADR37090.1| tRNA pseudouridine synthase A [Oceanithermus profundus DSM 14977]
          Length = 251

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 136/248 (54%), Gaps = 5/248 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQ-KNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R  +++EY+G+ + G+Q Q +   ++QG +E A+  + G    V  AGRTDSGVHAL 
Sbjct: 1   MRRLKLVLEYDGTDFAGFQLQARGERTVQGVLEAALARIPGARPKVTAAGRTDSGVHALA 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
              H+D         + +ALNA L     + +L    V   +HAR+SA  R YLYR++ R
Sbjct: 61  MPVHYDTEDTVPVERVPQALNALL--PPDVRVLEAEEVPPDWHARYSARWRRYLYRVLNR 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P AL++ R W +P+  D   +  AA+ LVG HDF  F   + +  + +R +    V +
Sbjct: 119 RQPTALDRHRVWWVPQPFDFPAIAAAARTLVGEHDFGAF--ANREKRATVRRLYQAHVEA 176

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  + +  V   F+  Q+R+ VG+L  VG G+    D+ + L+  +R E G  APP+GL
Sbjct: 177 VGGELHLHFVGSGFVRGQVRAMVGTLVEVGLGRRPPEDVARLLENPERSEGGATAPPQGL 236

Query: 240 YFDSVEYS 247
           YF +  YS
Sbjct: 237 YFVAAGYS 244


>gi|237653725|ref|YP_002890039.1| tRNA pseudouridine synthase A [Thauera sp. MZ1T]
 gi|237624972|gb|ACR01662.1| tRNA pseudouridine synthase A [Thauera sp. MZ1T]
          Length = 265

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + +EY G  + GWQ Q +G ++Q  +E+A+  + GE V  H AGRTD+GVHA  Q
Sbjct: 1   MRRIVLGLEYAGDAFCGWQSQAHGRTVQDVLERALAQIAGEPVRTHCAGRTDTGVHASAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD           + +NA L     + +   + V   FHARF A  R Y Y +    
Sbjct: 61  VAHFDTRAVRPASAWVRGVNALL--PPAVVVRWSTEVGDDFHARFLACERQYRYILHNAP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+  GR      +LD E M  AAQ LVG HDF++FR+  CQA +P+R +    V   
Sbjct: 119 TRPAMLAGRVGWYHPALDVERMAAAAQCLVGTHDFSSFRAAGCQAKTPVRVMHEARVVRQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  +     A  FLH  IR+ VG+L  VG G++    + + L+A+DR    P   P+GLY
Sbjct: 179 GEYLLFDFRANGFLHHMIRNLVGALVYVGKGRYPVAWMRELLEARDRARAAPTFSPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LCGVAY 244


>gi|326203861|ref|ZP_08193723.1| tRNA pseudouridine synthase A [Clostridium papyrosolvens DSM 2782]
 gi|325985959|gb|EGD46793.1| tRNA pseudouridine synthase A [Clostridium papyrosolvens DSM 2782]
          Length = 245

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 90/247 (36%), Positives = 131/247 (53%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  +IIEY+G+ Y GWQ QKN  ++Q +++KAI  + GE V V G  RTD GVHA  Q
Sbjct: 1   MRKIKIIIEYDGTNYHGWQVQKNAKTVQETVQKAISKLLGEGVGVTGCSRTDVGVHAYGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHF    +        A+N  L   D I I +   V ++FHAR+S   + Y Y I    
Sbjct: 61  VAHFLTDSQIPGDKFSYAINNLL--PDDIVIKHSEEVSEEFHARYSTKGKKYRYLIYNAP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN-S 179
            P A+ + R+  +   LD E M+ AA++ +G HDF  F++   Q  S +R I   +V+  
Sbjct: 119 HPSAIMRNRSCHVRPVLDIEQMKKAARYFIGEHDFAAFQATGGQVRSTVREIYSMEVSGK 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             N+I I V    FL+  +R   G+L  VG GK   +++   +   DR + G  AP +GL
Sbjct: 179 EDNMIYIEVSGNGFLYNMVRIIAGTLIYVGMGKLQESEIPGIIAGLDRTKSGKTAPAQGL 238

Query: 240 YFDSVEY 246
           Y   + Y
Sbjct: 239 YLMEIYY 245


>gi|240143728|ref|ZP_04742329.1| tRNA pseudouridine synthase A [Roseburia intestinalis L1-82]
 gi|257204287|gb|EEV02572.1| tRNA pseudouridine synthase A [Roseburia intestinalis L1-82]
 gi|291537295|emb|CBL10407.1| pseudouridylate synthase I [Roseburia intestinalis M50/1]
 gi|291539242|emb|CBL12353.1| pseudouridylate synthase I [Roseburia intestinalis XB6B4]
          Length = 251

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M  Y MI++Y+G+ Y GWQ      +IQG ++  +  + G  V V G+GRTD+GVHA  Q
Sbjct: 1   MANYKMILQYDGTRYRGWQVLPAELTIQGKLQDVLSKMAGYQVEVTGSGRTDAGVHAKGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            A+F L  EW    +   LN YL   + I++  +  VD++FH+R+ A+ ++YLYRI T +
Sbjct: 61  TANFHLREEWDEDKILFYLNQYL--PEDIAVCEVKRVDERFHSRYQAVEKTYLYRIHTGK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P   E+   +   + LD   MR AA++L G HDF +F        S +RTI    +   
Sbjct: 119 IPEVFERRYVYDYTEPLDVNRMRKAAEYLCGTHDFKSFCGNKKMKKSTVRTISRIQIKEL 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I+I      FL   +R   G+L  +GDG+ T  D+ + L+A++R+  G  AP  GL 
Sbjct: 179 PGEIQIYYTGNGFLQNMVRILTGTLIEIGDGRRTPEDVSEILEAKNRERAGYTAPACGLT 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LLEVIY 244


>gi|283786396|ref|YP_003366261.1| tRNA pseudouridine synthase A [Citrobacter rodentium ICC168]
 gi|282949850|emb|CBG89473.1| tRNA pseudouridine synthase A [Citrobacter rodentium ICC168]
          Length = 269

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/244 (36%), Positives = 131/244 (53%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           +  + +EY+GS Y+GWQRQ    S+Q  +EKA+  V  E + V  AGRTD+GVH   QV 
Sbjct: 10  KIALGVEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVV 69

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HF+             +NA L     I++  +  V + FHARFSA  R Y Y I   +  
Sbjct: 70  HFETSALRKDAAWTLGVNANL--PGDIAVRWVKAVPEDFHARFSATARRYRYIIYNHRLR 127

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+         + LD E M  AAQ L+G +DFT+FR++ CQ+ +P R + H +V+  G 
Sbjct: 128 PAVLAKGVTHYYEPLDAERMHRAAQCLIGENDFTSFRAVQCQSRTPWRNVMHINVSRHGA 187

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  VG      + + + L A+DR      A  EGLY  
Sbjct: 188 YVVVDIKANAFVHHMVRNIVGSLMEVGAHHQPESWIAELLAAKDRTLAAATAKAEGLYLV 247

Query: 243 SVEY 246
           +V+Y
Sbjct: 248 AVDY 251


>gi|312113444|ref|YP_004011040.1| tRNA pseudouridine synthase A [Rhodomicrobium vannielii ATCC 17100]
 gi|311218573|gb|ADP69941.1| tRNA pseudouridine synthase A [Rhodomicrobium vannielii ATCC 17100]
          Length = 245

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 129/246 (52%), Positives = 165/246 (67%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQ Q NG S+Q  + +AI   TG   +  GAGRTD+GVHA  Q
Sbjct: 1   MPRYKITIEYDGTPFSGWQMQANGRSVQDHLARAIERFTGVRAIPRGAGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R W P  +  ALN +L+    + IL    VD+ F ARFSA  R YLYRI+TR+
Sbjct: 61  VAHVDLERRWPPETVRNALNFHLR-PAPMVILACEEVDETFDARFSAKARHYLYRIVTRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +PLAL++ RAW I   LD E M+  A+HL+G HDFTTFR+  CQA SP+RT+D   V S 
Sbjct: 120 SPLALDRDRAWHIGVPLDAEAMQEGARHLLGHHDFTTFRASQCQAKSPLRTLDTLTVRSE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + I   ARSFLH Q+RS  GSLKLVG+GKW    + +AL+A+DR+ CG +AP  GLY
Sbjct: 180 GESVFIATSARSFLHNQVRSMAGSLKLVGEGKWQPERMREALEARDRRACGSVAPACGLY 239

Query: 241 FDSVEY 246
           F +V+Y
Sbjct: 240 FMTVDY 245


>gi|218289976|ref|ZP_03494153.1| tRNA pseudouridine synthase A [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239961|gb|EED07148.1| tRNA pseudouridine synthase A [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 262

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/245 (35%), Positives = 126/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  +++ Y+GSG+ G+ RQ+   ++QG +E  +  + G  +VV G+GRTD GVHA  QV
Sbjct: 5   RRIRLVLGYDGSGFHGFARQEGLRTVQGVLEDELRRMLGVDIVVEGSGRTDRGVHARAQV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFDL        +   L+  L     +       VD  FHARFS +R++Y Y +     
Sbjct: 65  VHFDLPYGPPADRMVHVLHRRL--PADLLPRQADEVDDGFHARFSVVRKTYRYTLDLAPL 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P       +W +P+ LD   M+ AA+HL+G HDFT+F +        +R ID  +    G
Sbjct: 123 PSLYWYRFSWHLPEYLDLAAMQEAARHLLGEHDFTSFCAAEAPQRDKVRRIDRVEFRQDG 182

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I      FL   +R  VG+L  VG GK     +   L+A+DR+  G  APP GL  
Sbjct: 183 SRLHIEFEGNGFLQYMVRILVGTLVKVGRGKERPDRIPLILEARDRRLAGETAPPHGLCL 242

Query: 242 DSVEY 246
            +VEY
Sbjct: 243 WNVEY 247


>gi|326803064|ref|YP_004320882.1| tRNA pseudouridine synthase A [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650503|gb|AEA00686.1| tRNA pseudouridine synthase A [Aerococcus urinae ACS-120-V-Col10a]
          Length = 264

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 89/248 (35%), Positives = 127/248 (51%), Gaps = 5/248 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            RY   I Y+G+ Y G+Q Q NG SIQ ++EKA+ L+T G+ + V+G+GRTDSGVHAL Q
Sbjct: 3   QRYKATIAYDGTPYVGFQVQPNGPSIQAALEKALKLMTKGQEIPVYGSGRTDSGVHALGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E     L +ALN+ L   D I +  +  V+K FHAR+ A R++YLY++    
Sbjct: 63  VVHFDYPSEIETEGLLRALNSIL--DDAICVKTVEPVEKHFHARYHAQRKAYLYKVSLAP 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                E+      P   D   ++ A   L+G H+F +F S     +   R I   +  + 
Sbjct: 121 FVSPFERHYVLHHPYRTDVSRIQAALPALIGAHNFKSFCSTKTDKTVFDREIYRAECQAS 180

Query: 181 GNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
            +            FL+  +R  VG+   +GDG     +L   L+ QDR   GP A   G
Sbjct: 181 WDGQTLTFYFEGNGFLYNMVRIIVGTCLQIGDGLRPVENLSDLLRIQDRNAAGPTAKAHG 240

Query: 239 LYFDSVEY 246
           LY   V+Y
Sbjct: 241 LYLHHVDY 248


>gi|83748092|ref|ZP_00945121.1| tRNA pseudouridine synthase A [Ralstonia solanacearum UW551]
 gi|207742812|ref|YP_002259204.1| trna pseudouridine synthase a (trna-uridine isomerasei) (trna
           pseudouridylate synthaseI protein [Ralstonia
           solanacearum IPO1609]
 gi|83725278|gb|EAP72427.1| tRNA pseudouridine synthase A [Ralstonia solanacearum UW551]
 gi|206594206|emb|CAQ61133.1| trna pseudouridine synthase a (trna-uridine isomerasei) (trna
           pseudouridylate synthaseI protein [Ralstonia
           solanacearum IPO1609]
          Length = 274

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 90/250 (36%), Positives = 139/250 (55%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+G+ + GWQ Q +G+++Q  +E A+    G  +    AGRTD+GVHAL Q
Sbjct: 1   MTRIALGIQYDGAAFSGWQSQPHGNTVQDVLEAALRQFGGVELPTTVAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + H D      P    +  NA+L    T+++     V + FHARFSA RR+Y Y +++  
Sbjct: 61  IVHLDTDLVREPFSWVRGTNAFL--PSTVAVRWAQAVPEDFHARFSAHRRTYYYALVSGP 118

Query: 121 APLALEKGRAWLIP----KSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
               L  G+A  +     + LD   M+ AAQ LVG HDF++FR+  CQA SP++T+   +
Sbjct: 119 TRSPLLGGKAGYVMLPPGEWLDVAAMQEAAQVLVGEHDFSSFRAAECQAKSPVKTLYSAE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
           V   G  + +R+   +FLH  +R+ +G L  +G G+  +  + + L A+DRK   P   P
Sbjct: 179 VRGQGEWVFVRIRGSAFLHHMVRNIMGCLVAIGRGRRPAAWMAEVLAARDRKAAAPTFMP 238

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 239 DGLYLAEVGY 248


>gi|313606591|gb|EFR83384.1| tRNA pseudouridine synthase A [Listeria monocytogenes FSL F2-208]
          Length = 248

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIITYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSDLDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G+HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGKHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDISKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|255526613|ref|ZP_05393520.1| tRNA pseudouridine synthase A [Clostridium carboxidivorans P7]
 gi|296187301|ref|ZP_06855697.1| tRNA pseudouridine synthase A [Clostridium carboxidivorans P7]
 gi|255509721|gb|EET86054.1| tRNA pseudouridine synthase A [Clostridium carboxidivorans P7]
 gi|296048172|gb|EFG87610.1| tRNA pseudouridine synthase A [Clostridium carboxidivorans P7]
          Length = 247

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 83/245 (33%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
               ++IEY+G+ Y GWQRQ N  SIQ  +E+AI   T     V G+ RTD+GVHA   V
Sbjct: 5   KNIKLVIEYDGTNYCGWQRQDNAESIQQKVEEAIERATKVFSKVTGSSRTDAGVHAEGFV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            +F       P    +ALN +L   + I I+    VDK+FH+RF++I + Y+Y ++T   
Sbjct: 65  CNFFTESSIPPENFKEALNVFL--PEDIVIIESKEVDKEFHSRFNSIGKKYVYTVLTGSH 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+ +   +   K+L+   M+ AA++ +G HDF+ F+       + IRTI   +++  G
Sbjct: 123 RPAIRRNYVYYFNKNLNIGQMKEAAKYFLGTHDFSAFKKSGSSVKTSIRTIKELNIDIDG 182

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I+  ++   FL+  +R  VG+L  VG  ++   D++K + +++R   G  AP  GL  
Sbjct: 183 NYIKFSIIGDGFLYNMVRIIVGTLLDVGTNRFNPEDIDKIISSKNRSNAGKSAPACGLTL 242

Query: 242 DSVEY 246
           + V Y
Sbjct: 243 EKVFY 247


>gi|319760619|ref|YP_004124557.1| tRNA pseudouridine synthase A [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039333|gb|ADV33883.1| tRNA pseudouridine synthase A [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 255

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 101/246 (41%), Positives = 140/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + IEY+GS Y GWQ+QKNG S+Q  +E A+ +VT E V V  AGRTDSGVHAL Q
Sbjct: 1   MQKIALGIEYDGSRYCGWQKQKNGISVQDCVENALNIVTAESVSVFCAGRTDSGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+   ++        +N YL    +I I  +S++ + FHARFSA+ R Y Y I   +
Sbjct: 61  VVHFETDVKYSKSAWTFGVNRYL--PRSICIRWVSLMKQDFHARFSAVSRRYYYYIYNDK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+   + W   K LD   M  AAQ+L+G +DF+ FRS  CQ+ S  R + H  V   
Sbjct: 119 IRSAILFQKTWHYTKLLDVCKMSRAAQYLLGENDFSAFRSAGCQSYSRCRNLYHLRVIRI 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + I + A SFL+  +R+ VGSL  VG G   +  + + L++  R   G  AP +GLY
Sbjct: 179 GQCVIIDIQANSFLYRMVRNIVGSLVEVGCGNRPAIWILELLKSCKRSLAGMTAPADGLY 238

Query: 241 FDSVEY 246
              V+Y
Sbjct: 239 LAEVKY 244


>gi|253701944|ref|YP_003023133.1| tRNA pseudouridine synthase A [Geobacter sp. M21]
 gi|259550393|sp|C6E4S9|TRUA_GEOSM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|251776794|gb|ACT19375.1| tRNA pseudouridine synthase A [Geobacter sp. M21]
          Length = 247

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 125/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQ Q NG ++Q ++E+A+  + G    +HG+GRTD+GVHA   
Sbjct: 1   MRNIKLIIEYDGTAYCGWQVQPNGRTVQEALEEALASMLGGKTALHGSGRTDAGVHARGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   +        + LN  L     I++     V  +FH RF A+ + Y Y ++   
Sbjct: 61  VACFQTDKGMPLRAFREGLNCLL--PADIAVREACEVPLEFHPRFDALAKHYRYTMLLDD 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +  AW +   LD + MR A    VG HDF  FR+ +C A + +R I   D+   
Sbjct: 119 LRSPLSRLTAWRLKGKLDVDAMRSACAAFVGEHDFAAFRASNCAAKTTVRRIYSMDLVQE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKE-CGPLAPPEGL 239
           G  + + V    FL   +R   G+L  VG GK +  D+ + L+  DR++  G   PP+GL
Sbjct: 179 GPFLHLDVKGSGFLKNMVRIITGTLIEVGQGKKSVEDVARLLKGSDRQQNSGMTVPPQGL 238

Query: 240 YFDSVEY 246
               V Y
Sbjct: 239 CLMQVYY 245


>gi|228919092|ref|ZP_04082471.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228840617|gb|EEM85879.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 252

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q N  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I  R V   FL+  +R  VG+L  +G GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDEIIFRFVGNGFLYNMVRIIVGTLLSIGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|149370146|ref|ZP_01889997.1| tRNA pseudouridine synthase A [unidentified eubacterium SCB49]
 gi|149356637|gb|EDM45193.1| tRNA pseudouridine synthase A [unidentified eubacterium SCB49]
          Length = 259

 Score =  187 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 116/244 (47%), Gaps = 4/244 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           RY + I YNG+ Y GWQ+Q +  ++Q  IE  +  V  + V   GAGRTD+GVHA +   
Sbjct: 8   RYFLEIAYNGAKYCGWQKQPDAKTVQQEIEYFLSTVLRQDVTTMGAGRTDTGVHARQMFL 67

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HFD+ +           N++L     IS+LN   V    HARF+AI R Y Y +   + P
Sbjct: 68  HFDVSKSISIPNFLYKANSFL--PPDISVLNYYEVLDDHHARFNAIAREYEYYVSVVKDP 125

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            +++      +    D   M  AA  L+   DF +F  +  +  +    +   +    GN
Sbjct: 126 FSIDSAY--YLKNFPDINLMNEAASSLLTYSDFQSFSKVRTEVKTFNCNVTKAEWILNGN 183

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
           ++   + A  FL   +RS VG+L  VG GK T  D    + +++R   G   P  GLY  
Sbjct: 184 MLIFTISADRFLRNMVRSIVGTLLEVGSGKITIEDFHNIIASKNRSNAGISVPAHGLYLT 243

Query: 243 SVEY 246
            V Y
Sbjct: 244 KVIY 247


>gi|99082224|ref|YP_614378.1| tRNA pseudouridine synthase A [Ruegeria sp. TM1040]
 gi|122984147|sp|Q1GE00|TRUA_SILST RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|99038504|gb|ABF65116.1| Pseudouridylate synthase [Ruegeria sp. TM1040]
          Length = 259

 Score =  187 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 116/250 (46%), Positives = 162/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+G  + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRFALKVEYHGKPFAGWQRQKDQPSVQGAIEAALARIEPGEHTIAAAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL + W P  L +ALN +LK    ++I++ ++VD ++HARFSA+ R YL+RI+ R+
Sbjct: 61  VAHCDLEKNWDPFRLSEALNYHLK-PAPVAIVDAALVDDEWHARFSAVERQYLFRILMRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   ++G+ W I   LD   M+  A  L+G HDFTTFRS  CQA+SP++T+D   V   
Sbjct: 120 APATHDEGQVWQIKHDLDVAAMQAGANMLLGNHDFTTFRSSICQAASPVKTLDELRVERV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
             L    +   V ARSFLH Q+RSFVG+L+ VG G W+  D++ AL+A+DR  CGP+ P 
Sbjct: 180 QGLSGPEVHFHVRARSFLHNQVRSFVGTLERVGTGAWSPEDVKHALEAKDRAACGPVCPG 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 HGLYLARVGY 249


>gi|207722996|ref|YP_002253419.1| trna pseudouridine synthase a (trna-uridine isomerasei) (trna
           pseudouridylate synthaseI protein [Ralstonia
           solanacearum MolK2]
 gi|206588185|emb|CAQ18754.1| trna pseudouridine synthase a (trna-uridine isomerasei) (trna
           pseudouridylate synthaseI protein [Ralstonia
           solanacearum MolK2]
          Length = 274

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/250 (35%), Positives = 136/250 (54%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+G+ + GWQ Q +G+++Q  +E A+    G  +    AGRTD+GVHAL Q
Sbjct: 1   MTRIALGIQYDGAAFSGWQSQPHGNTVQDVLEAALRQFGGVELPTTVAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + H D           +  NA+L    T+++     V + FHARFSA RR+Y Y +++  
Sbjct: 61  IIHLDTDLVREAFSWVRGTNAFL--PSTVAVRWAQAVPEDFHARFSAHRRTYYYALVSGP 118

Query: 121 APLALEKGRAWLIPKSL----DCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
               L  G+A  +        D   M+ AAQ LVG HDF++FR+  CQA SP++T+   +
Sbjct: 119 TRSPLLGGKAGYVMLPPGESLDVAAMQEAAQVLVGEHDFSSFRAAECQAKSPVKTLYSAE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
           V   G  + +R+   +FLH  +R+ +G L  +G G+  +  + + L A+DRK   P   P
Sbjct: 179 VRGQGEWVFVRIRGSAFLHHMVRNIMGCLVAIGRGRRPAAWMAEVLAARDRKAAAPTFMP 238

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 239 DGLYLAEVGY 248


>gi|110803601|ref|YP_698382.1| tRNA pseudouridine synthase A [Clostridium perfringens SM101]
 gi|110684102|gb|ABG87472.1| tRNA pseudouridine synthase A [Clostridium perfringens SM101]
          Length = 248

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + K +N YL   + I +  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIKYINEYL--PEDIRVKEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIIVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPA 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|85707833|ref|ZP_01038899.1| tRNA pseudouridine synthase A [Erythrobacter sp. NAP1]
 gi|85689367|gb|EAQ29370.1| tRNA pseudouridine synthase A [Erythrobacter sp. NAP1]
          Length = 247

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 127/246 (51%), Positives = 167/246 (67%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IE++G+ + G QRQK+G S+Q SIE+A+  +TGE   +H AGRTD+GVHAL  
Sbjct: 1   MTRFALTIEFDGTPFQGLQRQKHGPSVQQSIEEALHRITGEDATLHSAGRTDTGVHALGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            +H DL ++  P  L +ALNA+L+  D I+IL   +VD+ +HARFS + R Y+Y+I  R+
Sbjct: 61  RSHVDLEKDIDPFRLSEALNAHLR-PDPIAILACEVVDEDWHARFSCVGRRYVYKIANRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APL L K RAW +   LD E M  AAQ LVGRHDFTTFRS+HCQA  P++T+D  +V   
Sbjct: 120 APLTLAKNRAWQVAHDLDHEAMHRAAQALVGRHDFTTFRSVHCQAKDPVKTLDQLNVERV 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I I   ARSFLH Q+RS VG LKLVG G W    + +AL A+DR + G  APP+GLY
Sbjct: 180 GDEIHIHAAARSFLHHQVRSMVGCLKLVGAGSWREEQVAEALAAKDRSKLGLNAPPQGLY 239

Query: 241 FDSVEY 246
           F    Y
Sbjct: 240 FVEATY 245


>gi|254931132|ref|ZP_05264491.1| tRNA pseudouridine synthase A [Listeria monocytogenes HPB2262]
 gi|293582680|gb|EFF94712.1| tRNA pseudouridine synthase A [Listeria monocytogenes HPB2262]
 gi|328469771|gb|EGF40688.1| tRNA pseudouridine synthase A [Listeria monocytogenes 220]
 gi|332313028|gb|EGJ26123.1| tRNA pseudouridine synthase A 1 [Listeria monocytogenes str. Scott
           A]
          Length = 248

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALTKMHKGKTVRIKASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +  V   FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEVPDDFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   M++A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDISKMKLASKRLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G  + +  D+ +AL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQDRISPDDISEALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|34581081|ref|ZP_00142561.1| pseudouridylate synthase I [Rickettsia sibirica 246]
 gi|28262466|gb|EAA25970.1| pseudouridylate synthase I [Rickettsia sibirica 246]
          Length = 245

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 106/246 (43%), Positives = 149/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE V++ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTDLAGWQRQAGVMSVQQILEEAIYKFSGEQVILFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPHKIITAINYF-ARPYAVGVWNCELAPNNFHARFSATSRYYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ S I+T+   ++   
Sbjct: 120 YPSVIDLNRAWWISSPLDVPAMQQAAVYLLGKHDFTSFRASSCQSKSSIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNIWQAEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F    Y
Sbjct: 240 FVKTAY 245


>gi|322411078|gb|EFY01986.1| tRNA pseudouridine synthase A [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 249

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+QRQ +  ++Q  IEK +  +T G+ V +HGAGRTD+GVHA  
Sbjct: 1   MTRYKATISYDGTLFSGFQRQSHERTVQEEIEKTLQKLTGGQPVPIHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++     L  AL+   +  D I +++L+IV   FH R+    ++Y + +   
Sbjct: 61  QVIHFDLPQKRDLEKLRFALDT--QTPDDIDVVDLAIVADDFHCRYQKHSKTYEFLVDNG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD--V 177
           +    + +  A   P  LD   M+ A + LVG HDFT F +      + +RTI       
Sbjct: 119 RPKNPMMRHYATHYPYPLDMNKMQEAIKTLVGTHDFTGFTAAGTSVKNKVRTITEATLVQ 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     ++  L +++R+  GP     
Sbjct: 179 DDKTGFLVFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVEQIKVILDSKNRQLAGPTPAGN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIHY 247


>gi|319945640|ref|ZP_08019892.1| tRNA pseudouridine synthase A [Streptococcus australis ATCC 700641]
 gi|319748239|gb|EFW00481.1| tRNA pseudouridine synthase A [Streptococcus australis ATCC 700641]
          Length = 248

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 122/249 (48%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+QRQ +  S+Q  IEK +  +  G  V +HGAGRTD+GVHAL 
Sbjct: 1   MTRYKATISYDGTLFAGFQRQPHARSVQEEIEKTLMRLNQGNPVTIHGAGRTDAGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL +      L  AL+   +  + I  + +  V   FH+R+    ++Y + +   
Sbjct: 61  QVIHFDLPQPRDEEKLRFALDT--QTPEDIDFIRVEQVPDDFHSRYQKHSKTYEFIVDYG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +    + +  A   P  LD   M+ A Q L G HDFT F +        +RTI    +  
Sbjct: 119 RPKNPMMRHYATHYPYPLDVAKMQAAIQKLEGTHDFTGFTASGTSVEDKVRTITEARLVE 178

Query: 180 FGNLI--EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                          FL+ QIR+ VG+L  +G+G+     ++  L+ +DR   GP A P 
Sbjct: 179 DAEHHRLVFTFSGNGFLYKQIRNMVGTLLKIGNGRMPVDQIDLILEKKDRNLAGPTAAPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|15893251|ref|NP_360965.1| tRNA pseudouridine synthase A [Rickettsia conorii str. Malish 7]
 gi|24212567|sp|Q92FZ9|TRUA_RICCN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|15620470|gb|AAL03866.1| pseudouridylate synthase I [Rickettsia conorii str. Malish 7]
          Length = 245

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 107/246 (43%), Positives = 150/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE V++ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTDLAGWQRQAGVMSVQQILEEAIYKFSGEQVILFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +   P  +  A+N +      + + N  +    FHARFSA  R Y+YRII R 
Sbjct: 61  VAHFDLSKYLEPHKIITAINYF-ARPYAVGVWNCELAPNNFHARFSATSRYYIYRIINRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  RAW I   LD   M+ AA +L+G+HDFT+FR+  CQ+ SPI+T+   ++   
Sbjct: 120 YPSVIDLNRAWWISAPLDVPAMQQAAVYLLGKHDFTSFRASSCQSKSPIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  ++  L+A+DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNIWQAEQIKDVLEAKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F    Y
Sbjct: 240 FVKTAY 245


>gi|83591242|ref|YP_431251.1| tRNA pseudouridine synthase A [Moorella thermoacetica ATCC 39073]
 gi|123766692|sp|Q2RFT1|TRUA_MOOTA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|83574156|gb|ABC20708.1| tRNA pseudouridine synthase A [Moorella thermoacetica ATCC 39073]
          Length = 246

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 118/248 (47%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK--NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + + Y+GS Y GWQ Q   +G ++QG +  A+  +TGE +    AGRTD+GVHA 
Sbjct: 1   MPCLKITLAYDGSNYAGWQVQPEAHGPTVQGEVAAALKRLTGEEITPVAAGRTDAGVHAR 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            QV  F             ALN+ L     I+ L    V   FHAR+ A R+ Y Y I  
Sbjct: 61  GQVISFSTRARIPVERWPLALNSVL--PADIAALEAVEVAPDFHARYCAKRKWYRYTIYN 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            + P    +  +W + + LD   M  AA +L G HDF +F +         R +    V+
Sbjct: 119 NRVPDVFCRRYSWHLRQPLDVIAMARAAAYLQGCHDFRSFCAAGSPVRHFERQVQQASVS 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G  I   V+A  FL+  +R  VG+L  +G  +     +   L A+ R++ GP AP  G
Sbjct: 179 QNGPFIYFDVIADGFLYHMVRIMVGTLVEIGRRRLVPEAIPAILAARSREKAGPTAPARG 238

Query: 239 LYFDSVEY 246
           L  + VEY
Sbjct: 239 LCLERVEY 246


>gi|307726601|ref|YP_003909814.1| tRNA pseudouridine synthase A [Burkholderia sp. CCGE1003]
 gi|307587126|gb|ADN60523.1| tRNA pseudouridine synthase A [Burkholderia sp. CCGE1003]
          Length = 270

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 133/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + ++Y+G+ + GWQ Q +G+++Q  +E+A+       V    AGRTD+GVH L Q
Sbjct: 1   MKRIALGVQYDGTAFCGWQSQPHGNTVQDELERALREFAQTPVHTVVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E   V   +  N++L    TIS+     + + FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELERADVSWVRGTNSFL--PKTISVQWAKPMPEAFHARFSAFERTYYYVLYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +  GRA  +  +LD + M  AA HL+G HDF+ FRS  CQ+ +P++ +   D+   
Sbjct: 119 VRSPMLAGRAGWVHAALDIDAMHAAAAHLIGEHDFSAFRSSQCQSKTPVKHLYQIDIQQH 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +  R  A +FLH  +R+ +G L  +G G+     + + L  +DR+   P   P+GLY
Sbjct: 179 GDFVHFRFRANAFLHHMVRNVMGCLVYIGKGRRPVQWMAEVLAGRDREWAAPTFMPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAQVGY 244


>gi|121602227|ref|YP_989569.1| tRNA pseudouridine synthase A [Bartonella bacilliformis KC583]
 gi|166228679|sp|A1UUB6|TRUA_BARBK RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|120614404|gb|ABM45005.1| tRNA pseudouridine synthase A [Bartonella bacilliformis KC583]
          Length = 247

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 122/247 (49%), Positives = 162/247 (65%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+GS Y GWQRQ    ++QG++E+AIF  +G+ + +  AGRTD+GVHA  Q
Sbjct: 1   MARFKLTLEYDGSNYAGWQRQAELRTVQGAVEQAIFHFSGQQLTITTAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIV-DKQFHARFSAIRRSYLYRIITR 119
           VAH D  ++W    +  ALNA+L+       +         F AR SA++R YL++I+ R
Sbjct: 61  VAHVDFEKDWHVNTIHNALNAHLRQQGDNIAILNVENIPDSFDARLSAVKRHYLFKILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +AP AL   R W +P+ L+ + M  AAQ LVG+HDFTTFRS HCQA SPIRT++  DV  
Sbjct: 121 RAPPALNAKRVWWLPRPLNADAMHKAAQKLVGKHDFTTFRSAHCQAKSPIRTLECLDVQR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  I +   ARSFLH QIRSF GSL  VG G+WT+ DLE+AL A+DR  CG +APP GL
Sbjct: 181 EGEEIFLYARARSFLHHQIRSFAGSLMEVGIGRWTAQDLEEALHAKDRARCGMVAPPSGL 240

Query: 240 YFDSVEY 246
           Y   V+Y
Sbjct: 241 YLTQVDY 247


>gi|118602946|ref|YP_904161.1| tRNA pseudouridine synthase A [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567885|gb|ABL02690.1| tRNA pseudouridine synthase A [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 247

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 133/247 (53%), Gaps = 3/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQ-KNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           ++  + + Y G+ + GWQ Q  N  ++Q  +E+A+  V    V V  +GRTD+GVHA  Q
Sbjct: 1   MKIALGVAYLGTNFHGWQCQKPNIRTVQQVVEQALSSVANHPVRVFCSGRTDAGVHATCQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+   +    +     NA L     ++   +  V+  FHARFSAI R Y Y+I   +
Sbjct: 61  VIHFETNIKRENKVWLFGGNANL--PSDVNFTWVKHVNDNFHARFSAIARQYNYKIHNTK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              ++    +    K LD   M  A+++L+G+H+F+ FR   CQA S I+TI+   +N  
Sbjct: 119 VRCSIITAHSLWESKKLDIMAMNKASKYLIGKHNFSAFRGSLCQAKSSIKTIEFIKLNKC 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I + + A +FLH  +R+ VG+L  VG G+ +   +++ L  + RK+  P AP  GLY
Sbjct: 179 DDNILLDIKADAFLHHMVRNIVGTLLKVGKGEKSIEWVKEILDNKQRKQAAPAAPSHGLY 238

Query: 241 FDSVEYS 247
           F    YS
Sbjct: 239 FIKAFYS 245


>gi|229083462|ref|ZP_04215810.1| tRNA pseudouridine synthase A [Bacillus cereus Rock3-44]
 gi|228699895|gb|EEL52532.1| tRNA pseudouridine synthase A [Bacillus cereus Rock3-44]
          Length = 252

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE V V  +GRTDS VHA  
Sbjct: 6   MERIKCTVAYDGINFCGYQIQPQHRTVQQEIEKALQKLHKGENVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLTLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  +L+G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYLIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK  +  + + L  Q+RK  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLDVGQGKLDADSIPEILAKQNRKFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|319780351|ref|YP_004139827.1| tRNA pseudouridine synthase A [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166239|gb|ADV09777.1| tRNA pseudouridine synthase A [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 256

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 129/247 (52%), Positives = 173/247 (70%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IEY+GS + GWQ Q +  S+Q +IE+AI    GE + +  AGRTD+GVHA  Q
Sbjct: 1   MPRFRLDIEYDGSLFAGWQHQADQPSVQQAIEQAIEKFCGEAIRLRAAGRTDAGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLS-IVDKQFHARFSAIRRSYLYRIITR 119
           VAH DLV+ W    +  A+NA+L+ +     +  + +V   F ARFSAI R YLYRI+ R
Sbjct: 61  VAHVDLVKAWPSDKVRDAVNAHLQAAGARIAILKATVVSDSFDARFSAIGRHYLYRILNR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +AP AL+KG+ W +PK LD   M  AA+ L+GRHDFTTFRS  CQA+SPIRT++  DV+ 
Sbjct: 121 RAPAALDKGKVWWVPKRLDAGAMHEAAKVLLGRHDFTTFRSTQCQANSPIRTLERLDVSR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G++IE+R  ARSFLH Q+RS VGSLK VGDG W++ DL+ AL+A+DR  CG +APP+GL
Sbjct: 181 QGDMIEVRASARSFLHNQVRSMVGSLKRVGDGGWSAADLKTALEARDRAACGQVAPPDGL 240

Query: 240 YFDSVEY 246
           +   V+Y
Sbjct: 241 FLTGVDY 247


>gi|313622273|gb|EFR92777.1| tRNA pseudouridine synthase A [Listeria innocua FSL J1-023]
          Length = 248

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 91/249 (36%), Positives = 126/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG+FG+Q Q N  ++Q  IEKA+  +  G+ V +  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFFGYQVQPNTRTVQAEIEKALEKMHKGKSVRITASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +      FHARF  I + Y Y I   
Sbjct: 61  QVIHFDSELDITAEKFQKAL--QVMTPFDISFLTVEEAQADFHARFGTIGKEYRYVIKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD E M+ A++ L+G HDFT+F S   +  S +RT+   D   
Sbjct: 119 KIFDPFSRNFALHYPYELDIEKMKQASERLIGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
                  I      FL+  +R   G+L   G G+ +  D+ KAL A DR++     APP+
Sbjct: 179 EDAETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDITKALLAHDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|299820989|ref|ZP_07052878.1| tRNA-pseudouridine synthase I [Listeria grayi DSM 20601]
 gi|299818010|gb|EFI85245.1| tRNA-pseudouridine synthase I [Listeria grayi DSM 20601]
          Length = 247

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 126/248 (50%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY +I+ Y+GSG+ G+Q Q +  ++Q  +E+A+  +  GE V V  +GRTD+GVHA  
Sbjct: 1   MPRYKVILAYDGSGFSGYQVQPHKRTVQSELEEALLKMHKGEFVRVTASGRTDTGVHAAG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       +AL         I I ++  V   FHAR+  + + Y Y I   
Sbjct: 61  QVIHFDSPLQIPNEKFQRALQRM--TPFDIGIHSVEQVPDDFHARYGTVGKEYRYVIKNS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                  +  A   P  L  E M+ A+Q L+G HDFT+F S   +  S +RTI   +   
Sbjct: 119 TDYDPFSRNFALHYPYPLSIEKMQEASQILIGEHDFTSFCSARTEQDSKVRTIYSIEFLK 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPEG 238
               I I      FL+  +R   G+L  +G G+ T+  LEKALQA+DR +     AP +G
Sbjct: 179 EKETITICYRGDGFLYNMVRILTGALLDIGQGRMTAETLEKALQAKDRTKLPSVTAPAQG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLWEVAY 246


>gi|224825086|ref|ZP_03698192.1| tRNA pseudouridine synthase A [Lutiella nitroferrum 2002]
 gi|224602757|gb|EEG08934.1| tRNA pseudouridine synthase A [Lutiella nitroferrum 2002]
          Length = 262

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 140/245 (57%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G  + GWQ Q +G+++Q  +  A+  +    +    AGRTD+GVHAL QV
Sbjct: 1   MRVALGVEYDGRAFAGWQSQPHGNTVQDKLNLALSHIACAPINTVAAGRTDAGVHALMQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+  E       + +N++L     I+++    VD++FHARFSA  RSY Y ++T   
Sbjct: 61  VHFDVEVERPENAWVRGVNSHL--PADIAVVWAKQVDEEFHARFSAFSRSYSYFLLTHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              L  G+     + LD E MR AA HL+GRHDF++FR+  CQA SP++ +   D++   
Sbjct: 119 RSCLLAGKVGWYHQPLDVEAMREAAAHLLGRHDFSSFRAAECQAKSPVKHLQRLDIHEAD 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I   ++A +FLH  +R+ VG+L  VG G  +  D+   L A+DR+   P   P+GLY 
Sbjct: 179 GFIRFDLLADAFLHHMVRNIVGALVYVGKGTLSPEDMVDLLSARDRRHAPPTFMPDGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 TGVGY 243


>gi|108758714|ref|YP_633269.1| tRNA pseudouridine synthase A [Myxococcus xanthus DK 1622]
 gi|30913405|sp|Q93NE2|TRUA_MYXXA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|14517923|gb|AAK64428.1|AF377337_4 pseudouridine synthase TruA [Myxococcus xanthus]
 gi|108462594|gb|ABF87779.1| tRNA pseudouridine synthase A [Myxococcus xanthus DK 1622]
          Length = 265

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/247 (36%), Positives = 121/247 (48%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + +EY G+ Y GWQ Q NG SIQ  +E  +  + G  V V  AGRTD+GVHA  Q
Sbjct: 1   MPRLKLTLEYEGTRYVGWQVQPNGPSIQSVLESGLERLLGARVSVASAGRTDAGVHASGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA FD  R          LN  L     +        D     R  +  + Y YR+  R+
Sbjct: 61  VACFDSPRVLPMKAYVMGLNGLLPPDVAVVDAVEVAEDFD--PRRWSRGKRYRYRVSNRR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +   W +   LD E MR AA HL+GRHDF+ FR+  CQA   +R I    V   
Sbjct: 119 TRSPLRRMTHWEVFAPLDVEAMRQAAAHLLGRHDFSAFRAADCQAKHAVREIRSLAVEGT 178

Query: 181 GNLIEIRVV-ARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
                  VV   +FL   +R+  G+L  VG G+  ++ + + L +Q+RK  GP APP+GL
Sbjct: 179 SGDAVSFVVEGTAFLKHMVRNLAGTLVEVGKGRRPASWVAEVLASQERKRAGPTAPPQGL 238

Query: 240 YFDSVEY 246
             + V Y
Sbjct: 239 VLEEVFY 245


>gi|85703371|ref|ZP_01034475.1| tRNA pseudouridine synthase A [Roseovarius sp. 217]
 gi|85672299|gb|EAQ27156.1| tRNA pseudouridine synthase A [Roseovarius sp. 217]
          Length = 257

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 118/250 (47%), Positives = 161/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQRQ +  S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MPRYALKIEYDGAPFAGWQRQVDHPSVQGAIEAALGRIEPGPHTIAAAGRTDAGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R+W    L +ALN +LK    ++I   + V + +HARFSA  R YL+RI++R+
Sbjct: 61  VAHCDLPRDWGTFRLSEALNYHLK-PLPVAITGCARVPEDWHARFSATERQYLFRILSRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP+ L++GR W +   LD + MR  A HL+G HDFTTFRS  CQA+SPI+T+D  +++  
Sbjct: 120 APVTLDQGRVWHVRPMLDIDAMRAGAAHLIGTHDFTTFRSTICQAASPIKTLDSIEISEH 179

Query: 181 G----NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                  I  ++ ARSFLH Q+RS VG+L+ VG G W    +  AL A+DR  CGP+ PP
Sbjct: 180 STPTGTEIHFQLRARSFLHNQVRSIVGTLERVGAGSWHPDQVRGALDARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 YGLYLAHVVY 249


>gi|83951133|ref|ZP_00959866.1| tRNA pseudouridine synthase A [Roseovarius nubinhibens ISM]
 gi|83839032|gb|EAP78328.1| tRNA pseudouridine synthase A [Roseovarius nubinhibens ISM]
          Length = 258

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 120/250 (48%), Positives = 167/250 (66%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MPRYALKVEYHGAPFAGWQRQKDQPSVQGAIEAALSALEPGAHTIAAAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R+W P  L +ALN +LK    ++I   + V + +HARFSA+ R YL+R++TR+
Sbjct: 61  VAHCDLRRDWDPFRLSEALNYHLK-PAPVAITACAPVAEDWHARFSALERRYLFRLLTRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G  W IP  LD + M+ A +HLVGRHDFTTFRS  CQA+SP++T+D   +   
Sbjct: 120 APATHDAGLVWQIPHRLDTDAMQTACRHLVGRHDFTTFRSSICQAASPVKTLDELTITEH 179

Query: 181 GNLIEI----RVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
             +        + ARSFLH Q+RSFVG+L+ VG G+W+  D++ AL A++R  CGP++PP
Sbjct: 180 EGVSGWEVRFFLRARSFLHNQVRSFVGTLERVGAGRWSPDDVKAALDARNRAACGPVSPP 239

Query: 237 EGLYFDSVEY 246
            GLY   VEY
Sbjct: 240 HGLYLAGVEY 249


>gi|15598310|ref|NP_251804.1| tRNA pseudouridine synthase A [Pseudomonas aeruginosa PAO1]
 gi|107102663|ref|ZP_01366581.1| hypothetical protein PaerPA_01003728 [Pseudomonas aeruginosa PACS2]
 gi|218890685|ref|YP_002439549.1| tRNA pseudouridine synthase A [Pseudomonas aeruginosa LESB58]
 gi|254236084|ref|ZP_04929407.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa C3719]
 gi|254241809|ref|ZP_04935131.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa 2192]
 gi|296388384|ref|ZP_06877859.1| tRNA pseudouridine synthase A [Pseudomonas aeruginosa PAb1]
 gi|313108437|ref|ZP_07794441.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa 39016]
 gi|8134770|sp|O87016|TRUA_PSEAE RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|9949225|gb|AAG06502.1|AE004735_9 tRNA-pseudouridine synthase I [Pseudomonas aeruginosa PAO1]
 gi|3237313|gb|AAC23941.1| HisT [Pseudomonas aeruginosa PAO1]
 gi|126168015|gb|EAZ53526.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa C3719]
 gi|126195187|gb|EAZ59250.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa 2192]
 gi|218770908|emb|CAW26673.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa LESB58]
 gi|310880943|gb|EFQ39537.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa 39016]
          Length = 285

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/245 (40%), Positives = 130/245 (53%), Gaps = 3/245 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           R  + IEY GS Y GWQRQ+    S+Q ++E+A+  V  E V V  AGRTD+ VHA  QV
Sbjct: 19  RIALGIEYKGSRYRGWQRQEAGVPSVQEALERALSKVAAEPVGVICAGRTDAAVHASGQV 78

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E          NA L     IS+    ++   FHARFSA+ R Y Y I     
Sbjct: 79  VHFDTAVERPLKAWVMGTNANL--PADISVTWARVMPAHFHARFSAMARRYRYAIYNDPI 136

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A          + LD   MR AAQ LVG HDFT+FR++ CQA SP++T+ H  +   G
Sbjct: 137 RPAHLAEEVTWNHRPLDIGRMREAAQVLVGTHDFTSFRAVQCQAKSPVKTMHHVRLLEHG 196

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
            LI + +   +FLH  +R+  G L  +G G+      ++ L+A+DR+  G  A P GLY 
Sbjct: 197 RLIVLDIRGNAFLHHMVRNIAGVLMTIGAGERPIEWAKEVLEARDRRAGGVTAHPYGLYL 256

Query: 242 DSVEY 246
             VEY
Sbjct: 257 VRVEY 261


>gi|85859802|ref|YP_462004.1| tRNA pseudouridine synthase A [Syntrophus aciditrophicus SB]
 gi|85722893|gb|ABC77836.1| tRNA pseudouridine synthase A [Syntrophus aciditrophicus SB]
          Length = 259

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 96/249 (38%), Positives = 139/249 (55%), Gaps = 5/249 (2%)

Query: 1   MIR--YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M R    +++EY+G+ Y GWQRQ N  +IQ  +E++I  +T E V++HG+GRTD+GVHAL
Sbjct: 13  MTRRNIKLVLEYDGTAYRGWQRQGNLPTIQKILEESIARITQEPVILHGSGRTDAGVHAL 72

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            QVA+F          L + LN+ L     I I     VD++FH+R+SA  +SYLYRI+ 
Sbjct: 73  NQVANFRTSSRIPAANLLRGLNSLL--PGDIVIRETEDVDEEFHSRYSAKSKSYLYRILN 130

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
                 L++  AW I   LD E M  A   L G+HDFT+F +      S +RTI   ++ 
Sbjct: 131 SPVRSPLQRNSAWFIRCCLDLEKMAGAISLLCGKHDFTSFCAAGSDVKSCVRTIIRAEIE 190

Query: 179 SFGNLIEIRVV-ARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                +    V A  FL   +R+ VG+L  +G G+ +S  +   L+A+DR   G  APP+
Sbjct: 191 RETEQVITISVEADGFLRHMVRNIVGTLVEIGAGQDSSEIMRDILEAKDRGCAGITAPPQ 250

Query: 238 GLYFDSVEY 246
           GL+   V Y
Sbjct: 251 GLFLQKVSY 259


>gi|313636153|gb|EFS02014.1| tRNA pseudouridine synthase A [Listeria seeligeri FSL S4-171]
          Length = 248

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 88/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R+  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V V  +GRTD+GVHA  
Sbjct: 1   MTRFKAIISYDGSGFYGYQVQPNTRTVQAEIEKALKKMHKGKSVRVTASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +      FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDISAEKFQKAL--QVMTPFDISFLIVEEAPADFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  L+ E M++A++ LVG HDFT+F S   +  S +RT+   D   
Sbjct: 119 KVFDPFSRNFALHYPYELNLEKMKLASERLVGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EDDETLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDITKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|167573521|ref|ZP_02366395.1| tRNA pseudouridine synthase A [Burkholderia oklahomensis C6786]
          Length = 270

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q ++E+A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQSQPHGKTVQDALERALAEFAQTSLHTTVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L    T+S+     +   FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTELDRADFSWVRGTNAFL--PSTVSVQWAKPMPDTFHARFAAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +  GRA  +   LD + MR AA+HLVG HDF+ FRS  CQA SPI+ +    +   G
Sbjct: 119 RSPMLAGRAGWVHMPLDVDAMREAAEHLVGEHDFSAFRSSECQAKSPIKHLYQISIRPDG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ ++ L + L ++DR    P   PEGLY 
Sbjct: 179 DFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPASWLAEVLDSRDRDCAAPTFMPEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|229067907|ref|ZP_04201224.1| tRNA pseudouridine synthase A [Bacillus cereus F65185]
 gi|228715266|gb|EEL67125.1| tRNA pseudouridine synthase A [Bacillus cereus F65185]
          Length = 252

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q N  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTSLSLEEWQWINALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QNDEIIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|18309973|ref|NP_561907.1| tRNA pseudouridine synthase A [Clostridium perfringens str. 13]
 gi|24212547|sp|Q8XLQ0|TRUA1_CLOPE RecName: Full=tRNA pseudouridine synthase A 1; AltName: Full=tRNA
           pseudouridylate synthase I 1; AltName: Full=tRNA-uridine
           isomerase I 1
 gi|18144651|dbj|BAB80697.1| tRNA-pseudouridine synthase I [Clostridium perfringens str. 13]
          Length = 248

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + + +N YL   + I +  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIEYINEYL--PEDIRVTEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIMVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPA 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|163938150|ref|YP_001643034.1| tRNA pseudouridine synthase A [Bacillus weihenstephanensis KBAB4]
 gi|163860347|gb|ABY41406.1| tRNA pseudouridine synthase A [Bacillus weihenstephanensis KBAB4]
          Length = 252

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 123/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q +  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MERIKCTVAYDGIHFCGYQIQPHHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN+ L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNSML--PDDIIIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|313631806|gb|EFR98984.1| tRNA pseudouridine synthase A [Listeria seeligeri FSL N1-067]
          Length = 248

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+GSG++G+Q Q N  ++Q  IEKA+  +  G+ V V  +GRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGSGFYGYQVQPNTRTVQAEIEKALKKMHKGKSVRVTASGRTDTGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD   +       KAL   +     IS L +      FHARF  + + Y Y +   
Sbjct: 61  QVIHFDSELDISAEKFQKAL--QVMTPFDISFLIVEEALADFHARFGTVGKEYRYVVKRT 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  L+ E M++A++ LVG HDFT+F S   +  S +RT+   D   
Sbjct: 119 KVFDPFSRNFALHYPYELNLEKMKLASERLVGEHDFTSFCSARTERDSKVRTLYSIDFYE 178

Query: 180 FGNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECG-PLAPPE 237
             +    I      FL+  +R   G+L   G G+ +  D+ KAL A+DR++     APP+
Sbjct: 179 EDDDTLVIAFQGNGFLYNMVRILTGTLLDAGQGRISPDDITKALLARDRQKLISKTAPPQ 238

Query: 238 GLYFDSVEY 246
           GLY   V+Y
Sbjct: 239 GLYLWRVDY 247


>gi|260584448|ref|ZP_05852195.1| tRNA pseudouridine synthase A [Granulicatella elegans ATCC 700633]
 gi|260157966|gb|EEW93035.1| tRNA pseudouridine synthase A [Granulicatella elegans ATCC 700633]
          Length = 250

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 132/246 (53%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGE-IVVVHGAGRTDSGVHALRQ 60
            RY +I+ Y+G+ Y G+Q Q+NG+SIQ  + KA+  +T    + V G+GRTDSGVHA  Q
Sbjct: 3   FRYKVILSYDGTNYVGFQVQENGNSIQAELNKALRKMTKGLYIPVCGSGRTDSGVHANGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +     L +ALN+ L   D IS   +  V  +FHAR+S   + Y+YR+  ++
Sbjct: 63  VIHFDYPTKIEEENLQRALNSLL--PDDISAKQVMAVSDEFHARYSVTGKRYIYRVNIQK 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +      P  ++ +NM  A Q ++G HDFT+F S      S +R +   +V   
Sbjct: 121 FVNPFSRLYTLHHPYRVNVDNMNEALQAVIGEHDFTSFCSTKTDKESKVRIVTKAEVVEK 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              +        FL+  IR  VG+   +GDG    +D+   L A DR++ GP APP+GLY
Sbjct: 181 DGELVFTFEGNGFLYNMIRILVGTSLQIGDGLRPVSDMRDILVAMDRQKAGPTAPPQGLY 240

Query: 241 FDSVEY 246
            D V Y
Sbjct: 241 LDEVFY 246


>gi|160875946|ref|YP_001555262.1| tRNA pseudouridine synthase A [Shewanella baltica OS195]
 gi|189030142|sp|A9KTU7|TRUA_SHEB9 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|160861468|gb|ABX50002.1| tRNA pseudouridine synthase A [Shewanella baltica OS195]
 gi|315268141|gb|ADT94994.1| tRNA pseudouridine synthase A [Shewanella baltica OS678]
          Length = 261

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+GYFGWQRQ    S+Q  +E+A+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGNGYFGWQRQAEVDSVQAQLERALSIVANEPIGVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETNAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M  AAQ L+G  DFT+FR++ CQ+ +P R +   +V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADRMHQAAQALLGEQDFTSFRAVQCQSKTPFRNVHCVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|302390990|ref|YP_003826810.1| tRNA pseudouridine synthase A [Acetohalobium arabaticum DSM 5501]
 gi|302203067|gb|ADL11745.1| tRNA pseudouridine synthase A [Acetohalobium arabaticum DSM 5501]
          Length = 244

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 131/246 (53%), Gaps = 3/246 (1%)

Query: 2   IRY-CMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           +RY   II Y+G+ Y+G+Q Q +  +IQ  +E+++ ++T E   V  AGRTD GVHA  Q
Sbjct: 1   MRYLKAIIAYDGTNYYGFQHQPDVPTIQDELEESLRILTKEKNKVIVAGRTDRGVHAQNQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F          +  A N  L   + I I  +  V+  FHAR+ A  + Y YRI+ + 
Sbjct: 61  VINFKTESPIPLENIRFAWNNCL--PNDILIKEVEDVNADFHARYDAEGKIYEYRILNQP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P   ++   + I + LD   M  AA+ L+G +DF++F++      + +RTI   +V   
Sbjct: 119 LPSVFKRNYTYHIKEELDSAAMAEAAECLIGTYDFSSFQASGSNVQTTVRTIQQAEVTQQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
             L+  R+    FL+  +R  VG+L  VG G+W    + + ++A+DR   GP AP +GL 
Sbjct: 179 DRLVIFRIEGDGFLYNMVRIIVGTLIKVGTGEWEVPRMSRIIEAEDRLAAGPTAPAQGLR 238

Query: 241 FDSVEY 246
              V+Y
Sbjct: 239 LIKVKY 244


>gi|28212149|ref|NP_783093.1| tRNA pseudouridine synthase A [Clostridium tetani E88]
 gi|38258761|sp|Q890R5|TRUA2_CLOTE RecName: Full=tRNA pseudouridine synthase A 2; AltName: Full=tRNA
           pseudouridylate synthase I 2; AltName: Full=tRNA-uridine
           isomerase I 2
 gi|28204593|gb|AAO37030.1| tRNA pseudouridine synthase A [Clostridium tetani E88]
          Length = 248

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 86/250 (34%), Positives = 133/250 (53%), Gaps = 5/250 (2%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQK--NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHA 57
           M R   + +EY+G+ Y GWQ+QK  N  +IQ SIEKAI   T E V + G+ RTD+GVHA
Sbjct: 1   MARNVRLKVEYDGTNYSGWQKQKDKNIKTIQSSIEKAIEEATKEEVELIGSSRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L   A+F             ALN +L   + I IL    V  +FH+RF  I ++Y+Y+I+
Sbjct: 61  LAYTANFKTCSTIPGEKFKHALNRFL--PEDIVILESEEVPMEFHSRFDCIGKTYVYKIL 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
            R     +++   + +   LD  +M  A++ L+G HDF  F+       + +RTI + ++
Sbjct: 119 NRPLFSPIQRNYIYHVKDELDINSMIEASKFLIGTHDFNAFKKSGGNLKTTVRTITNINI 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
               +++EI V    FL+  +R   G+L  VG  +    D+   LQ++DR + G  AP  
Sbjct: 179 LKSNDIVEIHVSGDGFLYNMVRIISGTLIEVGLSRRKPEDISIILQSKDRCKAGMCAPAR 238

Query: 238 GLYFDSVEYS 247
           GLY   + Y+
Sbjct: 239 GLYLKELFYN 248


>gi|328951883|ref|YP_004369217.1| tRNA pseudouridine synthase A [Desulfobacca acetoxidans DSM 11109]
 gi|328452207|gb|AEB08036.1| tRNA pseudouridine synthase A [Desulfobacca acetoxidans DSM 11109]
          Length = 267

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 129/244 (52%), Gaps = 3/244 (1%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
            C+ +EY+G+ Y GWQRQ N  +IQ  +E  +  +TG+++ +H +GRTD+GVHAL QVAH
Sbjct: 25  ICLTLEYDGTAYHGWQRQANALTIQEVVETCLARLTGQVIRLHSSGRTDAGVHALGQVAH 84

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F            + LN+ L     ++IL +      FHAR+SA  ++Y YRI+ R    
Sbjct: 85  FLTTSSLPLSAFREGLNSLL--PRDLAILKVCDAPAGFHARYSATAKTYEYRILNRPVRS 142

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
            +     W + + LD   +R AA +++G  DF  F++      +  R +           
Sbjct: 143 PVHCNYCWWLARPLDQGLLRQAAGYILGEQDFAAFQASGGSVKTTTRKVMAASWEEKPGG 202

Query: 184 I-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
               ++ A  FL   +R+ VG++  VG GK +  DL++ L A+DR++ GP AP  GLY  
Sbjct: 203 WRIFQITANGFLRGMVRALVGTMVEVGWGKRSPGDLKRLLAARDRRQAGPTAPAAGLYLV 262

Query: 243 SVEY 246
            V Y
Sbjct: 263 EVRY 266


>gi|270291103|ref|ZP_06197326.1| tRNA pseudouridine synthase A [Pediococcus acidilactici 7_4]
 gi|304385383|ref|ZP_07367728.1| tRNA pseudouridine synthase A [Pediococcus acidilactici DSM 20284]
 gi|270280499|gb|EFA26334.1| tRNA pseudouridine synthase A [Pediococcus acidilactici 7_4]
 gi|304328590|gb|EFL95811.1| tRNA pseudouridine synthase A [Pediococcus acidilactici DSM 20284]
          Length = 248

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 119/250 (47%), Gaps = 7/250 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI---VVVHGAGRTDSGVHAL 58
           +RY + + Y+G+ + G+Q Q N  +++G +++A+  +       + + G+GRTD+GVHA 
Sbjct: 1   MRYKITMAYDGTNFAGFQAQPNQRTVEGVLKRAVNKIAKNPQPEIPIFGSGRTDAGVHAF 60

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            QV HFDL  E     +  ALN+ L       +  + IVD+ FHARF+   + Y YR+  
Sbjct: 61  GQVVHFDLPIEMTANNMLHALNSIL--PLDTQVKKVEIVDEDFHARFTTHGKRYQYRMAL 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            +     ++         +  E ++ A + L G HDF++F +    A + +RTI      
Sbjct: 119 GEFVDPFKRNYTGHWKFPISIELIQQAIKDLEGTHDFSSFVASGSTAKNHVRTIYEAKAW 178

Query: 179 SFGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                 E         FL+  +R  V  L  +G  +    D+ + L  +DR +    AP 
Sbjct: 179 KDEAQNEIIFEFYGNGFLYNMVRIMVAVLVEIGSKRRPVDDIPRLLAVKDRNQARGTAPA 238

Query: 237 EGLYFDSVEY 246
            GLY   V+Y
Sbjct: 239 SGLYLKEVDY 248


>gi|163738320|ref|ZP_02145735.1| Pseudouridylate synthase [Phaeobacter gallaeciensis BS107]
 gi|161388241|gb|EDQ12595.1| Pseudouridylate synthase [Phaeobacter gallaeciensis BS107]
          Length = 257

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 114/250 (45%), Positives = 164/250 (65%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+G+ + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRFALKVEYHGAPFAGWQRQKDQPSVQGAIEDALARLEPGPHTIAAAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+V++W P  L +ALN +LK    ++I++ +  +  +HARFSA+ R YL+RI+ R+
Sbjct: 61  VAHCDMVKDWDPFRLSEALNFHLK-PAPVAIVDCARAEDDWHARFSAVERQYLFRILIRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G+ W +   LD  +M+ AA HL+G+HDFTTFRS  CQA+SP++T+D   +   
Sbjct: 120 APATHDAGQVWQLNHDLDAGSMQEAANHLIGQHDFTTFRSSICQAASPLKTLDELRIERV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                  I   V ARSFLH Q+RSFVG+L+ VG G W+  D++ AL+A+DR  CGP+ P 
Sbjct: 180 QGFSGPEIHFHVRARSFLHNQVRSFVGTLERVGAGAWSPEDVKSALEAEDRAACGPVCPG 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 HGLYLARVGY 249


>gi|71892269|ref|YP_278003.1| tRNA pseudouridine synthase A [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|123775274|sp|Q492H3|TRUA_BLOPB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|71796375|gb|AAZ41126.1| tRNA pseudouridine synthase A [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 261

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 101/246 (41%), Positives = 134/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + IEY+GS Y GWQRQ++  SIQ  IE AI  +T E V V  AGRTDSGVHAL Q
Sbjct: 1   MQKLALGIEYDGSWYCGWQRQRDAPSIQSYIENAIKKITSESVTVFCAGRTDSGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+             +N YL    +I +    +V+K FHARFSAI R Y Y I    
Sbjct: 61  VVHFETYSRRSKSAWTLGMNRYL--PSSICVRWARLVNKDFHARFSAISRRYCYIINNNC 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL   + W   K LD   M  AAQ+L+G +DF++FR+  CQ+ S  R + H  +   
Sbjct: 119 IRSALLFRKTWHYKKYLDINKMCDAAQYLLGENDFSSFRAAGCQSYSARRKLYHIRIIRK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I I + A SF++  +R+ VGSL  VG G+     + + L+  +R   G  AP  GLY
Sbjct: 179 GQCIVIDIKANSFMYRMVRNIVGSLVKVGCGEQPEKWIAELLENCNRSLAGVTAPASGLY 238

Query: 241 FDSVEY 246
              V+Y
Sbjct: 239 LVEVKY 244


>gi|182625331|ref|ZP_02953105.1| tRNA pseudouridine synthase A [Clostridium perfringens D str.
           JGS1721]
 gi|177909489|gb|EDT71936.1| tRNA pseudouridine synthase A [Clostridium perfringens D str.
           JGS1721]
          Length = 248

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + + +N YL   + I I  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIEYINEYL--PEDIRITEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIIVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPA 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|158520483|ref|YP_001528353.1| tRNA pseudouridine synthase A [Desulfococcus oleovorans Hxd3]
 gi|158509309|gb|ABW66276.1| tRNA pseudouridine synthase A [Desulfococcus oleovorans Hxd3]
          Length = 252

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 96/246 (39%), Positives = 130/246 (52%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
             + +IIEY+G+ + GWQ QK+  ++QG I  A+  +TG+ V V G+GRTD+GVHA+ QV
Sbjct: 3   KNFRLIIEYDGACFHGWQIQKDLRTVQGEITGALASITGQAVSVIGSGRTDAGVHAMAQV 62

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A F       P  L KALN  L     I       V   FHAR+SA  ++Y YRI+ R  
Sbjct: 63  ASFICDTRLEPGTLQKALNGILAKDIVIHDC--REVSLNFHARYSAKSKTYRYRILNRNL 120

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS-F 180
           P AL +G AW I K LD   M  A  H++GRHDF++F       +S +R +     N   
Sbjct: 121 PAALYRGYAWHIKKPLDLGAMTAALPHILGRHDFSSFEGTGSPKASSVRHVTAATFNMAE 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              +   + A  FL   +R+ VG+L  VG GK T   +   L A+DR   G  AP  GL+
Sbjct: 181 DGYLAFEITADGFLKHMVRNIVGTLVEVGLGKKTPEAVADILAAKDRSRAGATAPGHGLF 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LVRVNY 246


>gi|219870357|ref|YP_002474732.1| tRNA pseudouridine synthase A [Haemophilus parasuis SH0165]
 gi|254789638|sp|B8F382|TRUA_HAEPS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|219690561|gb|ACL31784.1| tRNA pseudouridine synthase A [Haemophilus parasuis SH0165]
          Length = 262

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 125/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEY+G  Y GWQRQ+   S+Q  +E+A+ ++      V  AGRTD+GVHA  QV
Sbjct: 1   MKIALGIEYDGCRYCGWQRQQYVDSVQQRLEEALSVIANSSCEVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD          C   NA+L     +       V   FHARFSA+ R Y Y I   + 
Sbjct: 61  VHFDTDVNRPMQSWCLGTNAHLPEDIVVKWAIG--VSDDFHARFSALARRYRYVIYNNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+          SLD E M  A Q L+G +DF++FR+  CQ+ +P R + H  V+   
Sbjct: 119 RSAILPKGISHYHYSLDHEKMHEAGQFLLGENDFSSFRAAKCQSHTPWRNVHHLIVSRHQ 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I + + A +F+H  +R+ VGSL  VG G      ++  L+ +DR    P A  EGLY 
Sbjct: 179 DYIILDIQANAFVHHMVRNIVGSLIEVGRGDKPVEWIKWLLEKRDRTLAAPTAKAEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VEVIY 243


>gi|218781331|ref|YP_002432649.1| tRNA pseudouridine synthase A [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762715|gb|ACL05181.1| tRNA pseudouridine synthase A [Desulfatibacillum alkenivorans
           AK-01]
          Length = 245

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 94/247 (38%), Positives = 134/247 (54%), Gaps = 3/247 (1%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R + +I+EY+G+ Y GWQRQ +  +IQ  +E A+  +T +  VV+GAGRTDSGVHAL 
Sbjct: 1   MKRNFKLILEYDGTHYHGWQRQPHDLTIQEVLEGALEKITRQKCVVYGAGRTDSGVHALN 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
            VA+F         +  KALN+ L     I     ++    FHAR SA+ + Y Y I   
Sbjct: 61  YVANFRCNTHLDAGVFVKALNSTL--PKDIVCKESTLAPDGFHARKSAVSKIYEYHITNG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
             P A+ +  AW + + LD E M  AA+  +G HDF+ F       ++ +R I    + S
Sbjct: 119 PTPPAVCRQYAWHVRRRLDKEAMTRAAKLFLGSHDFSAFEGAGSPKATSVRNIMQSHIQS 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
           + N I  RV A  FL   +R+ VG+L  +G GK     +   L + DR + GP APPEGL
Sbjct: 179 WENHIIYRVEANGFLRYMVRNIVGTLVYIGMGKIPPEAVMDILASGDRGQAGPTAPPEGL 238

Query: 240 YFDSVEY 246
           +   V+Y
Sbjct: 239 FMMCVKY 245


>gi|170749553|ref|YP_001755813.1| tRNA pseudouridine synthase A [Methylobacterium radiotolerans JCM
           2831]
 gi|238688894|sp|B1M6N9|TRUA_METRJ RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|170656075|gb|ACB25130.1| tRNA pseudouridine synthase A [Methylobacterium radiotolerans JCM
           2831]
          Length = 253

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 114/250 (45%), Positives = 159/250 (63%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY ++IEY+GS + GWQRQ +  ++QG+IE A+   +GE   +  AGRTD+GVHA+ Q
Sbjct: 1   MPRYKLVIEYDGSPFCGWQRQADDPTVQGAIEAAVTRFSGENARLTCAGRTDAGVHAIHQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++W    +  ALNA+L+    ++IL+   V   F AR SAIRR Y YRI+ R+
Sbjct: 61  VAHLDLAKDWRTDTVRDALNAHLR-PQPVAILSAETVPDSFDARHSAIRRHYRYRILNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD---- 176
           +P AL +   W +P  LD + M  AAQ LVGRHDF+ FR+  CQA+SPIRT++  D    
Sbjct: 120 SPAALTRAHVWHVPWPLDADLMHDAAQRLVGRHDFSAFRAAECQANSPIRTLEQLDVARA 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
             +  + I +   ARSFLH Q+R+ VG+L L G  +  + D+ + L + D+  CGPLAP 
Sbjct: 180 PMALHDEIVVATAARSFLHHQVRAMVGTLMLAGCRRLAADDVAEILASGDKSRCGPLAPA 239

Query: 237 EGLYFDSVEY 246
            GL F  V+Y
Sbjct: 240 AGLTFVGVDY 249


>gi|110800554|ref|YP_695694.1| tRNA pseudouridine synthase A [Clostridium perfringens ATCC 13124]
 gi|110675201|gb|ABG84188.1| tRNA pseudouridine synthase A [Clostridium perfringens ATCC 13124]
          Length = 248

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + + +N YL   + I +  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIEYINEYL--PEDIRVKEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIIVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPA 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|168208061|ref|ZP_02634066.1| tRNA pseudouridine synthase A [Clostridium perfringens E str.
           JGS1987]
 gi|168215906|ref|ZP_02641531.1| tRNA pseudouridine synthase A [Clostridium perfringens NCTC 8239]
 gi|169341141|ref|ZP_02863234.1| tRNA pseudouridine synthase A [Clostridium perfringens C str.
           JGS1495]
 gi|169299748|gb|EDS81800.1| tRNA pseudouridine synthase A [Clostridium perfringens C str.
           JGS1495]
 gi|170660642|gb|EDT13325.1| tRNA pseudouridine synthase A [Clostridium perfringens E str.
           JGS1987]
 gi|182381869|gb|EDT79348.1| tRNA pseudouridine synthase A [Clostridium perfringens NCTC 8239]
          Length = 248

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + + +N YL   + I +  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIEYINEYL--PEDIRVTEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIIVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPA 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|328958698|ref|YP_004376084.1| tRNA pseudouridine synthase A [Carnobacterium sp. 17-4]
 gi|328675022|gb|AEB31068.1| tRNA pseudouridine synthase A [Carnobacterium sp. 17-4]
          Length = 279

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 133/247 (53%), Gaps = 5/247 (2%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQV 61
           RY +I++Y+G+ + G+Q Q +  ++QG I+KA+ ++T G  V++HG+GRTDSGVHA  QV
Sbjct: 5   RYKLIVQYDGTHFAGFQIQPHDRTVQGEIQKALKIMTKGIEVIIHGSGRTDSGVHAKGQV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD         + +ALN+       +  +++     +FHAR++   + Y YR+   + 
Sbjct: 65  IHFDYPFVIPAKNMKRALNSLTSDEIFVKDVSIVED--EFHARYNTSGKKYQYRVDLNEI 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P   ++      P  LD + ++ A + L G HDF +F + H    + +RT+    V    
Sbjct: 123 PDPFKRLYTLHHPYPLDMDKLKNALKDLEGEHDFASFCASHSGRENKVRTVYEASVVKDD 182

Query: 182 NLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              E         FL+  +R FVG+L  + +G   + ++++ L+ +DR E GP A P+GL
Sbjct: 183 FNNELLFTFRGNGFLYNMVRIFVGTLLQIANGLRPADEIQRLLEVKDRNEAGPTAKPQGL 242

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 243 YLMEVYY 249


>gi|251792608|ref|YP_003007334.1| tRNA pseudouridine synthase A [Aggregatibacter aphrophilus NJ8700]
 gi|247534001|gb|ACS97247.1| tRNA pseudouridine synthase A [Aggregatibacter aphrophilus NJ8700]
          Length = 261

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 133/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + +EY+G  YFGWQ+Q+  +S+Q  +E+AI  V  E + +  AGRTDSGVHA  QV
Sbjct: 1   MKIALGVEYDGKQYFGWQKQEKVASVQAELERAISTVANEEISIFCAGRTDSGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D +++    +VD  FHARFSA  R Y Y +   + 
Sbjct: 61  IHFETTANRPEKAWSFGVNANL--PDDVAVRWAKVVDDDFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+++P R + H +V+  G
Sbjct: 119 RSAILPQGVTHCHLELDHQLMHQAGQALLGENDFSSFRAAQCQSNTPWRNVHHLNVSRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G  +   L   L  +DR    P A PEGLY 
Sbjct: 179 QYIIVDIQANAFVHHMVRNIVGSLIEVGCGNQSVEWLAWLLAQKDRTLAAPTAKPEGLYL 238

Query: 242 DSVEY 246
            +V Y
Sbjct: 239 VNVFY 243


>gi|313884603|ref|ZP_07818364.1| tRNA pseudouridine synthase A [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620387|gb|EFR31815.1| tRNA pseudouridine synthase A [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 256

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 95/252 (37%), Positives = 136/252 (53%), Gaps = 8/252 (3%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG----EIVVVHGAGRTDSGVH 56
           M RY + +EY+GS Y G+Q Q NG S+Q  +++A+  +        V+   +GRTDSGVH
Sbjct: 1   MPRYAIKVEYDGSNYVGYQVQPNGPSVQAQLDRALLKLAKRPADHPVLTVASGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           AL QV HFDL  E  P+ L KALN+ L     I ++ +S V   FHAR+ AI ++YLYRI
Sbjct: 61  ALGQVVHFDLDFEIHPLALAKALNSILNK--DIRVVAVSQVAPDFHARYHAIGKAYLYRI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH-- 174
            T+  P   ++      P   D   M+ A   LVG+HDFT+F S H      +RTI    
Sbjct: 119 DTQAYPDPFKRFYTLHHPYRYDLGKMQRALTDLVGQHDFTSFCSTHSDKEDKVRTIKFAT 178

Query: 175 FDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLA 234
            + +     +   +    FL+  +R  VG+L  +GDG     + ++ L  +DR + GP A
Sbjct: 179 IEEDLVNQELRFMIAGNGFLYNMVRIIVGTLLQIGDGLKPVDEFKRLLAVKDRNQAGPTA 238

Query: 235 PPEGLYFDSVEY 246
            P GLY   V+Y
Sbjct: 239 DPSGLYLYRVDY 250


>gi|323126548|gb|ADX23845.1| tRNA pseudouridine synthase A [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 249

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/249 (31%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV-TGEIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+QRQ +  ++Q  IEK +  + +G+ V +HGAGRTD+GVHA  
Sbjct: 1   MTRYKATISYDGTLFSGFQRQSHARTVQEEIEKTLQKLASGQPVPIHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++     L  AL+   +  D I +++L+IV   FH R+    ++Y + +   
Sbjct: 61  QVIHFDLPQKRDLEKLRFALDT--QTPDDIDVVDLAIVADDFHCRYQKHSKTYEFLVDNG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD--V 177
           +    + +  A   P  LD   M+ A + LVG HDFT F +      + +RTI       
Sbjct: 119 RPKNPMMRHYATHYPYPLDINKMQEAIKDLVGTHDFTGFTAAGTSVENKVRTITEATLVQ 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     ++  L +++R+  GP     
Sbjct: 179 DDKTGFLVFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVEQIKVILDSKNRQLAGPTPAGN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|298383909|ref|ZP_06993470.1| tRNA pseudouridine synthase A [Bacteroides sp. 1_1_14]
 gi|298263513|gb|EFI06376.1| tRNA pseudouridine synthase A [Bacteroides sp. 1_1_14]
          Length = 269

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 90/249 (36%), Positives = 119/249 (47%), Gaps = 7/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NGSS+Q  + KA+       V V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGSSVQECLMKALSTFLRRDVEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD       V +   LN  L     IS+  +  V    HARF A  R+Y Y + T  
Sbjct: 61  VAHFDHEDVLDTVTVADKLNRLL--PPDISVYRVRQVKPDAHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A     +     +  SLD E M  AA+ L    DFT+F  +H    + I  I H +    
Sbjct: 117 AKYPFNRQYRCRVYGSLDYERMNEAARTLFEYIDFTSFSKLHTDVKTNICHISHAEWTKM 176

Query: 181 ---GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                     + A  FL   +R+ VG+L  VG GK T     K ++ QDR + G  AP  
Sbjct: 177 EGEDTTWVFTIRADRFLRNMVRAIVGTLLEVGRGKLTVEGFRKVIEQQDRCKAGTSAPGN 236

Query: 238 GLYFDSVEY 246
            L+  +VEY
Sbjct: 237 ALFLVNVEY 245


>gi|126697674|ref|YP_001086571.1| tRNA pseudouridine synthase 1 [Clostridium difficile 630]
 gi|254973765|ref|ZP_05270237.1| tRNA pseudouridine synthase 1 [Clostridium difficile QCD-66c26]
 gi|255091155|ref|ZP_05320633.1| tRNA pseudouridine synthase 1 [Clostridium difficile CIP 107932]
 gi|255099266|ref|ZP_05328243.1| tRNA pseudouridine synthase 1 [Clostridium difficile QCD-63q42]
 gi|255305049|ref|ZP_05349221.1| tRNA pseudouridine synthase 1 [Clostridium difficile ATCC 43255]
 gi|255312809|ref|ZP_05354392.1| tRNA pseudouridine synthase 1 [Clostridium difficile QCD-76w55]
 gi|255515568|ref|ZP_05383244.1| tRNA pseudouridine synthase 1 [Clostridium difficile QCD-97b34]
 gi|255648663|ref|ZP_05395565.1| tRNA pseudouridine synthase 1 [Clostridium difficile QCD-37x79]
 gi|260681880|ref|YP_003213165.1| tRNA pseudouridine synthase 1 [Clostridium difficile CD196]
 gi|260685478|ref|YP_003216611.1| tRNA pseudouridine synthase 1 [Clostridium difficile R20291]
 gi|306518785|ref|ZP_07405132.1| tRNA pseudouridine synthase ACD [Clostridium difficile QCD-32g58]
 gi|115249111|emb|CAJ66922.1| transfer RNA pseudouridine synthase A 1 [Clostridium difficile]
 gi|260208043|emb|CBA60248.1| tRNA pseudouridine synthase 1 [Clostridium difficile CD196]
 gi|260211494|emb|CBE01638.1| tRNA pseudouridine synthase 1 [Clostridium difficile R20291]
          Length = 243

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 128/246 (52%), Gaps = 3/246 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + I+YNG  Y GWQ+Q +   IQG+IE+AI+ +T E   + G+GRTDSGVHA+ Q
Sbjct: 1   MRNIKIKIQYNGKNYCGWQKQPDSLGIQGTIERAIYDITKEETSLIGSGRTDSGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +A+F +        +  ALNA L     IS++    V+  FH+R+SA  ++Y Y +   +
Sbjct: 61  IANFKINSGISIESIPMALNAKL--PKDISVIEACEVNDDFHSRYSAKGKTYKYLVYNSK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +    ++ +   LD + M   A+ L+G HDF  F S        +RTI   D++  
Sbjct: 119 FRNPILSEISYQVKYELDFDKMCSEAKSLLGTHDFKGFMSSGSSVKDTVRTIYDIDISKK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +LI   +    FL+  +R  VG+L  +G G+         +Q++ R  CG  AP +GL+
Sbjct: 179 DDLITFEISGNGFLYNMVRIIVGTLVDMGRGRIN-EPFLDIIQSKTRSRCGHTAPAQGLF 237

Query: 241 FDSVEY 246
              V Y
Sbjct: 238 LKKVHY 243


>gi|317055617|ref|YP_004104084.1| tRNA pseudouridine synthase A [Ruminococcus albus 7]
 gi|315447886|gb|ADU21450.1| tRNA pseudouridine synthase A [Ruminococcus albus 7]
          Length = 245

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 85/241 (35%), Positives = 124/241 (51%), Gaps = 2/241 (0%)

Query: 6   MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAHFD 65
           M + Y+GS Y GWQRQ N  ++Q  +E AIF +TGE VVV G  RTD+GVHA   V  F 
Sbjct: 1   MTLAYDGSNYHGWQRQSNALAVQEVVEDAIFKLTGENVVVQGCSRTDAGVHAREYVLSFG 60

Query: 66  LVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPLAL 125
           L        +   LN++L   D IS++     D+ FHAR+    + Y Y +   +     
Sbjct: 61  LELPINCRGIQLGLNSWL--PDDISVIGCEEADEGFHARYMCKGKEYEYIVHNSRIKDPF 118

Query: 126 EKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNLIE 185
            +  A+     +D   +  AA++ VG HDF  F S  C     +R I  FDV   G+ + 
Sbjct: 119 MRNTAFRNTYPIDEVLLDRAAKYFVGEHDFKAFCSTACDKEITVRKIYRFDVRREGDKVI 178

Query: 186 IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDSVE 245
             V    FL+  +R  VG+L  + +GK  +  + + L ++DRK+ G   PP+GLY + V 
Sbjct: 179 FTVAGNGFLYNMVRIMVGTLLFINEGKIAADAIPRILDSKDRKKAGKTVPPQGLYLNKVY 238

Query: 246 Y 246
           Y
Sbjct: 239 Y 239


>gi|322386788|ref|ZP_08060412.1| tRNA pseudouridine synthase A [Streptococcus cristatus ATCC 51100]
 gi|321269070|gb|EFX52006.1| tRNA pseudouridine synthase A [Streptococcus cristatus ATCC 51100]
          Length = 249

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  +I Y+G  + G+QRQ +  S+Q  IEK +  +  G+ +V+HGAGRTDSGVHAL 
Sbjct: 1   MTRYKALISYDGHDFAGFQRQPHARSVQEEIEKTLTRINKGQPIVIHGAGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL        L  AL+   +  + I ++++  V + FHAR+    ++Y + +   
Sbjct: 61  QVIHFDLPSARDEEKLRFALDT--QTPEDIDVISVEEVTEDFHARYKPHSKTYEFLVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHF--DV 177
           +    + +  A   P  L+   M  A + L G HDFT F +      + +RTI       
Sbjct: 119 RPKNPMMRHYATHYPYPLEIPLMEQAIKALEGTHDFTGFTASGTSVENKVRTITKASLTF 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           ++  N +        FL+ QIR+ VG+L  +G+ +     +E+ L+ +DR+  GP A P 
Sbjct: 179 DAQRNFLVFTFSGNGFLYKQIRNMVGTLLKIGNKRMPVNQIERILEEKDRQLAGPTAAPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|322381099|ref|ZP_08055102.1| tRNA pseudouridine synthase A-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154675|gb|EFX46946.1| tRNA pseudouridine synthase A-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 252

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 84/253 (33%), Positives = 129/253 (50%), Gaps = 9/253 (3%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M      + Y+G+ Y G+Q Q +G+++Q  +E+AI ++TGE V +  +GRTD+GVHA  Q
Sbjct: 1   MRNLRFTLSYDGTSYSGFQTQPDGNTVQDQLEEAIHMLTGEKVKITSSGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +F           C ALN+ L     I +     V   FH+R SA R++Y Y I T +
Sbjct: 61  VVNFLTSSRIPVDRWCLALNSRL--PRDIVVYEAEEVSLTFHSRKSAKRKTYCYEIRTSR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH------ 174
            P    +      P  L+ E M+ A    +G HDFT+F +      + +RTI        
Sbjct: 119 FPDVFHRAFEVHYPTPLNIEAMKEALSCFIGTHDFTSFCTTRTTMENRVRTIYEARLEYL 178

Query: 175 -FDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPL 233
               +    LI+I +    FL+  +R  VG++  VG+GK  S+++   L A+DR++ GP 
Sbjct: 179 PDQDDPARGLIQIYLTGSGFLYNMVRIIVGTILQVGEGKEKSSEIPVILAAKDRRKAGPT 238

Query: 234 APPEGLYFDSVEY 246
           A  +GL    VEY
Sbjct: 239 AMAKGLTLWKVEY 251


>gi|163742263|ref|ZP_02149651.1| tRNA pseudouridine synthase A [Phaeobacter gallaeciensis 2.10]
 gi|161384593|gb|EDQ08974.1| tRNA pseudouridine synthase A [Phaeobacter gallaeciensis 2.10]
          Length = 257

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 115/250 (46%), Positives = 164/250 (65%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+G+ + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRFALKVEYHGAPFAGWQRQKDQPSVQGAIENALARLEPGPHTIAAAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+V++W P  L +ALN +LK    ++I++ + V+  +HARFSA+ R YL+RI+ R+
Sbjct: 61  VAHCDMVKDWDPFRLSEALNFHLK-PSPVAIVDCARVEDDWHARFSAVERQYLFRILIRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G+ W +   LD   M+ AA HL+G+HDFTTFRS  CQA+SP++T+D   +   
Sbjct: 120 APATHDAGQVWQLNHDLDAGAMQEAANHLIGQHDFTTFRSSICQAASPLKTLDELRIERV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                  I   V ARSFLH Q+RSFVG+L+ VG G W+  D++ AL+A+DR  CGP+ P 
Sbjct: 180 QGFSGPEIHFHVRARSFLHNQVRSFVGTLERVGAGAWSPEDVKSALEAEDRAACGPVCPG 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 HGLYLARVGY 249


>gi|89070283|ref|ZP_01157602.1| tRNA pseudouridine synthase A [Oceanicola granulosus HTCC2516]
 gi|89044122|gb|EAR50283.1| tRNA pseudouridine synthase A [Oceanicola granulosus HTCC2516]
          Length = 257

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 115/251 (45%), Positives = 156/251 (62%), Gaps = 6/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  Y GWQRQ   +++QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRYALKVEYDGGPYAGWQRQDGPATVQGAIEAALARLEPGPHTIAAAGRTDAGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA  DL + W P  L +ALN +LK    I+I+  + V   +HARFSA  R YL+R++ R+
Sbjct: 61  VAQADLAKAWEPFRLAEALNYHLK-PAPIAIVACARVADDWHARFSANERRYLFRLVARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH-----F 175
           APL  E+G+ W + + LD   M+  A  LVG HDFTTFRS  CQA SP++T+D       
Sbjct: 120 APLPFERGQVWKVNQPLDAAAMQAGADLLVGHHDFTTFRSSICQADSPVKTLDELTVETV 179

Query: 176 DVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                       V ARSFLH Q+RSFVG+L+ VG G W    + +AL A++RK CGP+AP
Sbjct: 180 TRPDGYPEYRFHVRARSFLHNQVRSFVGTLERVGAGAWPPERVGEALAARERKACGPVAP 239

Query: 236 PEGLYFDSVEY 246
           P+GLY  +V+Y
Sbjct: 240 PQGLYLAAVKY 250


>gi|110632752|ref|YP_672960.1| tRNA pseudouridine synthase A [Mesorhizobium sp. BNC1]
 gi|123162871|sp|Q11LD0|TRUA_MESSB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|110283736|gb|ABG61795.1| tRNA pseudouridine synthase A [Chelativorans sp. BNC1]
          Length = 247

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 137/247 (55%), Positives = 172/247 (69%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + IEY+G  Y GWQRQ    S+Q +IEKAI   +GE V + GAGRTD+GVHAL Q
Sbjct: 1   MHRFRIDIEYDGGPYAGWQRQAGQHSVQEAIEKAIAAFSGEEVTIRGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSI-VDKQFHARFSAIRRSYLYRIITR 119
           VAHFDL REW    +  ALNA+L ++     +  +  V + F ARFSA  R YLYRI  R
Sbjct: 61  VAHFDLSREWKSDKVRDALNAHLTLAGEAVSILRAEAVAEDFDARFSAKARHYLYRIANR 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           ++PLALE+GRAW + + LD   M  AAQ LVG+HDFTTFRS+ CQA SP++T+D  DV  
Sbjct: 121 RSPLALERGRAWHVARRLDAAAMHEAAQRLVGKHDFTTFRSVQCQAKSPVKTLDRLDVTR 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ IEI   ARSFLH Q+RS VG+LK VG+G WT+ D + ALQA+DR  CGP+APP+GL
Sbjct: 181 VGDEIEIHASARSFLHNQVRSLVGTLKKVGEGGWTADDAQAALQARDRAACGPVAPPQGL 240

Query: 240 YFDSVEY 246
           Y   V+Y
Sbjct: 241 YLVRVDY 247


>gi|253682551|ref|ZP_04863348.1| tRNA pseudouridine synthase A [Clostridium botulinum D str. 1873]
 gi|253562263|gb|EES91715.1| tRNA pseudouridine synthase A [Clostridium botulinum D str. 1873]
          Length = 246

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/248 (31%), Positives = 128/248 (51%), Gaps = 4/248 (1%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R   +IIEY+GS Y GWQ+QK+  ++Q  +E+AI  +T     + G  RTD+GVHA  
Sbjct: 1   MKRNVKLIIEYDGSNYSGWQKQKHSITVQQKVEEAISEITKTDTEIIGCSRTDAGVHARN 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
            VA+F       P     A+N+ L     I I   S V   FHARF +  + Y+Y I+ R
Sbjct: 61  FVANFITESSVPPSKFKYAINSKL--PKDIVIKKSSEVPLDFHARFHSKGKKYVYTILNR 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLV-GRHDFTTFRSIHCQASSPIRTIDHFDVN 178
           + P  +++   +   K LD   M++A+++ +      + ++       S +RTI + DV 
Sbjct: 119 EEPPTIDRNVMYHFNKDLDVNAMKMASKYFIGSHEFDSFYKKSGSSVKSTLRTIYYCDVT 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
              ++I+  V+   FL+  +R   G+L   G G+    D++  + A+DR++ G   PP+G
Sbjct: 179 KCEDVIKFTVIGEGFLYNMVRIMAGTLIEAGIGRIRPEDIKAIILAKDREKAGRSLPPQG 238

Query: 239 LYFDSVEY 246
           L    V Y
Sbjct: 239 LCLQEVLY 246


>gi|53722721|ref|YP_111706.1| tRNA pseudouridine synthase A [Burkholderia pseudomallei K96243]
 gi|124382508|ref|YP_001025653.1| tRNA pseudouridine synthase A [Burkholderia mallei NCTC 10229]
 gi|126446203|ref|YP_001077728.1| tRNA pseudouridine synthase A [Burkholderia mallei NCTC 10247]
 gi|217422201|ref|ZP_03453704.1| tRNA pseudouridine synthase A [Burkholderia pseudomallei 576]
 gi|238563050|ref|ZP_04610365.1| tRNA pseudouridine synthase A [Burkholderia mallei GB8 horse 4]
 gi|251766902|ref|ZP_04819864.1| tRNA pseudouridine synthase A [Burkholderia mallei PRL-20]
 gi|254176501|ref|ZP_04883159.1| tRNA pseudouridine synthase A [Burkholderia mallei ATCC 10399]
 gi|254184999|ref|ZP_04891588.1| tRNA pseudouridine synthase A [Burkholderia pseudomallei 1655]
 gi|254201168|ref|ZP_04907533.1| tRNA pseudouridine synthase A [Burkholderia mallei FMH]
 gi|254205140|ref|ZP_04911493.1| tRNA pseudouridine synthase A [Burkholderia mallei JHU]
 gi|62901261|sp|Q63JL6|TRUA_BURPS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166228683|sp|A3MBU2|TRUA_BURM7 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166228684|sp|A2S134|TRUA_BURM9 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|52213135|emb|CAH39174.1| tRNA pseudouridine synthase A [Burkholderia pseudomallei K96243]
 gi|126239057|gb|ABO02169.1| tRNA pseudouridine synthase A [Burkholderia mallei NCTC 10247]
 gi|147748780|gb|EDK55855.1| tRNA pseudouridine synthase A [Burkholderia mallei FMH]
 gi|147754726|gb|EDK61790.1| tRNA pseudouridine synthase A [Burkholderia mallei JHU]
 gi|160697543|gb|EDP87513.1| tRNA pseudouridine synthase A [Burkholderia mallei ATCC 10399]
 gi|184215591|gb|EDU12572.1| tRNA pseudouridine synthase A [Burkholderia pseudomallei 1655]
 gi|217394432|gb|EEC34451.1| tRNA pseudouridine synthase A [Burkholderia pseudomallei 576]
 gi|238521484|gb|EEP84935.1| tRNA pseudouridine synthase A [Burkholderia mallei GB8 horse 4]
 gi|243064541|gb|EES46727.1| tRNA pseudouridine synthase A [Burkholderia mallei PRL-20]
 gi|261826841|gb|ABM98766.2| tRNA pseudouridine synthase A [Burkholderia mallei NCTC 10229]
          Length = 271

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R  + I+Y+G+ + GWQ Q +G ++Q ++E+++       +    AGRTD+GVH L Q
Sbjct: 1   MMRIALGIQYDGAAFCGWQSQPHGKTVQDALERSLAEFAQTSLHTTVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +       +  NA+L    T+++     +   FHARF+A  R+Y Y +    
Sbjct: 61  VVHFDTDLDRADFSWVRGTNAFL--PPTVAVQWAKPMPDTFHARFAAFERTYYYALYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +  GRA  +   LD + MR AA HLVG HDF+ FRS  CQA SP++ +    +   
Sbjct: 119 VRSPMLAGRAGWVHTPLDVDAMREAAAHLVGEHDFSAFRSSECQAKSPVKHLYQIGIRPD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I  R  A +FLH  +R+ +G L  VG G++ S+ L + L+++DR    P   PEGLY
Sbjct: 179 GDFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPSSWLAEVLESRDRDCAAPTFMPEGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAHVGY 244


>gi|254441675|ref|ZP_05055168.1| tRNA pseudouridine synthase A [Octadecabacter antarcticus 307]
 gi|198251753|gb|EDY76068.1| tRNA pseudouridine synthase A [Octadecabacter antarcticus 307]
          Length = 256

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 118/251 (47%), Positives = 157/251 (62%), Gaps = 6/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQRQ +  S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MPRYALKIEYDGAPFCGWQRQTSDPSVQGAIEAALAKLEPRGHTIGAAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ + W    L +ALN +LK +    +  + + D  +HARFSA+ R YL+R++ R+
Sbjct: 61  VAHCDMDKTWDAFRLSEALNFHLKPAPVSIVACVQVAD-DWHARFSALERRYLFRLVNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APL LE G+ W + + LD   M+  A  L+G HDFTTFRS  CQA SP+RT+D  D+   
Sbjct: 120 APLVLEAGKVWQVSQKLDGAAMQAGADRLLGHHDFTTFRSTVCQADSPMRTLDGLDIEQV 179

Query: 181 -----GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
                       V ARSFLH Q+RSFVG+L+ VG G WT  D+  AL A+DR  CGP+ P
Sbjct: 180 ARSDGAQEFRFHVRARSFLHNQVRSFVGTLERVGAGAWTRDDVSAALNARDRTACGPVCP 239

Query: 236 PEGLYFDSVEY 246
           P GLY  SV Y
Sbjct: 240 PHGLYLASVGY 250


>gi|73667044|ref|YP_303060.1| tRNA pseudouridine synthase A [Ehrlichia canis str. Jake]
 gi|123773369|sp|Q3YS43|TRUA_EHRCJ RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|72394185|gb|AAZ68462.1| tRNA pseudouridine synthase [Ehrlichia canis str. Jake]
          Length = 245

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 114/246 (46%), Positives = 159/246 (64%), Gaps = 2/246 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNG-SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           +RY + IEYNGS + GWQRQK+  +SIQ  +E+AIF  + E V  + AGRTD+GVHAL Q
Sbjct: 1   MRYKITIEYNGSNFIGWQRQKHLSNSIQEILEEAIFKFSRESVTTYVAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL  ++   ++  A+N +L I  +IS+LN+   D +FHARFSA +R YLY+II R 
Sbjct: 61  VAHFDLTADFDAYVVRNAINYHL-IPHSISVLNVEKTDDEFHARFSAKKRHYLYKIINRY 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +PL ++  RAWL+   LD E M  A +++ G HDF++FR+ HCQ+ SP++T+D   +   
Sbjct: 120 SPLTIDYNRAWLVRNPLDVEKMMRAVEYIKGNHDFSSFRARHCQSKSPVKTMDDLKIIHS 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I+I   A SFLH Q+R  VG+L   G   +     +  L+A+DR   G  APP GLY
Sbjct: 180 DQCIDIYFSAISFLHNQVRIIVGTLVECGKNSFPPEYTKDILEAKDRSYAGMTAPPYGLY 239

Query: 241 FDSVEY 246
           F  V+Y
Sbjct: 240 FVKVDY 245


>gi|254463862|ref|ZP_05077273.1| tRNA pseudouridine synthase A [Rhodobacterales bacterium Y4I]
 gi|206684770|gb|EDZ45252.1| tRNA pseudouridine synthase A [Rhodobacterales bacterium Y4I]
          Length = 255

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 117/250 (46%), Positives = 161/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+G  + GWQRQK+  S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MPRFALKVEYHGKPFAGWQRQKDLPSVQGAIEAALARLEPGEHTIAAAGRTDTGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ ++W P  L +ALN +LK  D ++I+  + VD  +HARFSA+ R YL+RI+ R+
Sbjct: 61  VAHCDMAKDWDPFRLSEALNYHLK-PDPVAIVGCARVDDDWHARFSAVERQYLFRILIRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G+ W +   LD + M+ AA +L+G HDFTTFRS  CQA SP++T+D   V   
Sbjct: 120 APATHDAGQVWQLSHELDADAMQEAANYLIGNHDFTTFRSSICQAQSPVKTLDELTVERV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                  I   V ARSFLH Q+RSFVG+L+ VG G W   D++ AL+A+DR  CGP+ P 
Sbjct: 180 QGFSGPEIHFHVRARSFLHNQVRSFVGTLERVGAGAWDPADVKAALEARDRAACGPVCPG 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 HGLYLARVGY 249


>gi|119897336|ref|YP_932549.1| tRNA pseudouridine synthase A [Azoarcus sp. BH72]
 gi|119669749|emb|CAL93662.1| pseudouridine synthase A [Azoarcus sp. BH72]
          Length = 265

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 127/246 (51%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R  + +EY G  + GWQ Q++G ++Q ++E A+  + GE V +H AGRTD+GVHA  Q
Sbjct: 1   MVRLALGVEYAGDRFEGWQSQRHGRTVQDALEAALSRIAGEAVKLHCAGRTDTGVHATAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD           + +N +L     +++     VD  FHARF A  R Y Y +    
Sbjct: 61  VAHFDTAAVRPLSAWIRGVNTHL--PAGVAVRWAVEVDDAFHARFLAYERRYRYVLFNAP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              AL  GR       LD   M  AA+ LVG  DF+ FR+  CQA +P+R +    V   
Sbjct: 119 TRPALLAGRVGWFHLPLDEGAMAEAARCLVGMQDFSAFRAAECQAKTPVRDMREVRVQRS 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ +     A  FLH  IR+ VG+L  VG G++    L + L  +DR    P   P+GLY
Sbjct: 179 GDYLIFDFRADGFLHHMIRNLVGALVYVGKGRYPPGWLAEVLAGRDRSRAAPTFAPDGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LCGVSY 244


>gi|260171626|ref|ZP_05758038.1| tRNA pseudouridine synthase A [Bacteroides sp. D2]
          Length = 267

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 118/247 (47%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  + KA+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMKALSTFLRREIEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD         +   LN  L     ISI  +  V    H RF A  R+Y Y + T  
Sbjct: 61  VAHFDSDELLDTTSVTDKLNRLL--PPDISIYRVCRVRPDAHVRFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +     +   W +   L+ E M  AA  L   +DFT+F  +H    + I  I H +    
Sbjct: 117 SKYPFNRQYRWRLYNQLNYERMNEAAHILFEYNDFTSFSKLHTDVKTNICHITHAEWTQE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK T     + ++ QDR + G  AP + L
Sbjct: 177 EDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLTVEGFRRIIEQQDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|254517504|ref|ZP_05129560.1| tRNA-pseudouridine synthase I [Clostridium sp. 7_2_43FAA]
 gi|226911253|gb|EEH96454.1| tRNA-pseudouridine synthase I [Clostridium sp. 7_2_43FAA]
          Length = 244

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 138/246 (56%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + +EY+G+ Y GWQ+QK G++IQ ++E+AI L+T E   V G+ RTD+GVHA   
Sbjct: 1   MRNIKLTLEYDGTNYLGWQKQKIGATIQETLEEAIRLLTNEESEVIGSSRTDAGVHARGF 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F            +A+N  L   + I IL    V++ FH+R+SA  ++Y Y I+ R 
Sbjct: 61  VANFKTNSTIPSEKFREAINYRL--PNDIVILKSEEVEEDFHSRYSAKGKTYSYSILNRD 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+ K   + + + LD E+M+ A ++ +G  DF  F+S      + +RTI    ++  
Sbjct: 119 VNSAIGKDYVYHVKRKLDVEDMKEACKYFIGTKDFMAFKSSGSSVKTTVRTISDLYIDIK 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            ++I+I V    FL+  +R  VG+L +VG  K  S +++  ++++DRK+ G   P  GL 
Sbjct: 179 DDIIKIYVTGDGFLYNMVRIIVGTLIMVGSNKIDSREVKNIIESKDRKKAGICVPAAGLV 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVYY 244


>gi|160887061|ref|ZP_02068064.1| hypothetical protein BACOVA_05075 [Bacteroides ovatus ATCC 8483]
 gi|156107472|gb|EDO09217.1| hypothetical protein BACOVA_05075 [Bacteroides ovatus ATCC 8483]
          Length = 267

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 84/247 (34%), Positives = 120/247 (48%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  + KA+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMKALSTFLRREIEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD         +   LN  L     IS+  +  V    HARF A  R+Y Y + T  
Sbjct: 61  VAHFDSDELLDTTSVTDKLNRLL--PPDISVYRVCRVRPDTHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +     +   W +   L+ E M  AA+ L   +DFT+F  +H    + I  I H +    
Sbjct: 117 SKYPFNRQYRWRLYNQLNYERMNEAARILFEYNDFTSFSKLHTDVKTNICHITHAEWTQE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK T     + ++ QDR + G  AP + L
Sbjct: 177 EDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLTVEGFRRIIEQQDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|147676690|ref|YP_001210905.1| tRNA pseudouridine synthase A [Pelotomaculum thermopropionicum SI]
 gi|146272787|dbj|BAF58536.1| pseudouridylate synthase [Pelotomaculum thermopropionicum SI]
          Length = 273

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 86/250 (34%), Positives = 134/250 (53%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNG--SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
           M    + I Y+G+ Y+G+Q Q+     ++Q  IE+ +  + GE + V GAGRTD+GVHA 
Sbjct: 26  MRNIKVTIAYDGTNYYGFQEQRGTKFRTVQEVIEERLSRLAGEQIRVIGAGRTDAGVHAR 85

Query: 59  RQVAHFDL-VREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
            QV +F+       P  +  ALN+ L     I+ L    V   FHARFSA+ ++Y Y I 
Sbjct: 86  GQVINFNPGNWPIPPERVAYALNSLL--PRDIAALESVEVPPSFHARFSAVAKTYRYTIY 143

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDV 177
             +      +  ++ +P+ LD E M+  A  L+GRHDF+ FR++     S +RT+    V
Sbjct: 144 NARVHSPFLRLYSYHVPRRLDVEAMQAGAALLIGRHDFSAFRALGTPVKSTVRTMLEACV 203

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +  G+L+ I + A  FL+   R   G+L  VG GK    ++   L+++D    GP AP  
Sbjct: 204 SREGDLVYIDLKADGFLYHMARMIAGTLIRVGLGKIPPGEVAAILKSRDSLRGGPTAPAR 263

Query: 238 GLYFDSVEYS 247
           GL  + +EY+
Sbjct: 264 GLCLEKIEYT 273


>gi|113461401|ref|YP_719470.1| tRNA pseudouridine synthase A [Haemophilus somnus 129PT]
 gi|122945393|sp|Q0I4X5|TRUA_HAES1 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|112823444|gb|ABI25533.1| pseudouridylate synthetase [Haemophilus somnus 129PT]
          Length = 269

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG+ YFGWQRQ N +S+Q  +E A+  V  E   ++ AGRTDSGVHA  QV
Sbjct: 1   MKIALGIEYNGTHYFGWQRQANVTSVQEKLESAVSFVANEFCQIYCAGRTDSGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             LNA L     I++    +V + FHARFSA  R Y Y I     
Sbjct: 61  VHFDTKAIRSEKAWTFGLNANL--PADIAVRWAKVVSEDFHARFSATARRYRYLIYNHPL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             AL          +LD   M  A Q+L+G HDF++FR+  CQ+++P R I H  V    
Sbjct: 119 RSALFPTGVTHHHVALDHRLMHQAGQYLLGEHDFSSFRAAQCQSNTPWRNIHHLHVFRQA 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  +G GK     ++  L  +DR    P A P+GLY 
Sbjct: 179 NYIIVDIQANAFVHHMVRNIVGSLLEIGSGKQPVEWMDWLLTQKDRTLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVKY 243


>gi|254514517|ref|ZP_05126578.1| tRNA pseudouridine synthase A [gamma proteobacterium NOR5-3]
 gi|219676760|gb|EED33125.1| tRNA pseudouridine synthase A [gamma proteobacterium NOR5-3]
          Length = 272

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 91/248 (36%), Positives = 130/248 (52%), Gaps = 5/248 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQK---NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHAL 58
            R  + IEY+GS Y GWQ Q       ++Q  +E A+  +    V V  AGRTD+GVHA 
Sbjct: 6   QRVALKIEYDGSAYSGWQSQPQLPKVRTVQTEVEVALSKIANSPVRVFCAGRTDTGVHAA 65

Query: 59  RQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
            Q  HFD   +          NA L     + + +   V + FHAR SA+ R Y Y I  
Sbjct: 66  AQWLHFDAPCDRSLKAWIVGANAQL--PLDVRLTDGLSVAEDFHARHSAVARQYDYLIAN 123

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            + P AL   R   + + LD   MR + Q L+G  DF+ FR+  CQ+++P+R ++   V 
Sbjct: 124 TRTPSALLANRMVWVRQPLDANLMRCSLQALLGEQDFSAFRAASCQSTTPMRFMESTQVF 183

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G++I+IRVVA +FLH  +R+ VGS   VG  +  +  L + L  +DR +    APP+G
Sbjct: 184 RRGDIIQIRVVANAFLHHMVRNIVGSCLQVGLCEQPAGWLGELLAGRDRTQAAATAPPQG 243

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 244 LYLTGVRY 251


>gi|299148560|ref|ZP_07041622.1| tRNA pseudouridine synthase A [Bacteroides sp. 3_1_23]
 gi|298513321|gb|EFI37208.1| tRNA pseudouridine synthase A [Bacteroides sp. 3_1_23]
          Length = 267

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 120/247 (48%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  + KA+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMKALSTFLRREIEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD         +   LN  L     ISI  +  V    HARF A  R+Y Y + T  
Sbjct: 61  VAHFDSDELLDTTSVTDKLNRLL--PPDISIYRVCRVRPDTHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +     +   W +   L+ E M  AA+ L   +DFT+F  +H    + I  I H +    
Sbjct: 117 SKYPFNRQYRWRLYNQLNYERMNEAARILFEYNDFTSFSKLHTDVKTNICHITHAEWTQE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK T     + ++ QDR + G  AP + L
Sbjct: 177 EDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLTVEGFRRIIEQQDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|148245016|ref|YP_001219710.1| tRNA pseudouridine synthase A [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326843|dbj|BAF61986.1| tRNA pseudouridine synthase A [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 247

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 133/246 (54%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           ++  + +EY G+ + GWQ QK N  ++Q  IE+A+  V  + V V  +GRTD+GVHA  Q
Sbjct: 1   MKLALGVEYLGTHFHGWQCQKSNIRTVQQVIEQALSSVANQPVRVFCSGRTDTGVHATCQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HF+   +          N +L     ++   +  VD  FHARFS I R Y Y+I   +
Sbjct: 61  VIHFETNIKRKNKAWLFGGNVHL--PSDVNFTWVKPVDDNFHARFSVITRQYNYKIHNTK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              ++    +   P+ LD   M  A Q+L G+H+F+ FR   CQA SPI+ I+   +   
Sbjct: 119 IRSSIIATHSLWEPRKLDIVAMNKAGQYLTGKHNFSAFRGSLCQAKSPIKNIEFIKLTKH 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I + + A +FLH  +R+ VG+L  VG G+     + + L ++ RK+ GP APP+GLY
Sbjct: 179 DDNILLDIKANAFLHHMVRNIVGTLLKVGKGEKPIEWVREVLNSKQRKQAGPTAPPQGLY 238

Query: 241 FDSVEY 246
           F    Y
Sbjct: 239 FIRAFY 244


>gi|218895277|ref|YP_002443688.1| tRNA pseudouridine synthase A [Bacillus cereus G9842]
 gi|218542262|gb|ACK94656.1| tRNA pseudouridine synthase A [Bacillus cereus G9842]
          Length = 252

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    I Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTIAYDGMHFCGYQIQPKHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWNNALNTML--PDDIVIRRVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|126174949|ref|YP_001051098.1| tRNA pseudouridine synthase A [Shewanella baltica OS155]
 gi|166229833|sp|A3D666|TRUA_SHEB5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|125998154|gb|ABN62229.1| tRNA pseudouridine synthase A [Shewanella baltica OS155]
          Length = 261

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+GYFGWQRQ    S+Q  +E+A+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGNGYFGWQRQAEVDSVQAQLERALSIVANEPIGVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETQAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M  AAQ L+G  DFT+FR++ CQ+ +P R +   +V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADRMHQAAQALLGEQDFTSFRAVQCQSKTPFRNVHCVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|255693609|ref|ZP_05417284.1| tRNA pseudouridine synthase A [Bacteroides finegoldii DSM 17565]
 gi|260620585|gb|EEX43456.1| tRNA pseudouridine synthase A [Bacteroides finegoldii DSM 17565]
          Length = 254

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 118/247 (47%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  +  A+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMNALSTFLRREIEVVGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD         +   LN  L     IS+  +  V  + HARF A  R+Y Y + T  
Sbjct: 61  VAHFDYDEPLDTESVADKLNRLL--PPDISVYRVCRVRPEAHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A     +     +   LD E M  AA+ L    DFT+F  +H    + I  I H +    
Sbjct: 117 AKYPFNRQYRCRVYSPLDYERMNEAAKVLFEYTDFTSFSKLHTDVKTNICHITHAEWTRE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK +     + ++ +DR + G  AP + L
Sbjct: 177 EDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLSIEGFRRIIEQKDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|311029085|ref|ZP_07707175.1| Pseudouridylate synthase I [Bacillus sp. m3-13]
          Length = 248

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 131/247 (53%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R   I+ Y+G+G+ G+Q QK   ++Q  +++A+  +  G  V V  +GRTD+GVHA+ 
Sbjct: 1   MNRLKCILTYDGAGFEGYQIQKEKRTVQLEVQRALSRIHKGTEVKVSASGRTDAGVHAVG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALNA+L     I +  +  V   FHARF  +++ Y Y++   
Sbjct: 61  QVLHFDSPLSIPVAAWQNALNAHL--PKDIWVKKVESVSGDFHARFDVVKKEYRYKVSLA 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +     ++ + +  P  LD E ++ A  HL+G HDFT+F S   +    +RTI   +V  
Sbjct: 119 KDFNVFDRDQVYHYPYPLDLEAVKEACGHLIGEHDFTSFCSAKTEVEDKVRTIYSLEVVR 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  +E R++   FL+  +R  VG+L  +G GK    D+   L+A+DR   G  AP  GL
Sbjct: 179 NGEELEFRIIGNGFLYNMVRIIVGTLLEIGQGKKLPRDIFSILEARDRGAAGKTAPAHGL 238

Query: 240 YFDSVEY 246
           Y  +V Y
Sbjct: 239 YLWNVVY 245


>gi|256822702|ref|YP_003146665.1| tRNA pseudouridine synthase A [Kangiella koreensis DSM 16069]
 gi|256796241|gb|ACV26897.1| tRNA pseudouridine synthase A [Kangiella koreensis DSM 16069]
          Length = 264

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 118/246 (47%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  + IEY+G  Y GWQRQ + SS+Q ++EK +  +  E + V  AGRTD+GVHA  Q
Sbjct: 1   MTKVALCIEYDGHRYHGWQRQSHASSVQQTLEKVLSTIADEPIEVSCAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + HF+L  E          N  L   D I++     V   FHARFSA  R Y Y I    
Sbjct: 61  IIHFELSNERPLKAWTMGANTQL--PDDIAVRWAHSVSDDFHARFSAKARRYRYIIANTP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+ +         LD + M  A  +  G  DF  F++  CQ+ +  R I H  V   
Sbjct: 119 TRPAISRSGLTWCRAPLDIDVMNQACAYFPGEQDFAAFQAASCQSKTSFRNIHHLFVERL 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + I + A +FLH  +R+  GSL  +G         ++ L  +DR +    A P GLY
Sbjct: 179 GEYVVIDIKANAFLHHMVRNIAGSLIEIGRYNQKPEWAKQLLDGKDRTQAASTASPNGLY 238

Query: 241 FDSVEY 246
              VEY
Sbjct: 239 LVDVEY 244


>gi|322831951|ref|YP_004211978.1| tRNA pseudouridine synthase A [Rahnella sp. Y9602]
 gi|321167152|gb|ADW72851.1| tRNA pseudouridine synthase A [Rahnella sp. Y9602]
          Length = 276

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 91/244 (37%), Positives = 133/244 (54%), Gaps = 2/244 (0%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           R  + IEY+GS YFGWQRQ+  +S+Q  +EKA+  V    +VV  AGRTD+GV A  QV 
Sbjct: 17  RVALGIEYDGSAYFGWQRQQGVASVQECLEKALSRVANAPIVVFCAGRTDAGVSATGQVV 76

Query: 63  HFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAP 122
           HFD             +N +L     I++   + V + FHARFSA  R Y Y I   +  
Sbjct: 77  HFDTPVLRKDAAWTMGVNTHL--PKDIAVRWCANVGEDFHARFSATARRYRYVIYNNRYR 134

Query: 123 LALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGN 182
            A+       +   LD E M++A Q L+G +DFT+FR+  CQ+ +P R + H +V+  G+
Sbjct: 135 SAILHAGVTHVHMPLDVEKMQLAGQALLGENDFTSFRASQCQSRTPWRYVMHVNVSRHGS 194

Query: 183 LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFD 242
            + + + A +F+H  +R+ VGSL  +G G      + + L A+DR        PEGLY  
Sbjct: 195 YVVVDIKANAFVHHMVRNIVGSLVEIGAGNQPVGWMGELLAAKDRNLAAATGKPEGLYLV 254

Query: 243 SVEY 246
            V+Y
Sbjct: 255 CVDY 258


>gi|298530329|ref|ZP_07017731.1| tRNA pseudouridine synthase A [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509703|gb|EFI33607.1| tRNA pseudouridine synthase A [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 247

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 131/247 (53%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + + Y+G+GY GWQ QK+G +IQG +EKA+  +    + VHG+GRTD+GVHAL QV
Sbjct: 3   MRVRLTLAYDGTGYNGWQIQKDGLTIQGELEKALSRICSASIRVHGSGRTDAGVHALGQV 62

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD   +++ V   +ALNA L     I +L+ +  D++FHARFSA  + Y Y + T+ A
Sbjct: 63  AHFDPPPKFLNVPWNRALNAVL--PPGIRVLDFARTDRKFHARFSARAKQYSYTLWTQGA 120

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHF--DVNS 179
               ++         LD E M+ A   L G HDF  F +   + +  IRT+ +       
Sbjct: 121 FFYPQRRNFVWNTGPLDLEAMQEATTCLTGSHDFNCFMNKGTEITDTIRTVRNILLAPGF 180

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
                 + + A  FL    R+ V +L  VG  K +  +L+  +Q +DR      AP  GL
Sbjct: 181 TPQETVVWIQADGFLKQMARNIVSALVQVGRKKLSQAELKSIIQGRDRALAPATAPARGL 240

Query: 240 YFDSVEY 246
             + V Y
Sbjct: 241 CLEHVTY 247


>gi|29349645|ref|NP_813148.1| tRNA pseudouridine synthase A [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253569984|ref|ZP_04847393.1| tRNA pseudouridine synthase A [Bacteroides sp. 1_1_6]
 gi|42559809|sp|Q89ZY4|TRUA_BACTN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|29341555|gb|AAO79342.1| tRNA pseudouridine synthase A [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251840365|gb|EES68447.1| tRNA pseudouridine synthase A [Bacteroides sp. 1_1_6]
          Length = 269

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/249 (36%), Positives = 120/249 (48%), Gaps = 7/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NGSS+Q  + KA+       V V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGSSVQECLMKALSTFLRRDVEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD       V +   LN  L     IS+  +  V    HARF A  R+Y Y + T  
Sbjct: 61  VAHFDHEDVLDTVTVADKLNRLL--PPDISVYRVRQVKPDAHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A     +   + +  SLD E M  AA+ L    DFT+F  +H    + I  I H +    
Sbjct: 117 AKYPFNRQYRYRVYGSLDYERMNEAARTLFEYIDFTSFSKLHTDVKTNICHISHAEWTKM 176

Query: 181 ---GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                     + A  FL   +R+ VG+L  VG GK T     K ++ QDR + G  AP  
Sbjct: 177 EGEDTTWVFTIRADRFLRNMVRAIVGTLLEVGRGKLTVEGFRKVIEQQDRCKAGTSAPGN 236

Query: 238 GLYFDSVEY 246
            L+  +VEY
Sbjct: 237 ALFLVNVEY 245


>gi|228937445|ref|ZP_04100091.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228970331|ref|ZP_04130990.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976901|ref|ZP_04137313.1| tRNA pseudouridine synthase A [Bacillus thuringiensis Bt407]
 gi|228782871|gb|EEM31037.1| tRNA pseudouridine synthase A [Bacillus thuringiensis Bt407]
 gi|228789440|gb|EEM37360.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228822278|gb|EEM68260.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326937937|gb|AEA13833.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 252

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPKHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVERKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+ + +R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEIKKIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|257092844|ref|YP_003166485.1| tRNA pseudouridine synthase A [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257045368|gb|ACV34556.1| tRNA pseudouridine synthase A [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 266

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+GSG+ GWQ Q  G ++Q +++ A+    G  V V  AGRTD+GVHA  QV
Sbjct: 1   MRIALAVEYDGSGFRGWQTQPGGGTVQDAVQDALRQFAGVPVQVVSAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E       +  N++L     +++     V   FHARFSA  R Y Y +I R  
Sbjct: 61  VHFDAAVERSMFAWVRGTNSFL--PSAVAVRWARPVADDFHARFSAYARRYRYLLINRAH 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +  GR       LD   M+ AA  L+G  DF+ FR+  CQA+SP++ +    V  FG
Sbjct: 119 RTGVWNGRVGWYHHPLDVGTMQAAAHLLLGERDFSAFRAAECQANSPVKVMREAHVRRFG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           +LI     A +FLH  +R+ VGSL  VG GK     + + L A DR+   P     GLY 
Sbjct: 179 DLIAFDFEASAFLHHMVRNLVGSLVHVGQGKRPPEWIGELLAAGDRRLAAPTFAAAGLYL 238

Query: 242 DSVEY 246
            +V Y
Sbjct: 239 FAVRY 243


>gi|149912589|ref|ZP_01901123.1| tRNA pseudouridine synthase A [Roseobacter sp. AzwK-3b]
 gi|149916040|ref|ZP_01904563.1| tRNA pseudouridine synthase A [Roseobacter sp. AzwK-3b]
 gi|149810114|gb|EDM69962.1| tRNA pseudouridine synthase A [Roseobacter sp. AzwK-3b]
 gi|149812995|gb|EDM72821.1| tRNA pseudouridine synthase A [Roseobacter sp. AzwK-3b]
          Length = 255

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 115/250 (46%), Positives = 160/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G+ + GWQRQ    S+QG+IE A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRYALKVEYDGAPFAGWQRQAEQPSVQGAIEAALARLEPGPHKIAAAGRTDAGVHGLAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DLV++W P  L  A+N +LK +    +    + +  +HARFSA+ R YL+R++ R+
Sbjct: 61  VAHCDLVKDWEPFKLMGAVNYHLKPAPVAVVACAQVAE-DWHARFSALERRYLFRLLMRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  LE GR W +P+SLD   MR  A+HL+G+HDFTTFRS  CQA SP++T+D  ++   
Sbjct: 120 PPETLEAGRVWRVPQSLDVAAMREGARHLLGKHDFTTFRSSICQAKSPVKTLDALEIEEA 179

Query: 181 GNLI----EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
             L        + ARSFLH Q+RS VG+L+ VG G W   D++ AL+A+DR  CGP+ PP
Sbjct: 180 EGLGGPELRFHLSARSFLHNQVRSIVGTLERVGAGSWAPEDVKTALEAKDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLAGVGY 249


>gi|157804248|ref|YP_001492797.1| tRNA pseudouridine synthase A [Rickettsia canadensis str. McKiel]
 gi|166228759|sp|A8F079|TRUA_RICCK RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157785511|gb|ABV74012.1| tRNA pseudouridine synthase A [Rickettsia canadensis str. McKiel]
          Length = 245

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 104/246 (42%), Positives = 150/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY G+   GWQRQ    S+Q  +E+AI+  +GE VV+ G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKITIEYLGTDLAGWQRQAGIMSVQQILEEAIYKFSGEQVVLFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL +      +  A+N +     ++ + N  +    FHARFSA+ R Y+YRI+ R 
Sbjct: 61  VAHFDLSKNLETHKIITAINYF-ARPYSVIVWNCEMAPNNFHARFSAVSRHYIYRILNRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               + + R W I   LD   M+ AA +L+G+HDFT+FR+  CQ+ SPI+T+   ++   
Sbjct: 120 YSSVINRDRVWWISSPLDVLAMQKAATYLLGKHDFTSFRASSCQSKSPIKTLTELNIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++ + A SFLH  +R+ VGSL LVG   W +  +++ L+ +DRK  GP AP  GLY
Sbjct: 180 DEEIKLYLSAPSFLHHMVRNIVGSLVLVGKNVWQAEYIKELLEVKDRKAAGPTAPASGLY 239

Query: 241 FDSVEY 246
           F   EY
Sbjct: 240 FVRTEY 245


>gi|77919497|ref|YP_357312.1| tRNA pseudouridine synthase A [Pelobacter carbinolicus DSM 2380]
 gi|123756611|sp|Q3A3B5|TRUA_PELCD RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|77545580|gb|ABA89142.1| tRNA pseudouridine synthase A [Pelobacter carbinolicus DSM 2380]
          Length = 252

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 126/247 (51%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIEY+G+ Y GWQRQ NG S+Q  +E+A+  V G    +  +GRTD+GVHA   
Sbjct: 1   MSVVRLIIEYDGTPYVGWQRQPNGLSVQQVVEEALAKVCGGPHSLVSSGRTDAGVHARGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHF   +        + +N +L     I++ + +++   FHAR+SA+ + Y Y I    
Sbjct: 61  VAHFVTPQPLPMAAYREGVNRFL--PAQIAVRDAALMPDDFHARYSAVGKWYRYSIYRSP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L    +W +   LD + MR AA+ LVGRHDF  FR+  C A + +R +   D+   
Sbjct: 119 VRSPLACRFSWHVRTVLDLQAMRQAARLLVGRHDFAAFRASGCAARTTVREVFSVDIVDA 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              + + V    FL   +R  VG+L  VG G     ++   L    RK+ G  AP +GL 
Sbjct: 179 EEWVYVDVRGSGFLRNMVRIMVGTLVEVGRGARPPEEVGAMLAGGCRKQSGITAPAQGLC 238

Query: 241 FDSVEYS 247
              V Y+
Sbjct: 239 LMEVAYA 245


>gi|116051110|ref|YP_790059.1| tRNA pseudouridine synthase A [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115586331|gb|ABJ12346.1| tRNA-pseudouridine synthase I [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 285

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 129/245 (52%), Gaps = 3/245 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           R  + IEY GS Y GWQRQ+    S+Q ++E+A+  V  E V V  AGRTD+ VHA  QV
Sbjct: 19  RIALGIEYKGSRYRGWQRQEAGVPSVQEALERALSKVAAEPVGVICAGRTDAAVHASGQV 78

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   E          NA L     IS+    ++   FHARFSA+ R Y Y I     
Sbjct: 79  VHFDTAVERPLKAWVMGTNANL--PADISVTWARVMPAHFHARFSAMARRYRYAIYNDPI 136

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A          + LD   MR AAQ LVG HDFT+FR++ CQA SP++T+ H  +   G
Sbjct: 137 RPAHLAEEVTWNHRPLDIGRMREAAQVLVGTHDFTSFRAVQCQAKSPVKTMHHVRLLEHG 196

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
            LI + +   +FLH  +R+  G L  +G G+      ++ L+ +DR+  G  A P GLY 
Sbjct: 197 RLIVLDIRGNAFLHHMVRNIAGVLMTIGAGERPIEWAKEVLETRDRRAGGVTAHPYGLYL 256

Query: 242 DSVEY 246
             VEY
Sbjct: 257 VRVEY 261


>gi|254883215|ref|ZP_05255925.1| tRNA pseudouridine synthase A [Bacteroides sp. 4_3_47FAA]
 gi|254836008|gb|EET16317.1| tRNA pseudouridine synthase A [Bacteroides sp. 4_3_47FAA]
          Length = 263

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 121/246 (49%), Gaps = 5/246 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY + + Y+G+ Y GWQ Q NG S+Q ++ +A+     + + V GAGRTD+GVHA   +
Sbjct: 7   MRYFIYLAYDGTNYHGWQIQPNGDSVQETLMRALSTFLRQEIEVVGAGRTDAGVHARLMI 66

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD  RE   V + + LN  L     I++  +  V    HARF A  R+Y Y + TR  
Sbjct: 67  AHFDYDRELDCVQITEKLNRLL--PPDIAVYAVKRVKDDAHARFDATYRTYKYYVTTR-- 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
                +  AW +  SLD E M  AA+ L    DFT+F  +H    +    I H +     
Sbjct: 123 KDPFNRHYAWRLFNSLDFEKMNEAARVLFDYTDFTSFSKLHTDVKTNNCRIMHAEWTQVS 182

Query: 182 -NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
                  + A  FL   +R+ VG+L  VG GK T  +  K ++ +DR   G   P   L+
Sbjct: 183 GTEWVFTIKADRFLRNMVRAVVGTLVEVGRGKMTVDEFRKVIEDKDRCSAGSSVPGHALF 242

Query: 241 FDSVEY 246
              V Y
Sbjct: 243 LVDVGY 248


>gi|330813516|ref|YP_004357755.1| tRNA pseudouridine synthase A [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486611|gb|AEA81016.1| tRNA pseudouridine synthase A [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 245

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 113/246 (45%), Positives = 156/246 (63%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY  I+EY+G+ + GWQRQ NG S+Q ++EK++  +T E + +HG+GRTD+GVHA  Q
Sbjct: 1   MRRYKCIVEYDGTSFVGWQRQTNGYSVQEAVEKSLKSITQEKIRIHGSGRTDTGVHAKGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD         +  ALN YLK      + +  IVD  F AR SAI R+Y Y II R 
Sbjct: 61  VIHFDSNTNLDEYTITSALNHYLKKELISIL-STEIVDDNFDARRSAILRTYEYLIINRA 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLA++K +AW I K L+ + +  A +   G HDFTTFR+  C+ASSPIRTI++ +  + 
Sbjct: 120 APLAIDKNKAWHISKPLNEKLIFAAIKIFEGTHDFTTFRAASCEASSPIRTIEYTEAFAR 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I I   ++SFL  Q+RS +G+LKL+G+ KW+  DL+ AL ++DR  C  LAP  GLY
Sbjct: 180 NEEILITFQSKSFLQHQVRSMIGALKLIGEEKWSIRDLQSALDSKDRSRCAALAPACGLY 239

Query: 241 FDSVEY 246
              V +
Sbjct: 240 LLKVSF 245


>gi|258512640|ref|YP_003186074.1| tRNA pseudouridine synthase A [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479366|gb|ACV59685.1| tRNA pseudouridine synthase A [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 262

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 84/245 (34%), Positives = 127/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            R  +++ Y+GSG+ G+ RQ+   ++QG +E  +  + G  ++V G+GRTD GVHA  QV
Sbjct: 5   RRIRLVLGYDGSGFHGFARQEGLRTVQGVLEDELRRMLGVDILVEGSGRTDRGVHARAQV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFDL        +   L   L     +   +   VD+ FHARFS +R++Y Y +     
Sbjct: 65  VHFDLPYGPPADRMVHVLRRRL--PADLLPRDAGEVDEGFHARFSVVRKTYRYTLDLAPL 122

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P       +W  P+ LD   M+ AA+HL+G HDFT+F +   +    +R ID  +    G
Sbjct: 123 PSLYWYRFSWHHPEPLDLAAMQEAARHLLGEHDFTSFCAAEARQRDKVRRIDRVEFRQDG 182

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I      FL   +R  VG+L  VG G+     +   L+A+DR+  G  APP GL  
Sbjct: 183 SRLHIEFEGNGFLQYMVRILVGTLVKVGRGQERPDRIPLILEARDRRLAGETAPPHGLCL 242

Query: 242 DSVEY 246
            +VEY
Sbjct: 243 WNVEY 247


>gi|217972794|ref|YP_002357545.1| tRNA pseudouridine synthase A [Shewanella baltica OS223]
 gi|254764864|sp|B8EEB7|TRUA_SHEB2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|217497929|gb|ACK46122.1| tRNA pseudouridine synthase A [Shewanella baltica OS223]
          Length = 261

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+GYFGWQRQ    S+Q  +E+A+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGNGYFGWQRQAEVDSVQAQLERALSIVANEPIGVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETHAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M  AAQ L+G  DFT+FR++ CQ+ +P R +   +V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADRMHQAAQALLGEQDFTSFRAVQCQSKTPFRNVHCVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|294778889|ref|ZP_06744305.1| tRNA pseudouridine synthase A [Bacteroides vulgatus PC510]
 gi|294447198|gb|EFG15782.1| tRNA pseudouridine synthase A [Bacteroides vulgatus PC510]
          Length = 257

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 121/246 (49%), Gaps = 5/246 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY + + Y+G+ Y GWQ Q NG S+Q ++ +A+     + + V GAGRTD+GVHA   +
Sbjct: 1   MRYFIYLAYDGTNYHGWQIQPNGDSVQETLMRALSTFLRQEIEVVGAGRTDAGVHARLMI 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD  RE   V + + LN  L     I++  +  V    HARF A  R+Y Y + TR  
Sbjct: 61  AHFDYDRELDCVQITEKLNRLL--PPDIAVYAVKRVKDDAHARFDATYRTYKYYVTTR-- 116

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
                +  AW +  SLD E M  AA+ L    DFT+F  +H    +    I H +     
Sbjct: 117 KDPFNRHYAWRLFNSLDFEKMNEAARVLFDYTDFTSFSKLHTDVKTNNCRIMHAEWTQVS 176

Query: 182 -NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
                  + A  FL   +R+ VG+L  VG GK T  +  K ++ +DR   G   P   L+
Sbjct: 177 GTEWVFTIKADRFLRNMVRAVVGTLVEVGRGKMTVDEFRKVIEDKDRCSAGSSVPGHALF 236

Query: 241 FDSVEY 246
              V Y
Sbjct: 237 LVDVGY 242


>gi|184155960|ref|YP_001844300.1| tRNA pseudouridine synthase A [Lactobacillus fermentum IFO 3956]
 gi|238692990|sp|B2GDT8|TRUA_LACF3 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|183227304|dbj|BAG27820.1| pseudouridylate synthase A [Lactobacillus fermentum IFO 3956]
          Length = 258

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 130/251 (51%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGE---IVVVHGAGRTDSGVHA 57
           M RY +   Y+GS + G+Q Q    ++Q  +E+A+  +  +    ++V G+GRTD+GVHA
Sbjct: 1   MHRYKITFAYDGSNFAGFQIQPGERTVQQVLERAVNKIAKKPQPPLMVFGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFDL  +     L +ALN+ L     + +   + V   FHARF A  + Y YR++
Sbjct: 61  LGQVAHFDLPYQIPGPSLVRALNSSL--PLDVLVKEATEVAPDFHARFDAHHKRYRYRVV 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD- 176
             +     ++         +D E M+ AAQ  VG HDFT+F +   QA+S +R ID    
Sbjct: 119 GGEFTNPFKRNYTGHYKYPVDVERMQTAAQDFVGEHDFTSFVASGSQATSNVRRIDEVTV 178

Query: 177 -VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
             +   + +    V   FL+ Q+R  V  L  +G+G+    D+ + ++A++R      AP
Sbjct: 179 VRDEENDEVVFDFVGNGFLYNQVRIMVAFLLEIGNGRRPVDDVMRVMKAKNRDLARGTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY   V Y
Sbjct: 239 ASGLYLVEVTY 249


>gi|167577247|ref|ZP_02370121.1| tRNA pseudouridine synthase A [Burkholderia thailandensis TXDOH]
          Length = 270

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 87/245 (35%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q ++E+A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQSQPHGKTVQDALERALAEFAQTSLHTTVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L    T+++     +   FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTDLDRADFSWVRGTNAFL--PSTVAVQWAKPMPDTFHARFAAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +   RA  +   LD + MR AA+HLVG HDF+ FRS  CQA SP++ +    +   G
Sbjct: 119 RSPMLAARAGWVHTPLDVDAMREAAEHLVGEHDFSAFRSSECQAKSPVKHLYQIGIRPDG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ ++ L + L+++DR    P   PEGLY 
Sbjct: 179 DFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPASWLAEVLESRDRDCAAPTFMPEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|119945656|ref|YP_943336.1| tRNA pseudouridine synthase A [Psychromonas ingrahamii 37]
 gi|166228751|sp|A1SW72|TRUA_PSYIN RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|119864260|gb|ABM03737.1| tRNA pseudouridine synthase A [Psychromonas ingrahamii 37]
          Length = 261

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 133/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+ Y+GWQRQK   S+Q  +E+++  +    V VH AGRTDSGVH+  QV
Sbjct: 1   MRIALGIEYDGAAYYGWQRQKEVISVQQELEQSLSKIANHTVRVHCAGRTDSGVHSTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+       V     +NA L     I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETEAIRKDVAWTLGVNANL--PKDIAVRWVKQVDSSFHARFSATARHYRYIIYNGAF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M +A Q L+G  DFT+FR++HCQASSP++ I++ +++   
Sbjct: 119 RPGILGTGLSHYHMDLDVQKMHLAGQMLLGEQDFTSFRALHCQASSPVKCIEYLNISQRS 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I I + A +FLH  +R+  GSL  +G GK     L+  L  +DR +    A P GLY 
Sbjct: 179 QFIIIDIKANAFLHHMVRNIAGSLIEIGCGKQPVDWLKTLLAYKDRSKAAATAKPGGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|83943967|ref|ZP_00956424.1| tRNA pseudouridine synthase A [Sulfitobacter sp. EE-36]
 gi|83954540|ref|ZP_00963251.1| tRNA pseudouridine synthase A [Sulfitobacter sp. NAS-14.1]
 gi|83840824|gb|EAP79995.1| tRNA pseudouridine synthase A [Sulfitobacter sp. NAS-14.1]
 gi|83845214|gb|EAP83094.1| tRNA pseudouridine synthase A [Sulfitobacter sp. EE-36]
          Length = 262

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 114/250 (45%), Positives = 162/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQRQ + +S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MQRYALKIEYHGAPFVGWQRQIDLASVQGAIEDALAKIEPRAHNIAAAGRTDAGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ R+W P  L +A+N +LK      +  +++ D  FHARFSA+ R YL+R++ R+
Sbjct: 61  VAHCDMERDWTPFRLSEAINYHLKPLPIAIVDCVAVDD-DFHARFSALERRYLFRVLVRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P   + G  W + K LD + MR AA HL+G HDFTTFRS  CQA +P++T+D  D+   
Sbjct: 120 PPATHQAGLVWQVKKPLDIDRMREAATHLIGEHDFTTFRSTICQAQTPVKTLDRVDMTEH 179

Query: 181 G----NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                  ++  V ARSFLH Q+RS VG+L+ VG G +   D+++ L A+DR+ CGP+APP
Sbjct: 180 PVGGGVEVQFDVRARSFLHNQVRSIVGTLERVGAGSFAPDDVKQMLAARDRQACGPVAPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLSHVTY 249


>gi|304411873|ref|ZP_07393484.1| tRNA pseudouridine synthase A [Shewanella baltica OS183]
 gi|307303359|ref|ZP_07583114.1| tRNA pseudouridine synthase A [Shewanella baltica BA175]
 gi|304349733|gb|EFM14140.1| tRNA pseudouridine synthase A [Shewanella baltica OS183]
 gi|306913719|gb|EFN44141.1| tRNA pseudouridine synthase A [Shewanella baltica BA175]
          Length = 261

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G+GYFGWQRQ    S+Q  +E+A+ +V  E + V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGIEYDGNGYFGWQRQAEVDSVQAQLERALSIVANEPIGVFCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +NA L   D I++  +  VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETHAIRNEGAWTLGVNANL--PDNIAVRWVKEVDDSFHARFSATARRYRYVIYNHSF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         +D + M  AAQ L+G  DFT+FR++ CQ+ +P R I   +V   G
Sbjct: 119 RPGILRHGVSHYHGDIDADRMHQAAQALLGEQDFTSFRAVQCQSKTPFRNIHCVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G    T +   L  +DR +    A P GLY 
Sbjct: 179 MYVIVDIAANAFLHHMVRNIVGSLLEIGLGNQPLTWMGDLLALKDRNQAAATAKPHGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|311694720|gb|ADP97593.1| tRNA pseudouridine synthase A [marine bacterium HP15]
          Length = 302

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 124/245 (50%), Gaps = 3/245 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           R  +  EY+G G+ GWQ QK    S++  +  A+  V    V +  AGRTD+GVHA  Q+
Sbjct: 18  RVALAFEYDGRGFHGWQLQKSGVRSVEAELTAAVAKVANHAVDLVCAGRTDAGVHASYQI 77

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD             +N  L   D IS+         FHARFSA  R Y Y I     
Sbjct: 78  AHFDTPSVRNLRSWVMGINTAL--PDDISVHWAGNGVGDFHARFSATYRRYRYIIYNHPV 135

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +++G+     + LD + M  AAQ L G HDF++FR+  CQ+ +PIR ++   V    
Sbjct: 136 RPGIQRGQVSWTFRPLDADRMHRAAQALAGEHDFSSFRAAGCQSRTPIRFLERISVTRKR 195

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + + I V A +FLH  +R+  G+L  VG GK     + + L A+DR   G  APP GLY 
Sbjct: 196 DFVVIDVQANAFLHHMVRNIAGALMAVGSGKQRPEWIHEILVARDRTAAGVTAPPHGLYL 255

Query: 242 DSVEY 246
             V Y
Sbjct: 256 VDVGY 260


>gi|157374791|ref|YP_001473391.1| tRNA-pseudouridine synthase I [Shewanella sediminis HAW-EB3]
 gi|189030145|sp|A8FTU0|TRUA_SHESH RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157317165|gb|ABV36263.1| tRNA-pseudouridine synthase I [Shewanella sediminis HAW-EB3]
          Length = 261

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+G  YFGWQRQ    S+Q  +E+A+  V  E + VH AGRTD+GVHA  QV
Sbjct: 1   MRVALGIEYDGRQYFGWQRQAEVDSVQAQLERALSKVANEPIRVHCAGRTDAGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N  L   D I++  + IVD +FHARFSA  R Y Y I     
Sbjct: 61  VHFETNAIRKDSAWTLGVNVNL--PDDIAVRWVKIVDDEFHARFSATARRYRYMIYNYDF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +        ++D + M  AAQ  VG HDFT+FR++HCQ+ +P R++   +V   G
Sbjct: 119 RPGILRSGVSHYRGNIDADIMHQAAQQFVGEHDFTSFRALHCQSKTPFRSVHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +FLH  +R+ VG+L  +G G      + + L  +DR +  P A P GLY 
Sbjct: 179 MYICVDIKANAFLHHMVRNIVGTLLEIGLGNQRPEWIPQLLDLKDRSQAAPTAKPNGLYM 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|170718977|ref|YP_001784140.1| tRNA pseudouridine synthase A [Haemophilus somnus 2336]
 gi|189030135|sp|B0USP1|TRUA_HAES2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|168827106|gb|ACA32477.1| tRNA pseudouridine synthase A [Haemophilus somnus 2336]
          Length = 269

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + IEYNG+ YFGWQRQ N +S+Q  +E A+  V  E   ++ AGRTDSGVHA  QV
Sbjct: 1   MKIALGIEYNGTHYFGWQRQANVTSVQEKLESAVSFVANEFCQIYCAGRTDSGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD             LNA L     I++    +V + FHARFSA  R Y Y I     
Sbjct: 61  VHFDTKAIRSEKAWTFGLNANL--PADIAVRWAKVVSEDFHARFSATARRYRYLIYNHPL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             AL          +LD   M  A Q+L+G HDF++FR+  CQ+++P R I H  V    
Sbjct: 119 RSALFPTGVTHHHVALDHHLMHQAGQYLLGEHDFSSFRAAQCQSNTPWRNIHHLHVFRQA 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           N I + + A +F+H  +R+ VGSL  +G GK     ++  L  +DR    P A P+GLY 
Sbjct: 179 NYIIVDIQANAFVHHMVRNIVGSLLEIGSGKQPVEWMDWLLTQKDRTLAAPTAKPDGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVKY 243


>gi|146317967|ref|YP_001197679.1| tRNA pseudouridine synthase A [Streptococcus suis 05ZYH33]
 gi|166229845|sp|A4VT40|TRUA_STRSY RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|145688773|gb|ABP89279.1| Pseudouridylate synthase [Streptococcus suis 05ZYH33]
          Length = 249

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV-TGEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G  + G+QRQ +  ++Q  IEK +  + +G+ V VHGAGRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGHDFSGFQRQPHARTVQEEIEKTLVRLNSGQPVTVHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL        L  AL+   + S+ I ++++  V   FH R++   ++Y + +   
Sbjct: 61  QVIHFDLAGSRDVEKLRFALDT--QTSEDIDVVSVEQVADDFHCRYAKHSKTYEFLVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID--HFDV 177
           +    + +  A   P  LD   +  A Q LVG HDFT F +        +RTI     + 
Sbjct: 119 RPKNPMMRHYATFYPYDLDLSLIEEAIQDLVGTHDFTGFTASGTSVEDNVRTITVASMEY 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     +++ L  +DR   GP A   
Sbjct: 179 DQQRQFLIFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVGQIKRILAEKDRGLAGPTAAGN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|86141215|ref|ZP_01059761.1| tRNA pseudouridine synthase A [Leeuwenhoekiella blandensis MED217]
 gi|85831774|gb|EAQ50229.1| tRNA pseudouridine synthase A [Leeuwenhoekiella blandensis MED217]
          Length = 263

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 124/247 (50%), Gaps = 7/247 (2%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVA 62
           RY + I Y+G+ Y GWQRQ    ++Q  +E+A+  +    V V GAGRTD+GVHA +  A
Sbjct: 11  RYFIEIAYDGTSYHGWQRQPQSITVQEVLEEALSTLLRSEVPVVGAGRTDAGVHATQLFA 70

Query: 63  HFDLVREWVPV---ILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           HF++   +       L   LN +L   + +++  L  V  + HARF A+RRSY Y+I   
Sbjct: 71  HFEIEESYSFEALSHLKFRLNRFL--PEAVAVNALLPVSAEAHARFDAVRRSYEYKIHMV 128

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P  + +   +  P ++D  N   AA  L+GR DF  F        + I  I     + 
Sbjct: 129 KNPFLVNQSYYFEKPLNVDAMN--EAAAFLLGRQDFKCFSRSKTDVKTYICEITEARWDQ 186

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G  ++  + A  FL   +R+ VG+L  +G GK     L+  + ++ R E G  AP  GL
Sbjct: 187 DGAQLKFSISADRFLRNMVRAIVGTLLEIGQGKLKPAALKTIIASRTRSEAGASAPAHGL 246

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 247 YLTEVAY 253


>gi|257870548|ref|ZP_05650201.1| tRNA pseudouridine synthase [Enterococcus gallinarum EG2]
 gi|257804712|gb|EEV33534.1| tRNA pseudouridine synthase [Enterococcus gallinarum EG2]
          Length = 247

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 125/249 (50%), Gaps = 6/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV-TGEIVVVHGAGRTDSGVHALR 59
           M+RY   I Y+G+ + G+QRQ NG ++Q  IEK +  +  G+ V +HG+GRTD+GVHAL 
Sbjct: 1   MVRYKATIAYDGTNFQGFQRQPNGRTVQEEIEKTLTRMNNGQAVQIHGSGRTDAGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD     +  +         +  + I++  + IVD+ FHAR+    ++Y +R+   
Sbjct: 61  QVIHFDFDERPLEKM---RFGLDTQTPEDIAVKQVEIVDEHFHARYLVREKTYQFRVDIG 117

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P  LD   ++ A   L+G HDFT+F +        +RTI    +  
Sbjct: 118 KPRSPFRRYYASYYPYPLDLMKIQQALPDLLGTHDFTSFCATGSSVEDKVRTIHQASMEV 177

Query: 180 FGNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                E         FL+  IR  VG+L  +G+G+  +  +   +  +DR   GP A PE
Sbjct: 178 NEAGDELLFTFRGDGFLYKMIRIMVGTLLKIGNGRLPADSIPAIIAQKDRNAAGPTAHPE 237

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 238 GLYLVRVAY 246


>gi|317131990|ref|YP_004091304.1| tRNA pseudouridine synthase A [Ethanoligenens harbinense YUAN-3]
 gi|315469969|gb|ADU26573.1| tRNA pseudouridine synthase A [Ethanoligenens harbinense YUAN-3]
          Length = 252

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 124/246 (50%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +++ ++G+ Y GWQ QKNG ++Q  ++ A+  V      V G  RTD+GVHAL  
Sbjct: 1   MRNILLLLRFDGAAYHGWQVQKNGVTVQEVLQNALETVLRHRPPVTGCSRTDAGVHALAY 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
             +F          L +ALNA L   D I++     V   FHAR+SA  + Y+YRI+   
Sbjct: 61  ACNFRTEHTIPCQNLVRALNACL--PDDIAVFACREVPPDFHARYSAHEKEYVYRILNAP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A     +GRA  +P  LD   M  AA+  +G HDF  FR+        +RT+ H  V   
Sbjct: 119 ARDPFWRGRALHVPYPLDEAVMDKAARGFLGTHDFAGFRAAGSDVKDTVRTVFHSGVQRD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+L+  RV A  FL+  +R  VG+L      K    D+   + ++DR   GP AP  GLY
Sbjct: 179 GDLVLFRVRADGFLYNMVRIMVGTLLYTAQDKLQPADILAVIDSRDRTAAGPTAPAHGLY 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LNRVFY 244


>gi|167566409|ref|ZP_02359325.1| tRNA pseudouridine synthase A [Burkholderia oklahomensis EO147]
          Length = 270

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q ++E+A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQSQPHGKTVQDALERALAEFAQTSLHTTVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L    T+S+     +   FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTELDRADFSWVRGTNAFL--PSTVSVQWAKPMPDTFHARFAAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +  GRA  +   LD + MR AA+HLVG HDF+ FRS  CQA SPI+ +    +   G
Sbjct: 119 RSPMLAGRAGWVHMPLDVDAMREAAEHLVGEHDFSAFRSSECQAKSPIKHLYQIGIRPDG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ ++ L + L ++DR    P   PEGLY 
Sbjct: 179 DFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPASWLAEVLDSRDRDCAAPTFMPEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|163750187|ref|ZP_02157429.1| tRNA pseudouridine synthase A [Shewanella benthica KT99]
 gi|161330043|gb|EDQ01027.1| tRNA pseudouridine synthase A [Shewanella benthica KT99]
          Length = 261

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS Y+GWQRQ    ++Q  +E+A+  V  + + VH AGRTDSGVH   QV
Sbjct: 1   MRVALGIEYDGSKYYGWQRQLEVDTVQAQLERALSKVANQPISVHCAGRTDSGVHGTGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N  L   D I++  + +VD  FHARFSA  R Y Y I     
Sbjct: 61  VHFETTAIRKESAWTLGVNVNL--PDDIAVKWVKLVDDDFHARFSATARRYRYIIYNYHL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         LD + M  AAQH VG HDFT+FR++HCQ+ +P R +   +V   G
Sbjct: 119 RPGILRSGVSHYRGQLDEDKMHHAAQHFVGEHDFTSFRALHCQSKTPFRHVHEVNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G      +   L  +DR +  P A P GLY 
Sbjct: 179 MYLCVDIKANAFLHHMVRNIVGSLIEIGLGHQNEDWIVSLLALKDRSKAAPTAKPNGLYM 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 VDVTY 243


>gi|229107828|ref|ZP_04237464.1| tRNA pseudouridine synthase A [Bacillus cereus Rock1-15]
 gi|228675677|gb|EEL30885.1| tRNA pseudouridine synthase A [Bacillus cereus Rock1-15]
          Length = 252

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 83/248 (33%), Positives = 123/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q N  ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + I  R V   FL+  +R  VG+L  VG GK  S  + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDEIIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDSDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|254510182|ref|ZP_05122249.1| tRNA pseudouridine synthase A [Rhodobacteraceae bacterium KLH11]
 gi|221533893|gb|EEE36881.1| tRNA pseudouridine synthase A [Rhodobacteraceae bacterium KLH11]
          Length = 255

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 120/250 (48%), Positives = 161/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY+G  + GWQRQK   S+QG+IE A+  +      +  AGRTD+GVHAL Q
Sbjct: 1   MPRYALKVEYHGEPFAGWQRQKEQPSVQGAIEAALSRIEPGDHTIAAAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++W P  L +ALN +LK    ++I+  + V+  +HARFSA+ R YL+RI+ R+
Sbjct: 61  VAHCDLTKDWDPFRLSEALNYHLK-PQPVAIVKAARVNDDWHARFSALERQYLFRILMRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   +KG+ W I  +LD   M+  A  L+G+HDFTTFRS  CQA+SP++T+D   V   
Sbjct: 120 APATHDKGQVWQINHTLDVAAMQAGADMLIGQHDFTTFRSSICQAASPVKTLDALRVEQV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                  I   V ARSFLH Q+RSFVG+L+ VG G WT  D+  AL+A DR  CGP+ PP
Sbjct: 180 QGFSGAEIHFHVRARSFLHNQVRSFVGTLERVGAGAWTPEDVRDALEAADRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLARVGY 249


>gi|225871229|ref|YP_002747176.1| tRNA pseudouridine synthase A [Streptococcus equi subsp. equi 4047]
 gi|254764866|sp|C0M8L4|TRUA_STRE4 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|225700633|emb|CAW95185.1| tRNA pseudouridine synthase A [Streptococcus equi subsp. equi 4047]
          Length = 249

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG-EIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+QRQ    ++Q  IEK +  +TG + + +HGAGRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGTLFSGFQRQSQARTVQEEIEKTLQKLTGGQGIQIHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++  P  L  AL+   +  D I +++L I    FHAR+    ++Y + +   
Sbjct: 61  QVIHFDLEQKRDPEKLRFALDT--QTPDDIDVISLEIAADDFHARYHKHFKTYEFLVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID--HFDV 177
           +    + +  A   P  LD   M+ A + LVG HDFT F +      + +RTI       
Sbjct: 119 RPKNPMMRHYATHYPYPLDIAKMQAAIKDLVGTHDFTGFTAAGTSVKNKVRTITAATLTQ 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     +   L++++R+  GP A   
Sbjct: 179 DPKTGFLVFTFSGNGFLYKQVRNMVGTLLKIGNGRLPIEQIRLVLESKNRQLAGPTAAGN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|168213913|ref|ZP_02639538.1| tRNA pseudouridine synthase A [Clostridium perfringens CPE str.
           F4969]
 gi|170714597|gb|EDT26779.1| tRNA pseudouridine synthase A [Clostridium perfringens CPE str.
           F4969]
          Length = 248

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + + +N YL   + I +  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIEYINEYL--PEDIRVTEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIIVGTLVNVGLGKIEPKYINDILEAKERAKASEKAPA 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|17546704|ref|NP_520106.1| tRNA pseudouridine synthase A [Ralstonia solanacearum GMI1000]
 gi|42559848|sp|Q8XXX8|TRUA_RALSO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|17429003|emb|CAD15687.1| probable trna pseudouridine synthase a (trna-uridine isomerasei)
           (trna pseudouridylate synthaseI protein [Ralstonia
           solanacearum GMI1000]
          Length = 274

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 90/250 (36%), Positives = 135/250 (54%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + I+Y+G+ + GWQ Q +G+++Q  +E A+    G  +    AGRTD+GVHAL Q
Sbjct: 1   MTRIALGIQYDGAAFSGWQSQPHGNTVQDVLEAALREFAGVALPTTVAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V H D      P    +  NA+L    T+++     + + FHARFSA RR+Y Y +    
Sbjct: 61  VVHLDTELVRDPFSWVRGTNAFL--PPTVAVRWAQAMPEDFHARFSAHRRTYYYALTYGP 118

Query: 121 APLALEKGRAWLIPKSL----DCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
               L +G+A  +        D   M  AAQ LVG HDF++FR+  CQA SP++T+   +
Sbjct: 119 TRAPLLEGKAGYVTLPPGQSLDVTAMHEAAQVLVGEHDFSSFRAAECQAKSPVKTMYSTE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
           V   G  + +R+   +FLH  +R+ +G L  +G GK  +  + + L A+DRK   P   P
Sbjct: 179 VRGQGEWVFVRIRGSAFLHHMVRNIMGCLVAIGRGKRPAAWMGEVLAARDRKAAAPTFMP 238

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 239 DGLYLAEVGY 248


>gi|146276554|ref|YP_001166713.1| tRNA pseudouridine synthase A [Rhodobacter sphaeroides ATCC 17025]
 gi|166228756|sp|A4WPU4|TRUA_RHOS5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|145554795|gb|ABP69408.1| tRNA pseudouridine synthase A [Rhodobacter sphaeroides ATCC 17025]
          Length = 257

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 121/250 (48%), Positives = 163/250 (65%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQRQ    S+QG+IE A+  +      +  AGRTD+GVHA  Q
Sbjct: 1   MPRYALKIEYDGAPFAGWQRQAVLPSVQGAIEAALGRLEPGPHTIAAAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL ++W P  L  ALNA+LK    ++++  + V + FHARFSAI R YL+R++ R+
Sbjct: 61  VAHCDLGKDWDPFRLAGALNAHLK-PLPVAVVAAARVGEDFHARFSAIERRYLFRLLARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD---- 176
           AP   ++GR W +P  LD   MR AA HLVGRHDFTTFR+I CQA+SP++T+D       
Sbjct: 120 APEVHDRGRVWRVPHPLDGAAMREAAAHLVGRHDFTTFRAIGCQAASPVKTLDELTLETV 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G     R+ ARSFLH Q+RS VG+L+ VG G W    +++AL+A+DR  CGP+ PP
Sbjct: 180 EVPNGVEYRFRLRARSFLHNQVRSIVGTLERVGAGAWAPDRVKEALEARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLTGVGY 249


>gi|220930998|ref|YP_002507906.1| pseudouridylate synthase I [Halothermothrix orenii H 168]
 gi|220931093|ref|YP_002508001.1| pseudouridylate synthase I [Halothermothrix orenii H 168]
 gi|219992308|gb|ACL68911.1| pseudouridylate synthase I [Halothermothrix orenii H 168]
 gi|219992403|gb|ACL69006.1| pseudouridylate synthase I [Halothermothrix orenii H 168]
          Length = 246

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 125/246 (50%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGS-SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
               + +EY+G+ Y GWQ Q N   +IQG + K +F +    V + GA RTD+GVHA  Q
Sbjct: 3   RNIKITVEYDGTNYSGWQIQNNTPETIQGVLSKCLFDINKSPVKLIGASRTDAGVHARGQ 62

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F L        +  ALN+ L     I   +   V + FHARF A  + Y+YRI+  +
Sbjct: 63  VANFRLKVGIPVERIPLALNSKL--PPDIVCKDAEEVTEDFHARFDARGKRYIYRILNSE 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +   + IP +L+ + MR A   L+G HDF +F++      + +RTI   D+   
Sbjct: 121 YPSPFLRNYTYFIPHNLNIDKMREAGSLLIGEHDFASFQASGGSNKTTVRTITKLDIYRD 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I+I V    FL+  +R   G+L  VG GK T   + + L+ +DR   G  APP GL 
Sbjct: 181 QYQIKIEVCGNGFLYKMVRIIAGTLIEVGLGKRTVKSVGQLLEIKDRDRAGFTAPPRGLT 240

Query: 241 FDSVEY 246
              V Y
Sbjct: 241 LIEVFY 246


>gi|146320154|ref|YP_001199865.1| tRNA pseudouridine synthase A [Streptococcus suis 98HAH33]
 gi|253751190|ref|YP_003024331.1| tRNA pseudouridine synthase A [Streptococcus suis SC84]
 gi|253753091|ref|YP_003026231.1| tRNA pseudouridine synthase A [Streptococcus suis P1/7]
 gi|253754913|ref|YP_003028053.1| tRNA pseudouridine synthase A [Streptococcus suis BM407]
 gi|166229843|sp|A4VZC6|TRUA_STRS2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|145690960|gb|ABP91465.1| Pseudouridylate synthase [Streptococcus suis 98HAH33]
 gi|251815479|emb|CAZ51057.1| tRNA pseudouridine synthase A [Streptococcus suis SC84]
 gi|251817377|emb|CAZ55113.1| tRNA pseudouridine synthase A [Streptococcus suis BM407]
 gi|251819336|emb|CAR44702.1| tRNA pseudouridine synthase A [Streptococcus suis P1/7]
 gi|319757459|gb|ADV69401.1| tRNA pseudouridine synthase A [Streptococcus suis JS14]
          Length = 249

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 126/249 (50%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV-TGEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G  + G+QRQ +  ++Q  IEK +  + +G+ V VHGAGRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGHDFSGFQRQPHARTVQEEIEKTLVRLNSGQPVTVHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL        L  AL+   + S+ I ++++  V   FH R++   ++Y + +   
Sbjct: 61  QVIHFDLAGSRDVEKLRFALDT--QTSEDIDVVSVEQVADDFHCRYAKHSKTYEFLVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID--HFDV 177
           +    + +  A   P  LD   +  A Q LVG HDFT F +        +RTI     + 
Sbjct: 119 RPKNPMMRHYATFYPYDLDLSLIEEAIQDLVGTHDFTGFTASGTSVEDKVRTITVASMEY 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     +++ L  +DR   GP A   
Sbjct: 179 DQQRQFLIFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVGQIKRILAEKDRGLAGPTAAGN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|239624119|ref|ZP_04667150.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522150|gb|EEQ62016.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 249

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 80/247 (32%), Positives = 124/247 (50%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNG-SSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + Y + + Y+G+ Y GWQ+Q N   +IQG +E+ +  + GE V V G+GRTD+GVHA  Q
Sbjct: 1   MNYIIWLSYDGTRYDGWQKQGNTEKTIQGKLERVLEKLDGEPVEVRGSGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F L  +  P  + + LN YL     +  +  +     FH+R +A+R++Y Y+I    
Sbjct: 61  VADFQLKGKRAPEEVMEYLNRYLPEDIAVWRIQTAPER--FHSRLNAVRKTYRYQIELGP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                 +   + + + LD  +M  A  +L G  DF +F        S +RT++       
Sbjct: 119 KKDVFRRSYYYGLGQELDVASMERAVAYLTGTRDFKSFCGNKKMKKSTVRTLESIRFERL 178

Query: 181 GNLI-EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +    I      FL   +R   G+L  VG G+    D+   L+A DR+  G  APPEGL
Sbjct: 179 EDTRLHISFTGNGFLQQMVRILTGTLIEVGQGRRKPEDIRSILEALDRQAAGFTAPPEGL 238

Query: 240 YFDSVEY 246
           + + VEY
Sbjct: 239 FLEKVEY 245


>gi|210623220|ref|ZP_03293659.1| hypothetical protein CLOHIR_01609 [Clostridium hiranonis DSM 13275]
 gi|210153757|gb|EEA84763.1| hypothetical protein CLOHIR_01609 [Clostridium hiranonis DSM 13275]
          Length = 243

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 86/246 (34%), Positives = 131/246 (53%), Gaps = 3/246 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    + ++YNG+ Y GWQ Q N   IQG+IE AI  +TGE V ++G+GRTD+GVHAL Q
Sbjct: 1   MRNIKITVQYNGANYCGWQEQPNSPGIQGNIEYAIKEITGEKVKINGSGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F +  +     +  ALN+ L     ISI++   V+ +FHAR+SA  + Y Y +   +
Sbjct: 61  VANFKIESQIPVNRIPDALNSKL--PKDISIIDAEEVEDEFHARYSAKGKIYKYLVYNSR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               + K  ++ +   LD E M+  A+ L+G +DF  F S        +RTI    +   
Sbjct: 119 YRNPILKDISYQVKYDLDFEKMKKEAESLIGTYDFCGFMSSGSSVKDTVRTIKSVKIEKE 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +LI        FL+  +R   G+L  +G G+ T   +E  +++QDR + G  AP   L+
Sbjct: 179 DDLIVFEFEGNGFLYNMVRILSGTLIDIGRGRIT-ESMEDIIKSQDRSKAGHTAPGHALF 237

Query: 241 FDSVEY 246
              V Y
Sbjct: 238 LKKVFY 243


>gi|150005081|ref|YP_001299825.1| tRNA pseudouridine synthase A [Bacteroides vulgatus ATCC 8482]
 gi|149933505|gb|ABR40203.1| tRNA pseudouridine synthase A [Bacteroides vulgatus ATCC 8482]
          Length = 267

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 84/246 (34%), Positives = 121/246 (49%), Gaps = 5/246 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +RY + + Y+G+ Y GWQ Q NG S+Q ++ +A+     + + V GAGRTD+GVHA   +
Sbjct: 11  MRYFIYLAYDGTNYHGWQIQPNGDSVQETLMRALSTFLRQEIEVVGAGRTDAGVHARLMI 70

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD  RE   V + + LN  L     I++  +  V    HARF A  R+Y Y + TR  
Sbjct: 71  AHFDYDRELDCVQITEKLNRLL--PPDIAVYAVKRVKDDAHARFDATYRTYKYYVTTR-- 126

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
                +  AW +  SLD E M  AA+ L    DFT+F  +H    +    I H +     
Sbjct: 127 KDPFNRHYAWRLFNSLDFEKMNEAARVLFDYTDFTSFSKLHTDVKTNNCRIMHAEWTQVS 186

Query: 182 -NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
                  + A  FL   +R+ VG+L  VG GK T  +  K ++ +DR   G   P   L+
Sbjct: 187 GTEWVFIIKADRFLRNMVRAVVGTLVEVGRGKMTVDEFRKVIEDKDRCSAGSSVPGHALF 246

Query: 241 FDSVEY 246
              V Y
Sbjct: 247 LVDVGY 252


>gi|125623329|ref|YP_001031812.1| tRNA pseudouridine synthase A [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|166228735|sp|A2RIH1|TRUA_LACLM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|124492137|emb|CAL97066.1| tRNA pseudouridine synthase A [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070076|gb|ADJ59476.1| tRNA pseudouridine synthase A [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 253

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG-EIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+Q Q N  ++Q  IEK +  +   E V++ G+GRTDSGVHA  
Sbjct: 1   MTRYKATIAYDGTDFAGFQSQTNQRTVQEEIEKVLSKLNSFEPVILQGSGRTDSGVHAFG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL  +   +   +      +    I++  + +V   +HAR+    ++Y Y +   
Sbjct: 61  QVIHFDLNGKARDLERLR-FGLDTQTPADIAVKKVELVPDDWHARYQKHEKTYEYYLENS 119

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                  +         L+ E M+ A   LVG+HDFT F +        +RTI   ++  
Sbjct: 120 VTRSPFHRHSKAYFRYPLNFERMQGAMVKLVGQHDFTGFTASGSSVDDKVRTIYQAEIIQ 179

Query: 180 -FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
                 +       FL+ Q+R+ VG++  +G+ +   + ++K L +++R   GP A PEG
Sbjct: 180 LDKENFKFIFRGNGFLYKQVRNMVGTVIKIGNDRMPVSQIDKILTSKNRNFAGPTAAPEG 239

Query: 239 LYFDSVEY 246
           LY   V+Y
Sbjct: 240 LYLKEVKY 247


>gi|312880338|ref|ZP_07740138.1| tRNA pseudouridine synthase A [Aminomonas paucivorans DSM 12260]
 gi|310783629|gb|EFQ24027.1| tRNA pseudouridine synthase A [Aminomonas paucivorans DSM 12260]
          Length = 260

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 122/247 (49%), Gaps = 2/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY   + Y G+ + G+Q Q N  S+QG +E A+  ++G  V  HGAGRTD+GVHA  Q
Sbjct: 1   MPRYAAEVAYVGASFAGFQAQPNRPSVQGVLEAALEALSGSPVRCHGAGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFDL R W P  L  A+ A+L    ++ IL ++ V   FHARF A+ R Y + +  + 
Sbjct: 61  VVHFDLPRPWDPFRLRGAMAAHL--PPSVEILQVAQVPDSFHARFDALWREYRFFLWNQA 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A +   +   W +   LD   ++     L GRHDF  F     +     RT+ H      
Sbjct: 119 ACVPHLRPFVWWVKSPLDWTLVQHLLPSLRGRHDFGAFCRSVDRPEDSWRTLLHVSCRRR 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I  R     FL   +R  VG+L+ V  G          L+   R E G  APP+GL+
Sbjct: 179 GPFIRFRFRGDGFLTNMVRILVGTLEGVARGGMEPEAFLNLLEGGCRSEAGRTAPPQGLF 238

Query: 241 FDSVEYS 247
           F  V Y+
Sbjct: 239 FWRVGYA 245


>gi|154684666|ref|YP_001419827.1| tRNA pseudouridine synthase A [Bacillus amyloliquefaciens FZB42]
 gi|166228678|sp|A7Z0S0|TRUA_BACA2 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|154350517|gb|ABS72596.1| TruA [Bacillus amyloliquefaciens FZB42]
          Length = 247

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 131/247 (53%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI--VVVHGAGRTDSGVHALR 59
           +R    I Y+G  + G+Q Q    ++Q  +EKA+ ++      V V+ +GRTDS VHA  
Sbjct: 1   MRVKCTIAYDGHLFNGYQVQPGKRTVQSELEKALAVIHKTDGRVPVYSSGRTDSDVHAAG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALNA L   D I++    I D  FHARFSA+++ Y Y + T 
Sbjct: 61  QVIHFDTPLSIPGEKWPFALNALL--PDDIAVKTAEIADDGFHARFSAVQKEYRYFVYTE 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P   ++  A+     L+ + MR A++HLVG HDFT+F +        +RTI   D   
Sbjct: 119 KHPDVFKRHYAYHFAYPLNVQKMREASRHLVGTHDFTSFCAADTAVQDKVRTIYELDWTE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +++R+    FL+  +R   G+L   G GK++  D++  L+A+DR+  G  AP  GL
Sbjct: 179 TVDGLQMRITGNGFLYNMVRIIAGTLLDTGAGKFSPDDVKAMLEAKDREAAGRTAPGHGL 238

Query: 240 YFDSVEY 246
           Y  SV Y
Sbjct: 239 YLWSVCY 245


>gi|310768198|gb|ADP13148.1| tRNA pseudouridine synthase A [Erwinia sp. Ejp617]
          Length = 271

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 133/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V    + V  AGRTD+GVH   QV
Sbjct: 11  HKLALGIEYDGSRYYGWQRQNEVRSVQEKLEKALAKVADRPIAVFCAGRTDAGVHGTGQV 70

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 71  VHFETTAQRKDAAWTLGVNANL--PADIAVRWVKAVADDFHARFSATARRYRYVIYNQRL 128

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M+ A Q L+G +DFT+FR++ CQ+ +P+R + H +V+  G
Sbjct: 129 RPAILAGGVTHFYHPLDVEKMQRAGQCLLGENDFTSFRAVQCQSRTPMRNVMHLNVSRHG 188

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  +G G      + + L A+DRK     A  EGLY 
Sbjct: 189 AYVVVDIKANAFVHHMVRNIVGSLIEIGCGNQPEGWMRELLVAKDRKLAAATARAEGLYL 248

Query: 242 DSVEY 246
            +V+Y
Sbjct: 249 VAVDY 253


>gi|293369414|ref|ZP_06615999.1| tRNA pseudouridine synthase A [Bacteroides ovatus SD CMC 3f]
 gi|292635581|gb|EFF54088.1| tRNA pseudouridine synthase A [Bacteroides ovatus SD CMC 3f]
          Length = 267

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 120/247 (48%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  + KA+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMKALSTFLRREIEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD         +   LN  L     ISI  +  V    HARF A  R+Y Y + T  
Sbjct: 61  VAHFDSDELLDTTSVTDKLNRLL--PPDISIYRVCRVRPDTHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +     +   W +   L+ E M  AA+ L   +DFT+F  +H    + I  I H +    
Sbjct: 117 SKYPFNRQYRWRLYNQLNYERMNEAARILFEYNDFTSFSKLHTDVKTNICHITHAEWTQE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK T     + ++ QDR + G  AP + L
Sbjct: 177 DDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLTVEGFRRVIEQQDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|84683526|ref|ZP_01011429.1| tRNA pseudouridine synthase A [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84668269|gb|EAQ14736.1| tRNA pseudouridine synthase A [Rhodobacterales bacterium HTCC2654]
          Length = 257

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 120/250 (48%), Positives = 164/250 (65%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQRQK+  S+QG++E A+  +  ++  +  AGRTD+GVHAL Q
Sbjct: 1   MPRYALKIEYDGRPFSGWQRQKDQPSVQGAVEAALGKLEADVPSIAAAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA  DL ++W P  L +ALN +LK      +   ++VD  FHARFSAI R YL+R+I+R+
Sbjct: 61  VATCDLQKDWTPFRLTEALNYHLKPDRVAIV-ACALVDDGFHARFSAIERQYLFRLISRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD---- 176
           APL  ++G AW + ++LD + M+  A  L+GRHDFTTFRS  CQA SP++T+D       
Sbjct: 120 APLVHDRGNAWRVVQALDADAMQAGADRLIGRHDFTTFRSTMCQADSPVKTLDELRVETL 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G      V ARSFLH Q+RSFVG+L+ VG G W+  D+  AL+A+DR  CGP+ PP
Sbjct: 180 PYPGGTEYRFHVRARSFLHNQVRSFVGTLERVGAGSWSPDDVTAALEARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 DGLYLARVGY 249


>gi|42518460|ref|NP_964390.1| tRNA pseudouridine synthase A [Lactobacillus johnsonii NCC 533]
 gi|51316717|sp|Q74L59|TRUA_LACJO RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|41582745|gb|AAS08356.1| tRNA pseudouridine synthase A [Lactobacillus johnsonii NCC 533]
          Length = 263

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 127/249 (51%), Gaps = 6/249 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            RY + + Y+G  + G+Q Q N  ++QG IE+A+  +T G+ VVVHG+GRTD+GVHA  Q
Sbjct: 3   TRYKLTMAYDGHLFHGFQIQPNQRTVQGVIEEALKKMTKGKRVVVHGSGRTDAGVHAKGQ 62

Query: 61  VAHFDLV-REWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V HFD   +E     +  ALNA   +          IVD+ FH ++S   + Y Y +   
Sbjct: 63  VIHFDYPGKEIPAKNMMLALNAL--MPIDTVFFESEIVDEDFHVQYSTKGKWYRYVVDQH 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH--FDV 177
           +      +      P  LD   M+ AA+ L+G HDFT+F +   Q    +RTI +     
Sbjct: 121 RFTDPFNRFYTGHYPYPLDISLMKQAAKDLIGEHDFTSFAASGGQIVDKVRTIYYVNITP 180

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     I    +   FL+  +R  VG+L  +G+ K    D+ + L+A+DR+E    AP  
Sbjct: 181 DPDKKQIIFDFIGNGFLYNMVRILVGTLLEIGNKKRPVDDIPRVLKAKDRQEVRTTAPAS 240

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 241 GLYLQQVFY 249


>gi|317154696|ref|YP_004122744.1| tRNA pseudouridine synthase A [Desulfovibrio aespoeensis Aspo-2]
 gi|316944947|gb|ADU63998.1| tRNA pseudouridine synthase A [Desulfovibrio aespoeensis Aspo-2]
          Length = 258

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 85/248 (34%), Positives = 120/248 (48%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + + Y+G+ + GWQ Q    ++QG IE A+  + G  V +HGAGRTD+GVHAL Q
Sbjct: 1   MPRFLLTLAYDGTDFSGWQLQARDRTVQGVIETALTEIMGSPVRLHGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            AHFD       +    ALNA L   + + +L    V   FHAR+ A  ++Y Y +   +
Sbjct: 61  TAHFDCQDIRASIPWQCALNARL--PEDVRVLACRRVADDFHARYQAQAKTYEYTLWHTR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                ++ R       LD   M  AA+ L G HDF +F++      S IRT+     +  
Sbjct: 119 EFCLPQRRRFAWNCGPLDFTAMEAAARLLTGEHDFASFQNTGTPVRSTIRTVTAISRHPG 178

Query: 181 GNLIE--IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
               E   R  A  FL   +R+ VG L   G G+    +  + L A DR      APP+G
Sbjct: 179 PTPHESVWRFTANGFLKQMVRNLVGCLAACGRGRLAPDEAGRILLAADRALAPATAPPQG 238

Query: 239 LYFDSVEY 246
           L   SV Y
Sbjct: 239 LTLISVAY 246


>gi|328948028|ref|YP_004365365.1| tRNA pseudouridine synthase A [Treponema succinifaciens DSM 2489]
 gi|328448352|gb|AEB14068.1| tRNA pseudouridine synthase A [Treponema succinifaciens DSM 2489]
          Length = 261

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 79/256 (30%), Positives = 122/256 (47%), Gaps = 12/256 (4%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKN------GSSIQGSIEKAIFLVTGEIVVVHGAGRTDSG 54
           M    + + Y+G+ + GWQRQ          ++QG IE A+F +    V + G+GRTDSG
Sbjct: 1   MTNILLTVSYDGTDFCGWQRQDKSDNGSPVRTVQGEIENALFKMLKVPVKLSGSGRTDSG 60

Query: 55  VHALRQVAHFDLVRE-WVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYL 113
           VHA  Q A+F+   +        +ALN  L     I IL    V+K F +RF A  R Y 
Sbjct: 61  VHAAGQAANFESPIDTIPCENYVRALNGIL--PQDIRILKARKVEKDFSSRFCATSRLYR 118

Query: 114 YRIITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID 173
           Y I T+  P A E    W I    + + +      L G  D  +F +    + S  R ID
Sbjct: 119 YFIQTKNPPFASESRYRWFISFRPEIDLLNEMCSCLRGEIDCASFAASGDSSLSTKRYID 178

Query: 174 HFDVNSF---GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKEC 230
           +          +L+  ++ A +FL   +RS  G+L  +   K +  + +K L+++DR + 
Sbjct: 179 NAFFFWNKENPDLLVFQIEANAFLWKMVRSITGTLIQLAQKKCSPNEFKKILESRDRTKA 238

Query: 231 GPLAPPEGLYFDSVEY 246
           G  APP GL+   V++
Sbjct: 239 GITAPPTGLFLWEVKF 254


>gi|157363557|ref|YP_001470324.1| tRNA pseudouridine synthase ACD [Thermotoga lettingae TMO]
 gi|166991166|sp|A8F526|TRUA_THELT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|157314161|gb|ABV33260.1| tRNA pseudouridine synthase A [Thermotoga lettingae TMO]
          Length = 245

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 91/247 (36%), Positives = 130/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+  I+ Y+G+ + G+Q QK+  ++QG  E+A+  +  + V+   AGRTD+GVHA  Q
Sbjct: 1   MKRFMAIVSYDGTNFCGFQVQKDVRTVQGMFEQALERILKQRVITIAAGRTDTGVHANGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +  FD   +     +  A+NA L   D I +  +  VDK FH RF A RR Y Y I   Q
Sbjct: 61  IVCFDCYLDIDEESMKNAMNANL--PDDIYVRKVVEVDKNFHPRFDAKRRIYHYLIYNSQ 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P    +  AW  P  L+   MR AA+   G HDF +F        + +RTI    V   
Sbjct: 119 EPNLFIRNYAWWFPYKLNICKMREAAKFFEGEHDFRSFMKSGDHRENTVRTIYRVRVLQL 178

Query: 181 GNLIE-IRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              I  IRV  RSFL   +R+ VG+L  VG G+W   D+ + L+ +DR +    APP GL
Sbjct: 179 RGGIILIRVEGRSFLRRMVRNMVGALVKVGVGEWKPEDISRVLELKDRSKAAVTAPPHGL 238

Query: 240 YFDSVEY 246
           Y  +V++
Sbjct: 239 YLYAVDF 245


>gi|330721742|gb|EGG99735.1| tRNA pseudouridine synthase A [gamma proteobacterium IMCC2047]
          Length = 269

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 97/246 (39%), Positives = 138/246 (56%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKN-GSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
            R  + IEY+GSGY GWQ Q +   ++Q  +E A+  +    V V  AGRTD+GVHA  Q
Sbjct: 9   TRVALGIEYHGSGYNGWQAQNHESITVQCELESALSKIADAPVRVFCAGRTDAGVHATGQ 68

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD+++        +  N +L   D+I +     V + FHARFSA+ R Y+Y I    
Sbjct: 69  VVHFDVLKPRTENAWVRGTNTHL--PDSIRVRWAKFVPEDFHARFSAMARRYIYVIENTP 126

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+         + LD E M++AA +LVG HDF+++R++ CQA S I+T+ H  V   
Sbjct: 127 VHSAIMNKHFSFEDRPLDVERMQLAANYLVGEHDFSSYRTVRCQAKSAIKTVHHLKVERH 186

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+LI I + A +FLH  +R+  G L +VG GK      ++ L A+DR   G  APP GLY
Sbjct: 187 GSLIAIDIYANAFLHHMVRNVAGVLMMVGMGKAEPVWAKQVLDARDRTVGGVTAPPNGLY 246

Query: 241 FDSVEY 246
              V+Y
Sbjct: 247 LVGVDY 252


>gi|319942390|ref|ZP_08016704.1| pseudouridylate synthase [Sutterella wadsworthensis 3_1_45B]
 gi|319804078|gb|EFW00986.1| pseudouridylate synthase [Sutterella wadsworthensis 3_1_45B]
          Length = 269

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 126/243 (51%), Gaps = 2/243 (0%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
             + IEY G+ + GWQ Q +  S+Q ++E A+       + V  AGRTD+GVHA  QV  
Sbjct: 11  LALGIEYRGTAFNGWQVQPDHPSVQAALEAALSQFADHPISVICAGRTDTGVHATHQVVS 70

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F  V         + +NA L  S  +  +    VD++FHARFSA  R+Y Y I       
Sbjct: 71  FTSVARRPSAGWIRGVNAILPESVAVRWM--REVDEKFHARFSARSRTYEYWIWNDPVRS 128

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
            L +G A  + + LD   M+  A  L+G HDFT+FR+  CQA +P+RTI    +   G L
Sbjct: 129 PLFEGSAGWVFRPLDEALMQRGATALIGEHDFTSFRASECQAKTPVRTISELKIVRRGAL 188

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           + +R+ A +FL   +R+ VG+L  VG G+     + + L A+ R    P   P GLY   
Sbjct: 189 VGVRITANAFLQHMVRNIVGALIYVGTGRERPEWIAEVLAAKSRDAAAPTFSPAGLYLTG 248

Query: 244 VEY 246
           V Y
Sbjct: 249 VGY 251


>gi|116628993|ref|YP_814165.1| tRNA pseudouridine synthase A [Lactobacillus gasseri ATCC 33323]
 gi|238853452|ref|ZP_04643830.1| tRNA pseudouridine synthase A [Lactobacillus gasseri 202-4]
 gi|116094575|gb|ABJ59727.1| Pseudouridylate synthase [Lactobacillus gasseri ATCC 33323]
 gi|238833892|gb|EEQ26151.1| tRNA pseudouridine synthase A [Lactobacillus gasseri 202-4]
          Length = 264

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 86/252 (34%), Positives = 128/252 (50%), Gaps = 8/252 (3%)

Query: 1   MI--RYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHA 57
           M+  RY + + Y+G  + G+Q Q N  ++QG IE+A+  +T G+ VVVHG+GRTD+GVHA
Sbjct: 1   MMTTRYKLTMAYDGHLFHGFQIQPNERTVQGVIEEALKKMTKGKRVVVHGSGRTDAGVHA 60

Query: 58  LRQVAHFDLV-REWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
             QV HFD   +E     +  ALNA   +       +  IVD  FH ++S   + Y Y +
Sbjct: 61  KGQVIHFDYPGKEIPAKNMMLALNAL--MPIDTVFFDSEIVDSDFHVQYSTKGKWYRYIV 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH-- 174
              +      +      P  LD   M+ AA+ L+G HDFT+F +   Q    +RTI +  
Sbjct: 119 DQHRFTDPFNRFYTGHYPYPLDIALMKKAAKDLIGEHDFTSFAASGGQIVDKVRTIYYVN 178

Query: 175 FDVNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLA 234
              +     I    +   FL+  +R  VG+L  +G+ K    D+ + L A+DR+E    A
Sbjct: 179 ITSDPDNKKIIFDFIGNGFLYNMVRILVGTLLEIGNKKRPVDDIPRVLAAKDRQEVRTTA 238

Query: 235 PPEGLYFDSVEY 246
           P  GLY   V Y
Sbjct: 239 PASGLYLQHVFY 250


>gi|260426957|ref|ZP_05780936.1| tRNA pseudouridine synthase A [Citreicella sp. SE45]
 gi|260421449|gb|EEX14700.1| tRNA pseudouridine synthase A [Citreicella sp. SE45]
          Length = 255

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 110/250 (44%), Positives = 154/250 (61%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G  + GWQRQ +  S+QG+IE A+  +      +  AGRTD+GVHA  Q
Sbjct: 1   MPRYALLVEYDGGPFAGWQRQADQPSVQGAIEAALARLEPREHTIAAAGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ + W P  L +ALN +LK +        ++ D  +HARFSA+ R Y +R++ R+
Sbjct: 61  VAHCDMAKPWDPFRLSEALNFHLKPAPVAIRACAAVAD-DWHARFSAVERRYTFRLLARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP  LE G+ W +   LD   M+  A HL+G HDFTTFRS  CQA+SP++T+D   +   
Sbjct: 120 APATLEAGQVWRVMNPLDLGAMQEGAAHLLGLHDFTTFRSTMCQAASPVKTLDEIRIEEC 179

Query: 181 G----NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                      + ARSFLH Q+RS VG+L+ VG G W   D++ AL+A+DR  CGP+ PP
Sbjct: 180 DTGAGPEYRFHLRARSFLHNQVRSIVGTLERVGAGSWAPEDVKHALEARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 DGLYLTGVGY 249


>gi|228898895|ref|ZP_04063177.1| tRNA pseudouridine synthase A [Bacillus thuringiensis IBL 4222]
 gi|228963242|ref|ZP_04124411.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228796500|gb|EEM43939.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228860795|gb|EEN05173.1| tRNA pseudouridine synthase A [Bacillus thuringiensis IBL 4222]
          Length = 252

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPKHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWNNALNTML--PDDIVIRRVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|225867856|ref|YP_002743804.1| tRNA pseudouridine synthase A [Streptococcus equi subsp.
           zooepidemicus]
 gi|259550446|sp|C0MFQ1|TRUA_STRS7 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|225701132|emb|CAW98001.1| tRNA pseudouridine synthase A [Streptococcus equi subsp.
           zooepidemicus]
          Length = 249

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG-EIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+QRQ    ++Q  IEK +  +TG + + +HGAGRTD+GVHA  
Sbjct: 1   MTRYKAIISYDGTLFSGFQRQSQARTVQEEIEKTLQKLTGGQGIQIHGAGRTDAGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL ++  P  L  AL+   +  D I +++L      FHAR+    ++Y + +   
Sbjct: 61  QVIHFDLEQKRDPEKLRFALDT--QTPDDIDVISLEAAADDFHARYHKHFKTYEFLVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID--HFDV 177
           +    + +  A   P  LD   M+ A + LVG HDFT F +      + +RTI       
Sbjct: 119 RPKNPMMRHYATHYPYPLDIAKMQAAIKDLVGTHDFTGFTAAGTSVKNKVRTITAATLTQ 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     +        FL+ Q+R+ VG+L  +G+G+     +   L++++R+  GP A   
Sbjct: 179 DPKTGFLVFTFSGNGFLYKQVRNMVGTLLKIGNGRLPIEQIRLVLESKNRQLAGPTAAGN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIIY 247


>gi|317123065|ref|YP_004103068.1| tRNA pseudouridine synthase A [Thermaerobacter marianensis DSM
           12885]
 gi|315593045|gb|ADU52341.1| tRNA pseudouridine synthase A [Thermaerobacter marianensis DSM
           12885]
          Length = 298

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 113/243 (46%), Gaps = 2/243 (0%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
              ++ Y+G+ + GWQRQ    ++Q  +E A+  + G  V V  AGRTD+GVHA  QV H
Sbjct: 46  LRAVLAYDGTDFAGWQRQPRQRTVQQVVEDALERLLGHPVRVTAAGRTDAGVHARAQVIH 105

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           +   R +    L  AL   L     +  +        FHAR+SA R++Y Y +     P 
Sbjct: 106 WRTPRPFPVDRLVPALRGLL--PADVVAVEAGEAPPGFHARYSARRKTYAYHVWRDPVPD 163

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
            L +   W +P  LD + M  AA+ L G HDF  F++         RT+    V   G L
Sbjct: 164 PLHRRWQWHLPLDLDVDAMVEAARRLEGTHDFAPFKAAGSPVRRTRRTLYRCAVEERGPL 223

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           +   + A  FL    R  VG+L  +G G+W +  +E  L    R   GP AP  GL    
Sbjct: 224 LRFVLEADGFLMHMARGIVGTLVEIGRGRWQADRVEAILAEGRRDLAGPTAPAHGLVLWQ 283

Query: 244 VEY 246
           V Y
Sbjct: 284 VVY 286


>gi|114763999|ref|ZP_01443240.1| tRNA pseudouridine synthase A [Pelagibaca bermudensis HTCC2601]
 gi|114543591|gb|EAU46605.1| tRNA pseudouridine synthase A [Roseovarius sp. HTCC2601]
          Length = 255

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 112/251 (44%), Positives = 155/251 (61%), Gaps = 5/251 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +++EY+G  + GWQRQ +  S+QG+IE A+  +      +  AGRTD+GVHA  Q
Sbjct: 1   MPRYALLVEYDGRPFAGWQRQADQPSVQGAIEAALARLEKRDHTIAAAGRTDAGVHARGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ + W P  L +ALN +LK +        ++ D  +HARFSA  R YL+R++ R+
Sbjct: 61  VAHCDMEKAWDPFRLSEALNFHLKPAPVAIRACAAVSD-DWHARFSAHERRYLFRLLVRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP  LE G+ W +   L  E MR  A HL+G+HDFTTFRS  CQA+SP++T+D   +   
Sbjct: 120 APATLEAGQVWRVMNPLSLEAMRAGAAHLIGQHDFTTFRSTMCQAASPVKTMDEIRIEQT 179

Query: 181 G----NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
                      + ARSFLH Q+RS VG+L+ VG G W   D+  AL+A+DR  CGP+ PP
Sbjct: 180 DTGAGTEFRFHLRARSFLHNQVRSIVGTLERVGAGSWAPEDVRSALEARDRAACGPVCPP 239

Query: 237 EGLYFDSVEYS 247
           +GLY   V Y+
Sbjct: 240 DGLYLMGVGYA 250


>gi|83718190|ref|YP_438876.1| tRNA pseudouridine synthase A [Burkholderia thailandensis E264]
 gi|167621345|ref|ZP_02389976.1| tRNA pseudouridine synthase A [Burkholderia thailandensis Bt4]
 gi|257141962|ref|ZP_05590224.1| tRNA pseudouridine synthase A [Burkholderia thailandensis E264]
 gi|123753984|sp|Q2T7H3|TRUA_BURTA RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|83652015|gb|ABC36079.1| tRNA pseudouridine synthase A [Burkholderia thailandensis E264]
          Length = 270

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 87/245 (35%), Positives = 134/245 (54%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q ++E+A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQSQPHGKTVQDALERALAEFAQTSLHTTVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L    T+++     +   FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTDLDRADFSWVRGTNAFL--PSTVAVQWAKPMPDTFHARFAAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +   RA  +   LD + MR AA+HLVG HDF+ FRS  CQA SP++ +    +   G
Sbjct: 119 RSPMLAARAGWVHTPLDVDAMREAAEHLVGEHDFSAFRSSECQAKSPVKHLYQIGIRPDG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ ++ L + L+++DR    P   PEGLY 
Sbjct: 179 DFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPASWLAEVLESRDRGCAAPTFMPEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|311111209|ref|ZP_07712606.1| tRNA pseudouridine synthase A [Lactobacillus gasseri MV-22]
 gi|311066363|gb|EFQ46703.1| tRNA pseudouridine synthase A [Lactobacillus gasseri MV-22]
          Length = 263

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 126/249 (50%), Gaps = 6/249 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            RY + + Y+G  + G+Q Q N  ++QG IE+A+  +T G+ VVVHG+GRTD+GVHA  Q
Sbjct: 3   TRYKLTMAYDGHLFHGFQIQPNERTVQGVIEEALKKMTKGKRVVVHGSGRTDAGVHAKGQ 62

Query: 61  VAHFDLV-REWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V HFD   +E     +  ALNA   +       +  IVD  FH ++S   + Y Y +   
Sbjct: 63  VIHFDYPGKEIPAKNMMLALNAL--MPIDTVFFDSEIVDSDFHVQYSTKGKWYRYIVDQH 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH--FDV 177
           +      +      P  LD   M+ AA+ L+G HDFT+F +   Q    +RTI +     
Sbjct: 121 RFTDPFNRFYTGHYPYPLDIALMKKAAKDLIGEHDFTSFAASGGQIVDKVRTIYYVNITS 180

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +     I    +   FL+  +R  VG+L  +G+ K    D+ + L A+DR+E    AP  
Sbjct: 181 DPDNKKIIFDFIGNGFLYNMVRILVGTLLEIGNKKRPVDDIPRVLAAKDRQEVRTTAPAS 240

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 241 GLYLQHVFY 249


>gi|187933357|ref|YP_001884507.1| tRNA pseudouridine synthase A [Clostridium botulinum B str. Eklund
           17B]
 gi|238691608|sp|B2TIK9|TRUA_CLOBB RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|187721510|gb|ACD22731.1| tRNA pseudouridine synthase A [Clostridium botulinum B str. Eklund
           17B]
          Length = 244

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 131/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M    +IIE++G+ + GWQRQ    ++QG +EKAI  +TGE  + +G+ RTD GVHA   
Sbjct: 1   MRNIKLIIEFDGTNFCGWQRQIKDRTVQGCLEKAILKITGEKSLTNGSSRTDGGVHAKAM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+F            +ALN  L   D I+++    VD  FHAR+S+  + Y Y I+ R 
Sbjct: 61  VANFITNSSIPGEKFREALNTKL--PDDIAVIKSEEVDMDFHARYSSKGKMYSYTIVNRY 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
             L+  K     + K L+ E+M+ A +  +G+HDF  F S    A + +RTI  F +   
Sbjct: 119 EKLSFGKQYVHHVRKELNVEDMKKACECFIGKHDFKAFMSPGSSAKTTVRTIQEFYIEKN 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            ++I+I + A  FL+  +R  VG+L  +G GK    D++  +    RK  G   PP GL 
Sbjct: 179 EDVIKIFISADGFLYNMVRIIVGTLINIGTGKTKLEDVDNIINDGIRKRSGMCVPPNGLV 238

Query: 241 FDSVEY 246
            + V Y
Sbjct: 239 LEKVFY 244


>gi|332992505|gb|AEF02560.1| tRNA pseudouridine synthase A [Alteromonas sp. SN2]
          Length = 263

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 132/246 (53%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + IEY+G+   GWQRQK+ +S+Q  +EKA+ ++  + ++V  AGRTD+GVHA  Q
Sbjct: 1   MGRIALGIEYDGASVHGWQRQKDVASVQEYLEKALTVIANKPIIVFCAGRTDAGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           + HFD   E         +NA   + DTI++     V   FHARFSA  R Y Y I   +
Sbjct: 61  IVHFDSDVERPERAWTLGINAN--MPDTIAVTWAKPVSDDFHARFSATHRRYRYVIYNSR 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
              A+         + LD E M  AAQ LVG HDFTTFR+  CQ+ +P RT+    V+  
Sbjct: 119 MRPAILHNGVTHEYRELDAEKMHEAAQALVGEHDFTTFRASLCQSKTPHRTVSSVSVHRQ 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + + + A +FLH  +R+  GSL  +G G+     +   L  +DR +    A P GLY
Sbjct: 179 GRYVVLDIRANAFLHHMVRNITGSLLCIGAGEQPVDWMAHLLTLKDRAKAATTAKPNGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVDVTY 244


>gi|332685695|ref|YP_004455469.1| tRNA pseudouridine synthase A [Melissococcus plutonius ATCC 35311]
 gi|332369704|dbj|BAK20660.1| tRNA pseudouridine synthase A [Melissococcus plutonius ATCC 35311]
          Length = 257

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 85/248 (34%), Positives = 130/248 (52%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG-EIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G+ + G+Q Q NG ++Q  +EK ++ +   + + + G+GRTD+GVHAL 
Sbjct: 1   MPRYKAIIAYDGTNFNGFQSQINGRTVQDELEKTLYKLNNNQSITIFGSGRTDAGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD ++      L  AL+   +    IS+  +  V   FHAR+  I ++Y ++I T 
Sbjct: 61  QVIHFDYLKARDVEKLRFALDT--QSPADISVKKIEEVSNNFHARYHVIEKTYQFKIDTG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +  A   P S+D   +  A   L+G HDFT+F +  C   S IRTI    V+ 
Sbjct: 119 KTRDPFRRFYASYFPHSIDLAKIEKALPDLLGEHDFTSFCAAGCSVDSKIRTIYEASVSQ 178

Query: 180 F-GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
              + I        FL+  +R  VG+L  +G GK   T + + +  ++R+  GP A PEG
Sbjct: 179 TSEDEIIFTFRGNGFLYKMVRIIVGTLLKIGQGKIKETAIPEIIAGKNRRLAGPTAHPEG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLVQVIY 246


>gi|300114593|ref|YP_003761168.1| tRNA pseudouridine synthase A [Nitrosococcus watsonii C-113]
 gi|299540530|gb|ADJ28847.1| tRNA pseudouridine synthase A [Nitrosococcus watsonii C-113]
          Length = 259

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 95/245 (38%), Positives = 136/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+GS + GWQ QK   ++Q ++E+A+  V  E V V  AGRTD+GVHA  QV
Sbjct: 1   MRIALGLEYDGSNFSGWQSQKGVRTVQATLERALSTVANEPVTVITAGRTDAGVHAAAQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD     +        NA L     ++IL    V++ FHARFSAI R Y Y ++ R+ 
Sbjct: 61  VHFDTTTFRLEHHWVFGGNANL--PPEVAILWAQPVNEAFHARFSAIARHYRYIVLNRRT 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+   R     + L    M+ A   LVG HDF++FR+  CQA SP+R + H +V   G
Sbjct: 119 RPAIANRRVTWYCQPLSVTKMKEAGAFLVGEHDFSSFRAKACQAKSPVRNVHHLEVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I + + A +FLH  +R+  G L  +G G+      E+ LQA+ R   G  A P+GLY 
Sbjct: 179 DWIIMDISANAFLHHMVRNIAGVLMAIGKGEQPPRWAEEVLQARCRAVGGVTARPDGLYL 238

Query: 242 DSVEY 246
            SV+Y
Sbjct: 239 VSVDY 243


>gi|313891575|ref|ZP_07825185.1| tRNA pseudouridine synthase A [Dialister microaerophilus UPII
           345-E]
 gi|313120034|gb|EFR43216.1| tRNA pseudouridine synthase A [Dialister microaerophilus UPII
           345-E]
          Length = 244

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 133/246 (54%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGS-SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + Y MIIEY+G+ Y GWQ+QK+   ++QG IEKA   VTGE V + GAGRTDSGVHA  Q
Sbjct: 1   MNYKMIIEYDGTRYEGWQKQKHSDETLQGKIEKAFEKVTGENVQIIGAGRTDSGVHAKGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V +  L  +     L   LN  L   D I I   + V+++FH+RF A  + Y Y +    
Sbjct: 61  VVNVHLPYDLNAENLKNELNEIL--PDDIYIKQCTEVEEKFHSRFHAKSKIYEYNLRIGS 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                +K   W   K L  E M+ AA+ L G HDFT F +      S +RT+   ++++ 
Sbjct: 119 NKDVFQKRFIWQFAKPLCIEKMKRAAEILQGTHDFTAFCNNKNFKKSAVRTVYSIEISTS 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +++ +R     FL   IR  VG+L  VG+ K  +  L   L+++ R   G  APP+GL 
Sbjct: 179 NDILHLRFCGDGFLQGMIRIMVGTLVEVGENKRDADSLYDVLKSKQRSNAGFTAPPQGLT 238

Query: 241 FDSVEY 246
             SV+Y
Sbjct: 239 LISVQY 244


>gi|261868098|ref|YP_003256020.1| tRNA pseudouridine synthase A [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413430|gb|ACX82801.1| tRNA pseudouridine synthase A [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 261

 Score =  185 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 135/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           ++  + +EY+G  YFGWQRQ+  +SIQ  +E+AI +V  E + +  AGRTDSGVHA  QV
Sbjct: 1   MKIALGVEYDGKHYFGWQRQEKVASIQAELERAISVVANEDIGIFCAGRTDSGVHATGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +NA L   D I++    +V+  FHARFSA  R Y Y +   + 
Sbjct: 61  LHFETTAQRPEKAWSFGVNANL--PDDIAVRWAKVVEDDFHARFSATARRYRYILYCNKL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+           LD + M  A Q L+G +DF++FR+  CQ+++P R + H +V   G
Sbjct: 119 RSAILPQGVTHYHLELDHQLMHGAGQALLGENDFSSFRAAQCQSNTPWRNVHHLNVTRQG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             I + + A +F+H  +R+ VGSL  VG G      ++  L+ +DR    P A PEGLY 
Sbjct: 179 QYIIVDIQANAFVHHMVRNIVGSLIEVGCGNQPVEWMKWLLEQKDRTLAAPTAKPEGLYL 238

Query: 242 DSVEY 246
            +V Y
Sbjct: 239 VNVIY 243


>gi|332559018|ref|ZP_08413340.1| tRNA pseudouridine synthase A [Rhodobacter sphaeroides WS8N]
 gi|332276730|gb|EGJ22045.1| tRNA pseudouridine synthase A [Rhodobacter sphaeroides WS8N]
          Length = 255

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 122/250 (48%), Positives = 161/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQRQ   +S+QG+IE A+  +      +  AGRTD+GVHA  Q
Sbjct: 1   MPRYALRIEYDGGPFAGWQRQAAQASVQGAIETALGRLEPGPHTIAAAGRTDTGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL R+W P  L  ALNA+LK    ++I+  + V ++FHARFSA+ R YL+R++ R+
Sbjct: 61  VAHCDLARDWDPFRLAGALNAHLK-PLPVAIVAAARVPEEFHARFSAVERRYLFRLLARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID----HFD 176
           AP   ++GR W +P  LD E MR  A HLVGRHDFTTFR+  CQA+SPI+T+D       
Sbjct: 120 APEVHDRGRVWRVPHPLDAEAMRAGAAHLVGRHDFTTFRAAGCQAASPIKTLDALTLETV 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G      + ARSFLH Q+RS VG+L+ VG G WT   + +AL A+DR  CGP+ PP
Sbjct: 180 EGMNGTEYRFHLRARSFLHNQVRSIVGTLERVGAGAWTPDQVREALDARDRAACGPVCPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLTGVGY 249


>gi|15616818|ref|NP_240030.1| tRNA pseudouridine synthase A [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11135207|sp|P57295|TRUA_BUCAI RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|25292033|pir||D84953 pseudouridylate synthase (EC 4.2.1.70) [imported] - Buchnera sp.
           (strain APS)
 gi|10038881|dbj|BAB12916.1| pseudouridylate synthase I [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 266

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 139/243 (57%), Gaps = 2/243 (0%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
           + + +EY+GS Y GWQRQK   SIQ  IEKA+ ++    + V  AGRTD+GVH++ QV H
Sbjct: 9   FALGVEYDGSYYHGWQRQKILPSIQEEIEKALSIIANHKIDVVCAGRTDAGVHSIGQVIH 68

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F              +N+YL  S+ IS++ +  V + FHAR+SAI RSY Y I       
Sbjct: 69  FKTTANRKKSSWSIGVNSYL--SENISVVWVKEVTENFHARYSAITRSYRYIIYNYSLRS 126

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
           A+ + +   I + L+ + M   AQ L+G HDFT+FR++ CQ+ SP R I   +V  F N 
Sbjct: 127 AIFQTKLNHIYRKLNVDKMNFEAQFLLGEHDFTSFRALGCQSHSPWRNITKLNVFRFHNW 186

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           + + + A SFLH  +R+ VGSL  VG  K     ++  L+ +DR   G  AP +GLY   
Sbjct: 187 VVVDITANSFLHHMVRNIVGSLIEVGISKKKEYWIKDLLEKKDRSHAGATAPAKGLYLVY 246

Query: 244 VEY 246
           VEY
Sbjct: 247 VEY 249


>gi|227515518|ref|ZP_03945567.1| tRNA-pseudouridine synthase I [Lactobacillus fermentum ATCC 14931]
 gi|227086131|gb|EEI21443.1| tRNA-pseudouridine synthase I [Lactobacillus fermentum ATCC 14931]
          Length = 258

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 130/251 (51%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGE---IVVVHGAGRTDSGVHA 57
           M RY +   Y+GS + G+Q Q    ++Q  +E+A+  +  +    ++V G+GRTD+GVHA
Sbjct: 1   MHRYKITFAYDGSNFAGFQVQPGERTVQQVLERAVNKIAKKPQPPLMVFGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFDL  +     L +ALN+ L     + +   + V   FHARF A  + Y YR++
Sbjct: 61  LGQVAHFDLPYQIPGPSLVRALNSSL--PLDVLVKEATEVAPDFHARFDAHHKRYRYRVV 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD- 176
             +     ++         +D E M+ AAQ  VG HDFT+F +   QA+S +R ID    
Sbjct: 119 GGEFTNPFKRNYTGHYKYPVDVERMQTAAQDFVGEHDFTSFVASGSQATSNVRRIDEVTV 178

Query: 177 -VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
             +   + +    V   FL+ Q+R  V  L  +G+G+    D+ + ++A++R      AP
Sbjct: 179 VRDEENDEVVFDFVGNGFLYNQVRIMVAFLLEIGNGRRPVDDVMRVMKAKNRDLARGTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY   V Y
Sbjct: 239 ASGLYLVEVTY 249


>gi|86139183|ref|ZP_01057753.1| tRNA pseudouridine synthase A [Roseobacter sp. MED193]
 gi|85824027|gb|EAQ44232.1| tRNA pseudouridine synthase A [Roseobacter sp. MED193]
          Length = 258

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 118/250 (47%), Positives = 160/250 (64%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R+ + +EY+G  + GWQRQK+  S+QG+IE+A+  +      +  AGRTD+GVH L Q
Sbjct: 1   MPRFALKVEYHGKPFAGWQRQKDQPSVQGAIEEALAKLEPGPHTIAAAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DL + W P  L +ALN +LK    ++I++ ++VD ++HARFSAI R YL+RI+ R+
Sbjct: 61  VAHCDLQKPWSPFRLSEALNFHLK-PAPVAIVDCAVVDPEWHARFSAIERQYLFRILIRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP   + G+ W I   LD E M+  A HL+G HDFTTFRS  CQA SP +T+D   +   
Sbjct: 120 APATHDAGQVWQINNDLDVERMQQGANHLLGNHDFTTFRSSICQAQSPQKTLDELRIERV 179

Query: 181 GNL----IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
             L    +   V ARSFLH Q+RSFVG+L+ VG   WT  D++ AL+A DR  CGP+ P 
Sbjct: 180 QGLSGPEVHFHVRARSFLHNQVRSFVGTLERVGADAWTPQDVKSALEACDRAACGPVCPG 239

Query: 237 EGLYFDSVEY 246
            GLY   V Y
Sbjct: 240 HGLYLARVGY 249


>gi|296877377|ref|ZP_06901416.1| tRNA-pseudouridine synthase I [Streptococcus parasanguinis ATCC
           15912]
 gi|296431616|gb|EFH17424.1| tRNA-pseudouridine synthase I [Streptococcus parasanguinis ATCC
           15912]
          Length = 251

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 123/249 (49%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+QRQ +  S+Q  IEK +  +  G  V VHGAGRTDSGVHAL 
Sbjct: 4   MTRYKATISYDGTLFAGFQRQPHARSVQEEIEKTLTRLNQGTPVTVHGAGRTDSGVHALG 63

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL +E     L  AL+   +  + I  + +  V   FH+R+    ++Y + +   
Sbjct: 64  QVIHFDLPQERDEEKLRFALDT--QTPEDIDFIRVEQVAADFHSRYKKHSKTYEFIVDYG 121

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +    + +  A   P  LD E M+ A Q L G HDFT F +        +RTI    +  
Sbjct: 122 RPKNPMMRHYATHYPYPLDVEKMQAAIQKLEGTHDFTGFTASGTSVEDKVRTITEARLVE 181

Query: 180 FGNLI--EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                          FL+ QIR+ VG+L  +G+ +     ++  L+ +DR   GP A P 
Sbjct: 182 DAEHHRLVFTFSGNGFLYKQIRNMVGTLLKIGNDRMPIEQIDLILEQKDRNLAGPTAAPN 241

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 242 GLYLKEIRY 250


>gi|160891004|ref|ZP_02072007.1| hypothetical protein BACUNI_03451 [Bacteroides uniformis ATCC 8492]
 gi|317480950|ref|ZP_07940030.1| tRNA pseudouridine synthase A [Bacteroides sp. 4_1_36]
 gi|156859225|gb|EDO52656.1| hypothetical protein BACUNI_03451 [Bacteroides uniformis ATCC 8492]
 gi|316902843|gb|EFV24717.1| tRNA pseudouridine synthase A [Bacteroides sp. 4_1_36]
          Length = 250

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 115/247 (46%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG+S+Q  + KA+  +    V V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTAYHGWQIQPNGASVQECLMKALSTLLRREVEVVGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD       V +   LN  L     IS+  L  V    HARF A  R Y Y + T  
Sbjct: 61  VAHFDSDSPLDTVFMTDKLNRLL--PPDISVYRLRAVKPDAHARFDATARMYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH-FDVNS 179
           A +   +     + ++ D E M  AAQ L    DFT+F  +H    +    I H      
Sbjct: 117 AKMPFNRQYRCRLFQTPDFERMNEAAQTLFDYTDFTSFSKLHTDVKTNNCKIMHAAWTRV 176

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
                   + A  FL   +R+ VG+L  VG GK +     + ++ +DR + G   P   L
Sbjct: 177 DDVTWVFTIQADRFLRNMVRAIVGTLLEVGRGKLSVESFRRVIEQKDRCQAGTSVPGNAL 236

Query: 240 YFDSVEY 246
           +   V Y
Sbjct: 237 FLVDVAY 243


>gi|115522681|ref|YP_779592.1| tRNA pseudouridine synthase A [Rhodopseudomonas palustris BisA53]
 gi|122297686|sp|Q07TX2|TRUA_RHOP5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|115516628|gb|ABJ04612.1| tRNA pseudouridine synthase A [Rhodopseudomonas palustris BisA53]
          Length = 246

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 132/246 (53%), Positives = 169/246 (68%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY +IIEY+G+ Y GWQ Q+NG SIQG++E A   + GE + V GAGRTD+GVHAL Q
Sbjct: 1   MPRYKLIIEYDGTPYCGWQIQENGPSIQGALEDAAKAICGEAIRVRGAGRTDAGVHALAQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH D+ ++  P  L  ALNA+L+    I ++   IV   F ARFSAI+R Y+YRI  R+
Sbjct: 61  VAHCDVPKQLPPGRLRDALNAHLR-PQPIGVITAEIVPDDFEARFSAIKRHYVYRISNRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A LAL   RAW +P+ LD + M  AAQ L+G+HDFTTFR   CQA SP +T+D  DV   
Sbjct: 120 ANLALAINRAWRVPRRLDSDAMHEAAQRLIGKHDFTTFRDTECQAKSPDKTLDQLDVIRD 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I I   ARSFLH+Q+RS VGSL  VG+G+W++ DL  AL A+ R  CGP+APP+GLY
Sbjct: 180 GDEIRIVTSARSFLHSQVRSMVGSLVWVGEGRWSADDLAAALAARSRSACGPVAPPDGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LVKVDY 245


>gi|300024227|ref|YP_003756838.1| tRNA pseudouridine synthase A [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526048|gb|ADJ24517.1| tRNA pseudouridine synthase A [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 246

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 132/246 (53%), Positives = 171/246 (69%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G+ + GWQRQ  G SIQG++E AI   +GE   V GAGRTD+GVHAL Q
Sbjct: 1   MPRYRITIEYDGTPFIGWQRQAEGVSIQGALETAIRKFSGEAPGVRGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL + W P  +  A+N +L+  + I ++  + VD  F ARFSA++R Y YR++TR+
Sbjct: 61  VAHFDLEKTWEPGRIRDAMNFHLR-PNPIGVVAAAQVDDAFDARFSAVKRYYEYRLLTRR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP  L++ R W   ++LD   M  AAQ LVG+HDFTTFR+  CQA SP++T+D FDV+  
Sbjct: 120 APPILQRHRVWWTMQNLDAAAMHAAAQELVGKHDFTTFRAAQCQAKSPVKTLDVFDVSRE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  I  RV ARSFLH Q+RS VGSLKLVG+GKW+  DL  AL A +R+ CGP+AP  GLY
Sbjct: 180 GEEIVCRVSARSFLHHQVRSMVGSLKLVGEGKWSRADLASALAAANREACGPVAPAAGLY 239

Query: 241 FDSVEY 246
              V+Y
Sbjct: 240 LVGVDY 245


>gi|237746730|ref|ZP_04577210.1| tRNA pseudouridine synthase A [Oxalobacter formigenes HOxBLS]
 gi|229378081|gb|EEO28172.1| tRNA pseudouridine synthase A [Oxalobacter formigenes HOxBLS]
          Length = 264

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 135/247 (54%), Gaps = 1/247 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M R  + IEY+G+G+ GWQ Q +G ++Q  +E AI   T   +    AGRTD+GVHA  Q
Sbjct: 4   MKRIALGIEYDGTGWRGWQTQPDGMTVQDQLEAAIRQFTRMDMATTCAGRTDAGVHATEQ 63

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQ-FHARFSAIRRSYLYRIITR 119
           V H D   E +PV   + +N+YL  S  +         K  FHAR SAI R Y Y +   
Sbjct: 64  VVHLDTGLERLPVSWVRGINSYLPSSIAVRWACEVPGGKDGFHARSSAIARRYRYLVYNS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                L K RA  + + LD E MR  A  L+G HDF+ FR+  CQ+ +P++T++   +  
Sbjct: 124 PVRSPLWKNRAGWVFRPLDLEWMREGAGFLLGEHDFSAFRAAECQSITPVKTMNGIGIEK 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            GNLI     A +FLH  IR+ VGSL +VG G      +++ L+++DR +  P   P+GL
Sbjct: 184 QGNLIVFTFEANAFLHHMIRNIVGSLIVVGKGNRPPKWMKELLESRDRSQAAPTFMPDGL 243

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 244 YLSRVFY 250


>gi|312868117|ref|ZP_07728321.1| tRNA pseudouridine synthase A [Streptococcus parasanguinis F0405]
 gi|322390938|ref|ZP_08064444.1| tRNA pseudouridine synthase A [Streptococcus parasanguinis ATCC
           903]
 gi|311096521|gb|EFQ54761.1| tRNA pseudouridine synthase A [Streptococcus parasanguinis F0405]
 gi|321142313|gb|EFX37785.1| tRNA pseudouridine synthase A [Streptococcus parasanguinis ATCC
           903]
          Length = 248

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 84/249 (33%), Positives = 123/249 (49%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+QRQ +  S+Q  IEK +  +  G  V VHGAGRTDSGVHAL 
Sbjct: 1   MTRYKATISYDGTLFAGFQRQPHARSVQEEIEKTLTRLNQGTPVTVHGAGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL +      L  AL+   +  + I  + +  V+  FH+R+    ++Y + +   
Sbjct: 61  QVIHFDLPQARDEEKLRFALDT--QTPEDIDFIRVEQVEDDFHSRYKKHSKTYEFIVDYG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +    + +  A   P  LD E M+ A Q L G HDFT F +        +RTI    +  
Sbjct: 119 RPKNPMMRHYATHYPYPLDVEKMQAAIQKLEGTHDFTGFTASGTSVEDKVRTITEARLVE 178

Query: 180 FGNLI--EIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
                          FL+ QIR+ VG+L  +G+ +     ++  L+ +DR   GP A P 
Sbjct: 179 DAEHHRLVFTFSGNGFLYKQIRNMVGTLLKIGNDRMPIEQIDLILEKKDRNLAGPTAAPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|168211805|ref|ZP_02637430.1| tRNA pseudouridine synthase A [Clostridium perfringens B str. ATCC
           3626]
 gi|170710235|gb|EDT22417.1| tRNA pseudouridine synthase A [Clostridium perfringens B str. ATCC
           3626]
          Length = 248

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK----NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVH 56
           M    + ++Y+GS Y GWQ+Q     N S++Q  +EK +  +T E + + G GRTDSGVH
Sbjct: 1   MRNIKITLDYDGSKYKGWQKQNQKGSNVSTVQDKLEKVLTKMTSEEIQLIGCGRTDSGVH 60

Query: 57  ALRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRI 116
           A   VA+F          + + +N YL   + I +  +    ++FHARF+   ++Y Y I
Sbjct: 61  AKNYVANFKTNSLMTLEQIIEYINEYL--PEDIRVTEIREASERFHARFNVKSKTYEYTI 118

Query: 117 ITRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD 176
              +      +  AW + + LD E M   A++L+G HDF +F S+  +  S +RTI+  +
Sbjct: 119 DNNKFKDVFLRKYAWHVEEKLDLEAMEEGAKYLLGTHDFKSFTSLKSKNKSTLRTINSIE 178

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
            +   N++ I++    FL   +R  VG+L  VG GK     +   L+A++R +    AP 
Sbjct: 179 FHENNNILSIKINGNGFLLNMVRIIVGTLVDVGLGKIEPKYINDILEAKERAKASEKAPS 238

Query: 237 EGLYFDSVEY 246
            GL    + Y
Sbjct: 239 HGLCLLELNY 248


>gi|58617163|ref|YP_196362.1| tRNA pseudouridine synthase A [Ehrlichia ruminantium str. Gardel]
 gi|62901148|sp|Q5FGS1|TRUA_EHRRG RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|58416775|emb|CAI27888.1| tRNA pseudouridine synthase A [Ehrlichia ruminantium str. Gardel]
          Length = 246

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 107/247 (43%), Positives = 157/247 (63%), Gaps = 2/247 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           +RY ++IEY+GS + GWQ+Q  N +SIQ  +EKAIF  + + V V+GAGRTD+GVHAL Q
Sbjct: 1   MRYKIVIEYDGSNFIGWQKQNHNSNSIQEILEKAIFKFSKQHVTVYGAGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDL  ++   I+  A+N +L       +  +   D  FHARFSA RR YLY+I+ R 
Sbjct: 61  VAHFDLTTDFETYIVRNAINYHLISHAIAVVH-VEKTDTDFHARFSAKRRYYLYKIVNRY 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +PL +++ RAWL+   L+ ENM  A  ++ G H+F++FR+  CQ+ SP++T+D+  +   
Sbjct: 120 SPLTIDRNRAWLVHTPLNVENMIKAVCYIKGNHNFSSFRAKCCQSKSPVKTVDNLSITYN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I+I + A SFLH Q+R  VG+L   G G +    ++  ++A +R   G  AP  GLY
Sbjct: 180 HPYIDINISAISFLHHQVRIIVGTLVECGKGYFPPEHIKTIMEANNRSYAGTTAPSYGLY 239

Query: 241 FDSVEYS 247
           F  V+YS
Sbjct: 240 FVKVDYS 246


>gi|52078642|ref|YP_077433.1| tRNA pseudouridine synthase A [Bacillus licheniformis ATCC 14580]
 gi|52784004|ref|YP_089833.1| tRNA pseudouridine synthase A [Bacillus licheniformis ATCC 14580]
 gi|319649083|ref|ZP_08003291.1| tRNA pseudouridine synthase A [Bacillus sp. BT1B_CT2]
 gi|62901269|sp|Q65P74|TRUA_BACLD RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|52001853|gb|AAU21795.1| pseudouridylate synthase I [Bacillus licheniformis ATCC 14580]
 gi|52346506|gb|AAU39140.1| TruA [Bacillus licheniformis ATCC 14580]
 gi|317388783|gb|EFV69602.1| tRNA pseudouridine synthase A [Bacillus sp. BT1B_CT2]
          Length = 247

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 90/247 (36%), Positives = 136/247 (55%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV--TGEIVVVHGAGRTDSGVHALR 59
           +R    I Y+G  ++G+Q Q    +IQ  +EKA+  +    E + V  +GRTDSGVHA+ 
Sbjct: 1   MRMKCTISYDGHLFYGYQVQPGQRTIQDELEKALQTLHKAKERIPVVSSGRTDSGVHAVG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           Q  HFD            ALNA L   D IS+     V+ QFHARFSA R+ Y Y I   
Sbjct: 61  QTIHFDSPLSIPEAKWPYALNALL--PDDISVRKAEAVNDQFHARFSAKRKEYRYMIYRG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P   ++  A+ +P  LD E ++ A+++LVG HDFT+F +   +    +RT+   + + 
Sbjct: 119 RHPDVFKRYYAYHVPYDLDMEKVKEASRYLVGTHDFTSFCATKTEVKDKVRTVHELEWSD 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            G+ +++R+V   FL+  +R   G+L  VG GK++  D+EK + A++R   G  AP  GL
Sbjct: 179 TGDGLQMRIVGSGFLYNMVRIIAGTLLDVGTGKFSPGDIEKMILAKNRDAAGRTAPAHGL 238

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 239 YLWRVIY 245


>gi|312874027|ref|ZP_07734062.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 2052A-d]
 gi|312874727|ref|ZP_07734746.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 2053A-b]
 gi|325912360|ref|ZP_08174756.1| tRNA pseudouridine synthase A [Lactobacillus iners UPII 143-D]
 gi|329920629|ref|ZP_08277316.1| tRNA pseudouridine synthase A [Lactobacillus iners SPIN 1401G]
 gi|311089472|gb|EFQ47897.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 2053A-b]
 gi|311090367|gb|EFQ48776.1| tRNA pseudouridine synthase A [Lactobacillus iners LEAF 2052A-d]
 gi|325475831|gb|EGC79001.1| tRNA pseudouridine synthase A [Lactobacillus iners UPII 143-D]
 gi|328935887|gb|EGG32347.1| tRNA pseudouridine synthase A [Lactobacillus iners SPIN 1401G]
          Length = 260

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY +I+ Y+G+ + G+Q+Q N  +IQG IE A+  +T G+ V+VHG+GRTD+GVHA  
Sbjct: 1   MQRYKLILAYDGTLFHGFQKQPNQRTIQGVIEDALLKMTKGKHVIVHGSGRTDAGVHAKG 60

Query: 60  QVAHFDLVREWVPVILCK-ALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIIT 118
           QV HFD     +P      ALNA   +   I  L+  +V+  FH ++S   + Y Y I  
Sbjct: 61  QVIHFDYPGNVIPAKNMLLALNAL--MPRDIIFLDSELVNDDFHVQYSTKAKWYRYIINQ 118

Query: 119 RQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN 178
            +      +      P  LD   M+ AA +L+G+HDFT+F +   Q    +RTI + ++ 
Sbjct: 119 SRFTDPFRRNYTGHCPYKLDMLKMKKAATYLLGKHDFTSFAASGGQIVDKVRTIFYINLE 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
             G+ I + V+   FL+  +R   G L  +G G+    D+EK + A++R++    AP  G
Sbjct: 179 QHGDEIVLDVIGDGFLYNMVRIITGLLIDIGHGQKEVEDVEKIILAKNRQQVRNTAPASG 238

Query: 239 LYFDSVEY 246
           LY   V Y
Sbjct: 239 LYLYHVFY 246


>gi|325523908|gb|EGD02125.1| tRNA pseudouridine synthase A [Burkholderia sp. TJI49]
          Length = 270

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 84/245 (34%), Positives = 128/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q ++E A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQAQPHGKTVQNALEHALAEFARVPLHTTVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +  P    +  NA+L  S  +       +   FHARFSA  R+Y Y +     
Sbjct: 61  VHFDTDLDREPFSWVRGTNAFLPPSVAVQW--AKPMPDAFHARFSAFERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +   RA  I   LD + MR AA HL+G HDF++FRS  CQ+ +P++ +   D+   G
Sbjct: 119 RSPMLDRRAGWIHTPLDDDAMRTAAAHLIGEHDFSSFRSSECQSKTPVKHLYQIDIRRVG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + +  R  A +FLH  +R+ +G L  VG G++ +  +   L  +DR    P    +GLY 
Sbjct: 179 HFLHFRFRANAFLHHMVRNLMGCLVAVGRGRYPADWMAAVLAGRDRNLAAPTFMADGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|259907892|ref|YP_002648248.1| tRNA pseudouridine synthase A [Erwinia pyrifoliae Ep1/96]
 gi|224963514|emb|CAX55004.1| tRNA pseudouridylate synthase I [Erwinia pyrifoliae Ep1/96]
 gi|283477767|emb|CAY73683.1| pseudouridylate synthase I [Erwinia pyrifoliae DSM 12163]
          Length = 271

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 132/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            +  + IEY+GS Y+GWQRQ    S+Q  +EKA+  V    + V  AGRTD+GVH   QV
Sbjct: 11  HKLALGIEYDGSRYYGWQRQNEVRSVQEKLEKALAKVADRPIAVFCAGRTDAGVHGTGQV 70

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+   +         +NA L     I++  +  V   FHARFSA  R Y Y I  ++ 
Sbjct: 71  VHFETTAQRKDAAWTLGVNANL--PADIAVRWVKAVADDFHARFSATARRYRYVIYNQRL 128

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
             A+  G        LD E M+ A Q L+G +DFT+FR++ CQ+ +P+R + H  V+  G
Sbjct: 129 RPAILAGGVTHFYHPLDVEKMQRAGQCLLGENDFTSFRAVQCQSRTPMRNVMHLKVSRHG 188

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +F+H  +R+ VGSL  +G G      + + L A+DRK     A  EGLY 
Sbjct: 189 AYVVVDIKANAFVHHMVRNIVGSLMEIGCGNQPEGWMRELLVAKDRKLAAATARAEGLYL 248

Query: 242 DSVEY 246
            +V+Y
Sbjct: 249 VAVDY 253


>gi|329666723|gb|AEB92671.1| tRNA pseudouridine synthase A [Lactobacillus johnsonii DPC 6026]
          Length = 263

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 128/249 (51%), Gaps = 6/249 (2%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALRQ 60
            RY + + Y+G  + G+Q Q N  ++QG IE+A+  +T G+ VVVHG+GRTD+GVHA  Q
Sbjct: 3   TRYKLTMAYDGHLFHGFQIQPNERTVQGVIEEALKKMTKGKRVVVHGSGRTDAGVHAKGQ 62

Query: 61  VAHFDLV-REWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           V HFD   +E     +  ALNA   +          IVD+ FH ++S   + Y Y +   
Sbjct: 63  VIHFDYPGKEIPAKNMMLALNAL--MPIDTVFFESEIVDEDFHVQYSTKGKWYRYIVDQH 120

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDH--FDV 177
           +      +      P  LD   M+ AA+ L+G HDFT+F +   Q    +RTI +     
Sbjct: 121 RFTDPFNRFYTGHYPYPLDISLMQQAAKDLIGEHDFTSFAASGGQIVDKVRTIYYVNITP 180

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +S    I    +   FL+  +R  VG+L  +G+ K    D+ + L+A+DR+E    AP  
Sbjct: 181 DSDKKQIIFDFIGNGFLYNMVRILVGTLLEIGNKKRPVDDIPRVLKAKDRQEVRTTAPAS 240

Query: 238 GLYFDSVEY 246
           GLY   V Y
Sbjct: 241 GLYLQQVFY 249


>gi|332798239|ref|YP_004459738.1| tRNA pseudouridine synthase A [Tepidanaerobacter sp. Re1]
 gi|332695974|gb|AEE90431.1| tRNA pseudouridine synthase A [Tepidanaerobacter sp. Re1]
          Length = 243

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 90/245 (36%), Positives = 136/245 (55%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +   +++EY G+ Y GWQRQKN  SIQ  +E AI  +TGE V V G+GRTD+GVHAL QV
Sbjct: 1   MNVKILLEYEGTAYSGWQRQKNAISIQEVLENAIKSITGEAVNVIGSGRTDAGVHALGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A+F    +     L  A+N+ L   + I + +  IV + FHARF A  + Y Y I   + 
Sbjct: 61  ANFKTQTKIPIEKLPYAINSKL--PEDIVVKHAEIVPEDFHARFWAKAKIYTYTIYNAKF 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P  L K  ++  P+ L+   M+ AA  L+G HDF +F + +    S +R I+  +V   G
Sbjct: 119 PSPLLKRYSYFYPRPLNVRAMKKAADMLIGTHDFASFMASNSPVKSTVRCIERLEVFQNG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           ++++  + A  FL+  +R   G+L  VG  K  + D+   ++++DR   G   PP+GL  
Sbjct: 179 DIVKFEIEANGFLYNMVRIIAGTLLDVGINKKKANDIISIIKSKDRSMAGKTLPPQGLCL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 IKVIY 243


>gi|289167524|ref|YP_003445793.1| tRNA pseudouridine synthase A [Streptococcus mitis B6]
 gi|288907091|emb|CBJ21925.1| tRNA pseudouridine synthase A [Streptococcus mitis B6]
          Length = 249

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 128/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEI-VVVHGAGRTDSGVHALR 59
           M RY   I Y+G  + G+QRQ +  S+Q  IEK +  +  E  + VHGAGRTDSGVHAL 
Sbjct: 1   MTRYKATISYDGYAFAGFQRQPHARSVQEEIEKTLTRLNKEQAITVHGAGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL  +     L  AL+   +  + I ++++ +V   FH R++   ++Y + +   
Sbjct: 61  QVIHFDLPYQMDEEKLRFALDT--QSPEDIDVISIELVADDFHCRYTKHSKTYEFIVDRG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHF--DV 177
           +    + +  A   P  LD E MR A + L G HDFT F +        +RTI      V
Sbjct: 119 RPKNPMRRHYATHFPYPLDVERMREAIKKLEGTHDFTGFTASGTSVEDKVRTITEASLTV 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +  G  +        FL+ QIR+ VG+L  +G+ +     ++  L+ +DR+  GP A P 
Sbjct: 179 DETGQFLTFTFSGNGFLYKQIRNMVGTLLKIGNNRMPVEQIDLILEKKDRQLAGPTAAPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|312144215|ref|YP_003995661.1| tRNA pseudouridine synthase A [Halanaerobium sp. 'sapolanicus']
 gi|311904866|gb|ADQ15307.1| tRNA pseudouridine synthase A [Halanaerobium sp. 'sapolanicus']
          Length = 248

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 122/246 (49%), Gaps = 4/246 (1%)

Query: 3   RYCMIIEYNGSGYFGWQRQKNGS-SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            Y + +EY+GS Y GWQRQKN   +IQ  +E A+  +    V V G+GRTD+GVHA  Q 
Sbjct: 4   NYKITLEYDGSNYSGWQRQKNTKETIQEKLENALSKINKNKVEVIGSGRTDAGVHAAGQT 63

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A+F L  +     +  A+N +L   D I       V K FHAR+ A  + Y YRI+    
Sbjct: 64  ANFFLDIQIPTYKIPIAINTHL--PDDIICYKAEKVAKDFHARYDARGKKYRYRILNSNF 121

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVN-SF 180
                +   + + + LD + M+  A+  +G HDF  F S      S IR I  FD+N   
Sbjct: 122 NSVFVRNYVYKVHQRLDLDIMQKGAKIFLGSHDFAAFCSAGSSVDSTIREIYSFDINSKT 181

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I+I +    FL+  +R  VG+L  +  GK    DLE+ L    R+  G  AP +GL 
Sbjct: 182 NGEIQIDISGSGFLYNMVRILVGTLIELAKGKRNLADLEEILAGTQRERAGFTAPAKGLT 241

Query: 241 FDSVEY 246
              V Y
Sbjct: 242 LLEVFY 247


>gi|311086513|gb|ADP66594.1| tRNA pseudouridine synthase A [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
          Length = 266

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 139/243 (57%), Gaps = 2/243 (0%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
           + + +EY+GS Y GWQRQK   SIQ  IEKA+ ++    + V  AGRTD+GVH++ QV H
Sbjct: 9   FALGVEYDGSYYHGWQRQKIVPSIQEEIEKALSIIANHKIDVVCAGRTDAGVHSIGQVIH 68

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F              +N+YL  S+ IS++ +  V + FHAR+SAI RSY Y I       
Sbjct: 69  FKTTANRKKSSWSIGVNSYL--SENISVVWVKEVTENFHARYSAITRSYRYIIYNYSLRS 126

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
           A+ + +   I + L+ + M   AQ L+G HDFT+FR++ CQ+ SP R I   +V  F N 
Sbjct: 127 AIFQTKLNHIYRKLNVDKMHFEAQFLLGEHDFTSFRALGCQSHSPWRNITKLNVFRFHNW 186

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           + + + A SFLH  +R+ VGSL  VG  K     ++  L+ +DR   G  AP +GLY   
Sbjct: 187 VVVDITANSFLHHMVRNIVGSLIEVGISKKKEYWIKDLLEKKDRSHAGATAPAKGLYLVY 246

Query: 244 VEY 246
           VEY
Sbjct: 247 VEY 249


>gi|228905939|ref|ZP_04069836.1| tRNA pseudouridine synthase A [Bacillus thuringiensis IBL 200]
 gi|228853754|gb|EEM98514.1| tRNA pseudouridine synthase A [Bacillus thuringiensis IBL 200]
          Length = 252

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPKHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWNNALNTML--PDDIVIRRVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPNSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWEVNYN 251


>gi|168187780|ref|ZP_02622415.1| tRNA pseudouridine synthase A [Clostridium botulinum C str. Eklund]
 gi|169294335|gb|EDS76468.1| tRNA pseudouridine synthase A [Clostridium botulinum C str. Eklund]
          Length = 246

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 133/248 (53%), Gaps = 4/248 (1%)

Query: 1   MIR-YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M R   ++IEY+GS Y GWQ+QK+  ++Q  IE+AIF +T + + + G  RTD+GVHA  
Sbjct: 1   MKRNIKLVIEYDGSNYSGWQKQKHSMTVQQRIEEAIFDITKQNIEIIGCSRTDAGVHARN 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
            VA+F +     P     A+N+ L     I I     V   FHARF +  + Y+Y I+ R
Sbjct: 61  FVANFIIDSNIPPEKFKYAINSKL--PKDIVIKKSCEVPIDFHARFQSKGKKYVYTILNR 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLV-GRHDFTTFRSIHCQASSPIRTIDHFDVN 178
           + P  +++G  +   K LD + M+ A+++ +      + ++       S +RTI + DV 
Sbjct: 119 EEPPTIDRGVVYHFNKKLDVDLMKSASKYFIGSHEFDSFYKKAGSSVKSTLRTIYYCDVT 178

Query: 179 SFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
              ++I+I V+   FL+  +R   G+L  VG  +    D++  + A+DR+  G   PP+G
Sbjct: 179 KVDDIIKIIVIGEGFLYNMVRIMAGTLVEVGITRIKPEDIKTIILAKDRERAGRSLPPQG 238

Query: 239 LYFDSVEY 246
           L  + V Y
Sbjct: 239 LCLEEVLY 246


>gi|219681571|ref|YP_002467957.1| pseudouridylate synthase I [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682129|ref|YP_002468513.1| pseudouridylate synthase I [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471256|ref|ZP_05635255.1| tRNA pseudouridine synthase A [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|254789608|sp|B8D8Z8|TRUA_BUCA5 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|254789609|sp|B8D7A3|TRUA_BUCAT RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|219621862|gb|ACL30018.1| pseudouridylate synthase I [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624414|gb|ACL30569.1| pseudouridylate synthase I [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311085941|gb|ADP66023.1| tRNA pseudouridine synthase A [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311087094|gb|ADP67174.1| tRNA pseudouridine synthase A [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087644|gb|ADP67723.1| tRNA pseudouridine synthase A [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 266

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 139/243 (57%), Gaps = 2/243 (0%)

Query: 4   YCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQVAH 63
           + + +EY+GS Y GWQRQK   SIQ  IEKA+ ++    + V  AGRTD+GVH++ QV H
Sbjct: 9   FALGVEYDGSYYHGWQRQKIVPSIQEEIEKALSIIANHKIDVVCAGRTDAGVHSIGQVIH 68

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F              +N+YL  S+ IS++ +  V + FHAR+SAI RSY Y I       
Sbjct: 69  FKTTANRKKSSWSIGVNSYL--SENISVVWVKEVTENFHARYSAITRSYRYIIYNYSLRS 126

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
           A+ + +   I + L+ + M   AQ L+G HDFT+FR++ CQ+ SP R I   +V  F N 
Sbjct: 127 AIFQTKLNHIYRKLNVDKMHFEAQFLLGEHDFTSFRALGCQSHSPWRNITKLNVFRFHNW 186

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           + + + A SFLH  +R+ VGSL  VG  K     ++  L+ +DR   G  AP +GLY   
Sbjct: 187 VVVDITANSFLHHMVRNIVGSLIEVGISKKKEYWIKDLLEKKDRSHAGATAPAKGLYLVY 246

Query: 244 VEY 246
           VEY
Sbjct: 247 VEY 249


>gi|229009651|ref|ZP_04166877.1| tRNA pseudouridine synthase A [Bacillus mycoides DSM 2048]
 gi|229131150|ref|ZP_04260062.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-ST196]
 gi|229165130|ref|ZP_04292925.1| tRNA pseudouridine synthase A [Bacillus cereus AH621]
 gi|228618393|gb|EEK75423.1| tRNA pseudouridine synthase A [Bacillus cereus AH621]
 gi|228652363|gb|EEL08288.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-ST196]
 gi|228751673|gb|EEM01473.1| tRNA pseudouridine synthase A [Bacillus mycoides DSM 2048]
          Length = 252

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MERIKCTVAYDGIHFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIIIRQVEKKTEEFHARYGVEKKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|324989944|gb|EGC21886.1| tRNA pseudouridine synthase A [Streptococcus sanguinis SK353]
          Length = 249

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 84/249 (33%), Positives = 127/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY  II Y+G G+ G+QRQ +  S+Q  IEK +  +  G+ VV+HGAGRTDSGVHAL 
Sbjct: 1   MTRYKAIISYDGYGFAGFQRQPHARSVQEEIEKTLTRINKGQPVVIHGAGRTDSGVHALG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL  E     L  AL+   +  + I  +++  V   FH+R++   ++Y + +   
Sbjct: 61  QVLHFDLPDERDEEKLRFALDT--QTPEDIDFISVERVSDDFHSRYNKHSKTYEFLVDIG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID--HFDV 177
           +    + +  A   P  L+   +  A   L G HDFT F +        +RTI       
Sbjct: 119 RPKNPMMRHYATHYPYPLELRLIEEAIAQLEGTHDFTGFTASGTSVEDKVRTITDAKVRY 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           ++  N +        FL+ QIR+ VG+L  +G+ +     +++ L  +DR   GP A P 
Sbjct: 179 DAERNFLVFTFSGNGFLYKQIRNMVGTLLKIGNKRMPVEQIQRILAEKDRHLAGPTADPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|75764616|ref|ZP_00744060.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74487896|gb|EAO51668.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 264

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 18  MDRIKCTVAYDGMHFCGYQIQPKHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 77

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   ++ Y YR++  
Sbjct: 78  QVIHFDTPLSLEEWQWNNALNTML--PDDIVIRRVEKKTEEFHARYGVEKKEYRYRVLLS 135

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 136 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 195

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 196 QDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 255

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 256 YLWEVNYN 263


>gi|311070796|ref|YP_003975719.1| tRNA pseudouridine synthase A [Bacillus atrophaeus 1942]
 gi|310871313|gb|ADP34788.1| tRNA pseudouridine synthase A [Bacillus atrophaeus 1942]
          Length = 247

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 133/247 (53%), Gaps = 4/247 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG--EIVVVHGAGRTDSGVHALR 59
           ++    I Y+G  + G+Q Q    ++Q  +EKA+ ++    + V V  +GRTDSGVHA  
Sbjct: 1   MKMKCTISYDGHLFNGYQVQPGKRTVQAELEKALAILHKSEDKVPVISSGRTDSGVHAAG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALNA L     I++      D  FHARFSAI++ Y Y + T 
Sbjct: 61  QVIHFDTPLSIPAERWPYALNALL--PGDIAVKTAEHADDGFHARFSAIKKEYRYFVYTE 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P   ++  A+     L+ + MR A++HL+G HDFT+F S + +    +RTI   D   
Sbjct: 119 KHPDVFKRHYAYHFSYRLNVQKMREASEHLIGTHDFTSFCSANTEVRDKVRTIYELDWTD 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +++R+V   FL+  +R   G+L  VG GK+++ D++  L A+DR+  G  AP  GL
Sbjct: 179 TDDGLQMRIVGSGFLYNMVRIIAGTLLDVGTGKFSADDVKGMLDAKDREAAGRTAPGHGL 238

Query: 240 YFDSVEY 246
           Y   V Y
Sbjct: 239 YLWHVYY 245


>gi|116511297|ref|YP_808513.1| tRNA pseudouridine synthase A [Lactococcus lactis subsp. cremoris
           SK11]
 gi|123320604|sp|Q031N1|TRUA_LACLS RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|116106951|gb|ABJ72091.1| Pseudouridylate synthase [Lactococcus lactis subsp. cremoris SK11]
          Length = 253

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 122/248 (49%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTG-EIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G+ + G+Q Q N  ++Q  IEK +  +   E V++ G+GRTDSGVHA  
Sbjct: 1   MTRYKATIAYDGTDFAGFQSQTNQRTVQEEIEKVLSKLNSFEPVILQGSGRTDSGVHAFG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL  +   +   +      +    I++  + +V   +HAR+    ++Y Y +   
Sbjct: 61  QVIHFDLNGKARDLERLR-FGLDTQTPADIAVKKVELVPDDWHARYQKHEKTYEYYLENS 119

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
                  +         L+ E M+ A   LVG+HDFT F +        +RTI   ++  
Sbjct: 120 VTRSPFHRHSKAYFRYPLNFELMQGAMAKLVGQHDFTGFTASGSSVDDKVRTIYQAEIIQ 179

Query: 180 -FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEG 238
                 +       FL+ Q+R+ VG++  +G+ +   + ++K L +++R   GP A PEG
Sbjct: 180 LDKENFKFIFRGNGFLYKQVRNMVGTVIKIGNDRMPVSQIDKILTSKNRNFAGPTAAPEG 239

Query: 239 LYFDSVEY 246
           LY   V+Y
Sbjct: 240 LYLKEVKY 247


>gi|118444045|ref|YP_877232.1| tRNA pseudouridine synthase A [Clostridium novyi NT]
 gi|118134501|gb|ABK61545.1| tRNA pseudouridine synthase A [Clostridium novyi NT]
          Length = 246

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
               ++IEY+GS Y GWQ+QK+  +IQ  IE+AIF +T + + V+G  RTD+GVHA   V
Sbjct: 3   KNIKLVIEYDGSNYSGWQKQKHSMTIQQRIEEAIFDITKQKIEVNGCSRTDAGVHARNFV 62

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           A+F +     P     A+N+ L     I I N   V   FHARF +  + Y+Y I+ R+ 
Sbjct: 63  ANFIIDSSIPPEKFKYAMNSKL--PKDIVIKNSCEVPMDFHARFQSKGKKYVYTILNREE 120

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLV-GRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           P  +++G  +   K LD + MR A+++ +      + ++       S +RTI + DV   
Sbjct: 121 PPTIDRGVVYHFNKKLDVDLMRSASKYFIGSHEFDSFYKKAGSSVKSTLRTIYYCDVTKV 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            ++I+I V+   FL+  +R   G+L  VG  +    D++  + A+DR++ G   PP+GL 
Sbjct: 181 DDIIKIIVIGEGFLYNMVRIIAGTLVEVGIARIKPEDIKNIILAKDREKAGRSLPPQGLC 240

Query: 241 FDSVEY 246
            + V Y
Sbjct: 241 LEEVLY 246


>gi|77464142|ref|YP_353646.1| tRNA pseudouridine synthase A [Rhodobacter sphaeroides 2.4.1]
 gi|123591335|sp|Q3J0D9|TRUA_RHOS4 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|77388560|gb|ABA79745.1| tRNA pseudouridine synthase [Rhodobacter sphaeroides 2.4.1]
          Length = 255

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 123/250 (49%), Positives = 163/250 (65%), Gaps = 5/250 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + IEY+G  + GWQRQ   +S+QG+IE A+  +      +  AGRTD+GVHA  Q
Sbjct: 1   MPRYALRIEYDGGPFAGWQRQAAQASVQGAIETALGRLEPGPHTIAAAGRTDTGVHASGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAH DLVREW P  L  ALNA+LK    ++I+  + V ++FHARFSA+ R YL+R++ R+
Sbjct: 61  VAHCDLVREWDPFRLAGALNAHLK-PLPVAIVAAARVPEEFHARFSAVERRYLFRLLARR 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTID----HFD 176
           AP   ++GR W +P  LD E MR  A HLVGRHDFTTFR+  CQA+SP++T+D       
Sbjct: 120 APEVHDRGRVWRVPHPLDPEAMRAGAAHLVGRHDFTTFRAAGCQAASPVKTLDALTLETV 179

Query: 177 VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPP 236
               G      + ARSFLH Q+RS VG+L+ VG G WT   + +AL A+DR  CGP++PP
Sbjct: 180 EGMNGTEYRFHLRARSFLHNQVRSIVGTLERVGAGAWTPDQVREALDARDRAACGPVSPP 239

Query: 237 EGLYFDSVEY 246
           +GLY   V Y
Sbjct: 240 QGLYLTGVGY 249


>gi|89890586|ref|ZP_01202096.1| tRNA pseudouridine synthase A [Flavobacteria bacterium BBFL7]
 gi|89517501|gb|EAS20158.1| tRNA  pseudouridine synthase A [Flavobacteria bacterium BBFL7]
          Length = 251

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 117/245 (47%), Gaps = 4/245 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
            RY + + Y+G+ Y GWQRQ    ++Q  +E+ +  +  E + V GAGRTD+GVHA   V
Sbjct: 5   KRYFIELAYDGTAYHGWQRQPQSITVQEVLEEGLHKMLREQIKVQGAGRTDAGVHAAYMV 64

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
           AHFD         L   LN +L     I++  +  V    HARF A +RSY Y       
Sbjct: 65  AHFDYSGAIDLDHLVYRLNRWL--PKDIAVYEVKPVVNNAHARFHAYKRSYEYHF--LLR 120

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
           P   +  +A+++ +  D + M+ AA  L    DF  F   +    + +  +         
Sbjct: 121 PDPFQVMQAYVLFRKPDFKLMQEAAAILPEYKDFECFSRSNTDVKTYVCDLTEAYFEFKD 180

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + +   + A  FL   +R+ VG+L  +G GK T  DL + + ++DR   G  AP  GL+ 
Sbjct: 181 HKVIFHITANRFLRNMVRAVVGTLLDIGYGKKTIEDLREIIASKDRSNAGASAPAGGLFL 240

Query: 242 DSVEY 246
             + Y
Sbjct: 241 TKIHY 245


>gi|315022484|gb|EFT35511.1| tRNA pseudouridine synthase A [Riemerella anatipestifer RA-YM]
 gi|325335444|gb|ADZ11718.1| Pseudouridylate synthase [Riemerella anatipestifer RA-GD]
          Length = 246

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 125/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+RYC+   YNG  YFG+Q Q    S+Q ++E+A+  +  E +   GAGRTD+GVHA + 
Sbjct: 1   MLRYCIEFSYNGEKYFGYQIQPKQISVQETLEQALSTILREEIKTTGAGRTDTGVHAKKM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            AHFD        +L K LN++L     IS+  L  V   FHARF A  R+Y Y I   +
Sbjct: 61  FAHFDTDLILEEELLPKRLNSFL--PPDISVKRLFRVSSDFHARFDATYRTYEYYISLEK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P   +        + L+ E M  A + L    DFT+F  ++    + +  I        
Sbjct: 119 NPFT-QNSAWGYWRRPLNLEAMNEACKILFEYTDFTSFSKLNTDTKTNLCEIYKAFWVQE 177

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  ++  + A  FL   +R+ VG++  +G GK    DL K ++A++R   G  AP +GL+
Sbjct: 178 GAELKFTISANRFLRNMVRAIVGTMVDIGSGKIAPQDLRKVIEAKERNAAGTSAPAQGLF 237

Query: 241 FDSVEYS 247
              V Y+
Sbjct: 238 LVDVGYN 244


>gi|148263121|ref|YP_001229827.1| tRNA pseudouridine synthase A [Geobacter uraniireducens Rf4]
 gi|189030134|sp|A5GB00|TRUA_GEOUR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|146396621|gb|ABQ25254.1| tRNA pseudouridine synthase A [Geobacter uraniireducens Rf4]
          Length = 244

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 121/246 (49%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M +  +IIEY+G+ Y GWQ Q NG +IQ  IE ++  + GE V +H +GRTD+GVHAL  
Sbjct: 1   MRQIKLIIEYDGTNYSGWQVQPNGITIQQLIEASLATMLGEPVKLHSSGRTDAGVHALGM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA F   +          LNA L   + I+I +       F+ R  A  + Y Y I    
Sbjct: 61  VAAFKTGKLLPLRAFSDGLNALL--PNDIAIRDAVEAPLSFNPRADAKSKHYRYTIYNAV 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               L +  +W +  +LD E M+ AA H VG HDF  FR+ +C A + +R +    V   
Sbjct: 119 RRSPLARLSSWHLRGALDIERMQAAASHFVGEHDFAAFRASNCAAKTTVRRLFSVSVAKD 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  + I V    FL   +R   G+L  VG GK     +   L + DR   G  APP+GL 
Sbjct: 179 GESVIIDVHGSGFLKNMVRIIAGTLAEVGQGKKNPDAVPGLLVSGDRAASGITAPPQGLC 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LVEVFY 244


>gi|42779223|ref|NP_976470.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 10987]
 gi|51316699|sp|Q73F64|TRUA1_BACC1 RecName: Full=tRNA pseudouridine synthase A 1; AltName: Full=tRNA
           pseudouridylate synthase I 1; AltName: Full=tRNA-uridine
           isomerase I 1
 gi|42735138|gb|AAS39078.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 10987]
          Length = 247

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 120/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 1   MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 61  QVIHFDTPLSLEEWQWNNALNTML--PDDIVITQVEKKTEEFHARYGVERKEYRYRVLLS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+   +R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 119 KTADVFRRNYVYQYPYPLEINAIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 179 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 238

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 239 YLWQVNYN 246


>gi|313207118|ref|YP_004046295.1| tRNA pseudouridine synthase a [Riemerella anatipestifer DSM 15868]
 gi|312446434|gb|ADQ82789.1| tRNA pseudouridine synthase A [Riemerella anatipestifer DSM 15868]
          Length = 246

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 83/247 (33%), Positives = 124/247 (50%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RYC+   YNG  YFG+Q Q    S+Q ++E+A+  +  E +   GAGRTD+GVHA + 
Sbjct: 1   MSRYCIEFSYNGEKYFGYQIQPKQISVQETLEQALSTILREEIKTTGAGRTDTGVHAKKM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
            AHFD        +L K LN++L     IS+  L  V   FHARF A  R+Y Y I   +
Sbjct: 61  FAHFDTDLILEEELLPKRLNSFL--PPDISVKRLFRVSSDFHARFDATYRTYEYYISLEK 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P   +        + L+ E M  A + L    DFT+F  ++    + +  I        
Sbjct: 119 NPFT-QNSAWGYWRRPLNLEAMNEACKILFEYTDFTSFSKLNTDTKTNLCEIYKAFWVQE 177

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G  ++  + A  FL   +R+ VG++  +G GK    DL K ++A++R   G  AP +GL+
Sbjct: 178 GTELKFTISANRFLRNMVRAIVGTMVDIGSGKIAPQDLRKVIEAKERNAAGTSAPAQGLF 237

Query: 241 FDSVEYS 247
              V Y+
Sbjct: 238 LVDVGYN 244


>gi|260662783|ref|ZP_05863677.1| tRNA pseudouridine synthase A [Lactobacillus fermentum 28-3-CHN]
 gi|260552864|gb|EEX25863.1| tRNA pseudouridine synthase A [Lactobacillus fermentum 28-3-CHN]
          Length = 258

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 131/251 (52%), Gaps = 7/251 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGE---IVVVHGAGRTDSGVHA 57
           M RY +   Y+GS + G+Q Q    ++Q ++E+A+  +  +    ++V G+GRTD+GVHA
Sbjct: 1   MHRYKITFAYDGSNFAGFQVQPGERTVQQALERAVNKIAKKPQPPLMVFGSGRTDAGVHA 60

Query: 58  LRQVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRII 117
           L QVAHFDL  +     L +ALN+ L     + +   + V   FHARF A  + Y YR++
Sbjct: 61  LGQVAHFDLPYQIPGPSLVRALNSSL--PLDVLVKEATEVAPDFHARFDAHHKRYRYRVV 118

Query: 118 TRQAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD- 176
             +     ++         +D E M+ AAQ  VG HDFT+F +   QA+S +R ID    
Sbjct: 119 GGEFTNPFKRNYTGHYKYPVDVERMQTAAQDFVGEHDFTSFVASGSQATSNVRRIDEVTV 178

Query: 177 -VNSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAP 235
             +   + +    V   FL+ Q+R  V  L  +G+G+    D+ + ++A++R      AP
Sbjct: 179 VRDEENDEVVFDFVGNGFLYNQVRIMVAFLLEIGNGRRPVDDVMRVMKAKNRDLARGTAP 238

Query: 236 PEGLYFDSVEY 246
             GLY   V Y
Sbjct: 239 ASGLYLVEVTY 249


>gi|42520874|ref|NP_966789.1| tRNA pseudouridine synthase A [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|51316700|sp|Q73G93|TRUA_WOLPM RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|42410614|gb|AAS14723.1| tRNA pseudouridine synthase A [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 245

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 117/246 (47%), Positives = 157/246 (63%), Gaps = 2/246 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKN-GSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           +RY + +EYNGS + GWQ+Q++  +SIQ  IE AIF  +GE V ++  GRTD+GVHAL Q
Sbjct: 1   MRYKITVEYNGSNFSGWQKQQHSANSIQEKIENAIFNFSGEKVTLYCGGRTDAGVHALGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD+ +E+    +  A+N +LK S  I +LN  +VD  FHARFSA +R Y YRI+ R 
Sbjct: 61  VAHFDMEKEFELYRIRNAINYHLK-SIPIVVLNAEVVDDAFHARFSAKKRYYEYRIVNRY 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           AP ALE G  W +   LD   MR AA+HL+G+HD ++FRS  CQA++PIRTID  D+   
Sbjct: 120 APAALETGYVWQVFSPLDVNIMREAAKHLLGKHDLSSFRSKDCQAANPIRTIDDIDIIQN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GN I I++ A SFLH Q+R  VG+L   G  +    ++   L    R   G  APP GLY
Sbjct: 180 GNHIHIKISAISFLHNQVRIIVGTLVEFGKNRTNPQEMLNILNQCKRSAAGVTAPPFGLY 239

Query: 241 FDSVEY 246
              ++Y
Sbjct: 240 LVKIDY 245


>gi|91204875|ref|YP_537230.1| tRNA pseudouridine synthase A [Rickettsia bellii RML369-C]
 gi|157826493|ref|YP_001495557.1| tRNA pseudouridine synthase A [Rickettsia bellii OSU 85-389]
 gi|123266250|sp|Q1RKH3|TRUA_RICBR RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|166228758|sp|A8GUM4|TRUA_RICB8 RecName: Full=tRNA pseudouridine synthase A; AltName: Full=tRNA
           pseudouridylate synthase I; AltName: Full=tRNA-uridine
           isomerase I
 gi|91068419|gb|ABE04141.1| tRNA pseudouridine synthase A [Rickettsia bellii RML369-C]
 gi|157801797|gb|ABV78520.1| tRNA pseudouridine synthase A [Rickettsia bellii OSU 85-389]
          Length = 245

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 103/246 (41%), Positives = 152/246 (61%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + +EY G+   GWQRQ    S+Q  +E+AI+  +GE V + G+GRTD+GVHA+ Q
Sbjct: 1   MYRYKISVEYLGTNLAGWQRQSGVMSVQQILEEAIYKFSGEQVTLFGSGRTDAGVHAIGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           +AHFDL + + P  + +A+N +      + + N  +VD  FHARFSAI R Y+YRI+ R 
Sbjct: 61  IAHFDLSKYFEPYKIIRAINYF-TRPYIVGVCNCELVDNNFHARFSAIARHYVYRILNRP 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
            P  ++  R W I   LD   M+ ++ +L+G+H+FT+FR+  CQ+ SPI+T+   D+   
Sbjct: 120 YPSVIDFDRVWWISVPLDVSAMQKSSLYLLGKHNFTSFRASSCQSKSPIKTLTKLDIIKE 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
              I++   A SFLH  +R+ VGSL LVG   W +  +++ L+  DRK  GP AP  GLY
Sbjct: 180 NEEIKLYFSAPSFLHHMVRNIVGSLVLVGKNIWQAEQMQQVLEVADRKAAGPTAPACGLY 239

Query: 241 FDSVEY 246
           F   +Y
Sbjct: 240 FIKADY 245


>gi|164688053|ref|ZP_02212081.1| hypothetical protein CLOBAR_01698 [Clostridium bartlettii DSM
           16795]
 gi|164602466|gb|EDQ95931.1| hypothetical protein CLOBAR_01698 [Clostridium bartlettii DSM
           16795]
          Length = 245

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 86/247 (34%), Positives = 130/247 (52%), Gaps = 3/247 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQK-NGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALR 59
           M    M++EY+GS + G+Q+ K N ++IQG +E  +  +  E + + G+GRTD GVHA  
Sbjct: 1   MRNIKMVVEYDGSNFKGFQKLKDNENTIQGKLESVLSQMADENIEIIGSGRTDMGVHAYG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV +F          + K L  YL  S  I    +  VD +FH+R++A R+ YLY+I   
Sbjct: 61  QVVNFKTNSPLSLNKMHKYLYEYLPQSIAIR--EIEEVDDRFHSRYNAKRKVYLYKIDNN 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           + P    +     +PK +D + MR  A  LVG HDFT+F S   +  S +R I    +N 
Sbjct: 119 EYPNPFNRKYTCHVPKKIDLDKMRAVADVLVGEHDFTSFCSSRSKKKSHVREIYSISINE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
              LIEI V    FL+  +R   G+L   G  K T  +++  L+ +DR +    AP +GL
Sbjct: 179 NNGLIEIYVEGNGFLYNMVRIIAGTLIDAGHNKITPEEVKNLLELKDRSKSPETAPSKGL 238

Query: 240 YFDSVEY 246
           +   V+Y
Sbjct: 239 FLYRVKY 245


>gi|222093912|ref|YP_002527962.1| tRNA pseudouridine synthase a [Bacillus cereus Q1]
 gi|221237960|gb|ACM10670.1| tRNA pseudouridine synthase A [Bacillus cereus Q1]
          Length = 247

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 120/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 1   MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 61  QVIHFDTPLSLEEWQWSNALNTML--PDDIVITQVEKKTEEFHARYGVERKEYRYRVLLS 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+   +R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 119 KTADVFRRNYVYQYPYPLEINAIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 178

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 179 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 238

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 239 YLWQVNYN 246


>gi|294141648|ref|YP_003557626.1| tRNA pseudouridine synthase A [Shewanella violacea DSS12]
 gi|293328117|dbj|BAJ02848.1| tRNA pseudouridine synthase A [Shewanella violacea DSS12]
          Length = 275

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 92/245 (37%), Positives = 129/245 (52%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + IEY+GS Y+GWQRQ    ++Q  +E+A+  V  + + VH AGRTD+GVH   QV
Sbjct: 15  MRVALGIEYDGSKYYGWQRQLEVDTVQAQLERALSKVANQPITVHCAGRTDAGVHGTGQV 74

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HF+             +N  L   D I++  + +VD  FHARFSA  R Y Y I     
Sbjct: 75  VHFETTAIRKESAWTLGVNVNL--PDDIAVKWVKLVDDDFHARFSATARRYRYLIYNYHL 132

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              + +         LD   M  AAQH VG HDFT+FR++HCQ+ SP R +   +V   G
Sbjct: 133 RPGILRSGVSHYRGQLDENKMHQAAQHFVGEHDFTSFRALHCQSKSPFRHVHEVNVTRQG 192

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
             + + + A +FLH  +R+ VGSL  +G G      + + L  +DR +  P A P GLY 
Sbjct: 193 MYLCVDIKANAFLHHMVRNIVGSLIEIGQGHQQGDWIVELLALKDRSKAAPTAKPNGLYM 252

Query: 242 DSVEY 246
             V Y
Sbjct: 253 VDVTY 257


>gi|229194532|ref|ZP_04321335.1| tRNA pseudouridine synthase A [Bacillus cereus m1293]
 gi|228588998|gb|EEK47013.1| tRNA pseudouridine synthase A [Bacillus cereus m1293]
 gi|324324133|gb|ADY19393.1| tRNA pseudouridine synthase A [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 252

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 120/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVITQVEKKTEEFHARYGVERKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+   +R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINAIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|206562845|ref|YP_002233608.1| tRNA pseudouridine synthase A [Burkholderia cenocepacia J2315]
 gi|198038885|emb|CAR54847.1| tRNA pseudouridine synthase A [Burkholderia cenocepacia J2315]
          Length = 271

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 130/246 (52%), Gaps = 2/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M+R  + I+Y+G+ + GWQ Q +G ++Q  +E A+       +    AGRTD+GVH L Q
Sbjct: 1   MMRIALGIQYDGAAFCGWQAQPHGKTVQDRLEHALAEFARVPLHTTVAGRTDTGVHGLGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   E       +  NA+L    T+S+     +   FHARFSA  R+Y Y +    
Sbjct: 61  VVHFDTELEREVFSWVRGTNAFL--PPTVSVQWAKPMPDTFHARFSAFERTYYYALYVHP 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
               +  GRA  I   LD + MR AA +L+G HDF++FRS  CQ+ +P++ +   DV   
Sbjct: 119 VRSPMLAGRAGWIHTPLDDDAMRAAAAYLIGEHDFSSFRSSECQSKTPVKHLYQIDVRRA 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           G+ I  R  A +FLH  +R+ +G L  VG G++ +  L   L  +DR    P    +GLY
Sbjct: 179 GHFIHFRFRANAFLHHMVRNLMGCLVAVGRGRYPADWLADVLAGRDRNLAAPTFMADGLY 238

Query: 241 FDSVEY 246
              V Y
Sbjct: 239 LAHVGY 244


>gi|167840379|ref|ZP_02467063.1| tRNA pseudouridine synthase A [Burkholderia thailandensis MSMB43]
          Length = 270

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 131/245 (53%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + I+Y+G+ + GWQ Q +G ++Q S+E A+       +    AGRTD+GVH L QV
Sbjct: 1   MRIALGIQYDGAAFCGWQSQPHGKTVQDSLEAALAEFAQTSLHTTVAGRTDTGVHGLGQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD   +       +  NA+L    TI++     +   FHARF+A  R+Y Y +     
Sbjct: 61  VHFDTDLDRADFSWVRGTNAFL--PSTIAVQWAKPMPDTFHARFAAYERTYYYALYVHPV 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +  GR   +   LD + MR AA HLVG HDF+ FRS  CQA SP++ +    +   G
Sbjct: 119 RSPMLAGRTGWVHTPLDIDAMREAAGHLVGEHDFSAFRSSECQAKSPVKHLYQIGIRPDG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I  R  A +FLH  +R+ +G L  VG G++ ++ L   L+++DR    P   PEGLY 
Sbjct: 179 DFIHFRFRASAFLHHMVRNLMGCLVAVGRGRYPASWLADVLESRDRDCAAPTFMPEGLYL 238

Query: 242 DSVEY 246
             V Y
Sbjct: 239 AHVGY 243


>gi|329121886|ref|ZP_08250501.1| tRNA pseudouridine synthase A [Dialister micraerophilus DSM 19965]
 gi|327467824|gb|EGF13316.1| tRNA pseudouridine synthase A [Dialister micraerophilus DSM 19965]
          Length = 244

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 133/246 (54%), Gaps = 3/246 (1%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGS-SIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           + Y MIIEY+G+ Y GWQ+QK+   ++QG IEKA   VTGE V + GAGRTDSGVHA  Q
Sbjct: 1   MNYKMIIEYDGTRYEGWQKQKHSDETLQGKIEKAFEKVTGENVQIIGAGRTDSGVHAKGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VA+  L  +     L   LN  L   D I I     V+++FH+RF A  + Y Y +    
Sbjct: 61  VANVHLPYDLNAENLKNELNEIL--PDDIYIKQCIEVEEKFHSRFHAKSKIYEYNLRIGS 118

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
                +K   W   K L  E M+ AA+ L G HDFT F +      S +RT+   ++++ 
Sbjct: 119 NKDVFQKRFIWQFAKPLCIEKMKRAAEILQGTHDFTAFCNNKHFKKSAVRTVYSIEISTS 178

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            +++ +R     FL   IR  VG+L  VG+ K  +  L   L+++ R   G  APP+GL 
Sbjct: 179 NDILHLRFCGDGFLQGMIRIMVGTLVEVGENKRDADSLYDVLKSKQRSNAGFTAPPQGLT 238

Query: 241 FDSVEY 246
             SV+Y
Sbjct: 239 LISVQY 244


>gi|262277956|ref|ZP_06055749.1| tRNA pseudouridine synthase A [alpha proteobacterium HIMB114]
 gi|262225059|gb|EEY75518.1| tRNA pseudouridine synthase A [alpha proteobacterium HIMB114]
          Length = 245

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 96/246 (39%), Positives = 148/246 (60%), Gaps = 1/246 (0%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY  ++EYNG+ + GWQ Q +G+++Q  IEK+   +      + G+GRTDSGVHA  Q
Sbjct: 1   MHRYKAVVEYNGTDFEGWQSQPSGNTVQQIIEKSFLEIQLNKTKIFGSGRTDSGVHATGQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           V HFD   +     +   LN +LK  +   +      +  F +R  A  R+Y Y+I+ R 
Sbjct: 61  VFHFDYEDKLDCKKILLGLNHFLKKKNISVLSLDF-TNNNFDSRRDAKLRTYTYKILNRI 119

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           A   + + + W + K+LD + M+ A+Q  +G HDFTTFR+  C+A+SPIR I + ++   
Sbjct: 120 ASPVILENQVWHVIKNLDFKLMQKASQIFLGSHDFTTFRASSCEATSPIREIIYSELKKN 179

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
            + I   V +RSFL  Q+RS VG++K VG+ KW+  DL++AL++++R  C   AP  GLY
Sbjct: 180 NDQIIYIVKSRSFLQHQVRSMVGAIKFVGEKKWSLKDLDEALKSKNRNNCATPAPACGLY 239

Query: 241 FDSVEY 246
            ++VEY
Sbjct: 240 LENVEY 245


>gi|229094864|ref|ZP_04225869.1| tRNA pseudouridine synthase A [Bacillus cereus Rock3-29]
 gi|229100941|ref|ZP_04231745.1| tRNA pseudouridine synthase A [Bacillus cereus Rock3-28]
 gi|229113818|ref|ZP_04243253.1| tRNA pseudouridine synthase A [Bacillus cereus Rock1-3]
 gi|228669689|gb|EEL25096.1| tRNA pseudouridine synthase A [Bacillus cereus Rock1-3]
 gi|228682520|gb|EEL36593.1| tRNA pseudouridine synthase A [Bacillus cereus Rock3-28]
 gi|228688607|gb|EEL42480.1| tRNA pseudouridine synthase A [Bacillus cereus Rock3-29]
          Length = 252

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MERIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVIRQVEKKTEEFHARYGVERKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIFEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|206978041|ref|ZP_03238926.1| tRNA pseudouridine synthase A [Bacillus cereus H3081.97]
 gi|217957717|ref|YP_002336261.1| tRNA pseudouridine synthase A [Bacillus cereus AH187]
 gi|229136988|ref|ZP_04265615.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-ST26]
 gi|206743754|gb|EDZ55176.1| tRNA pseudouridine synthase A [Bacillus cereus H3081.97]
 gi|217063029|gb|ACJ77279.1| tRNA pseudouridine synthase A [Bacillus cereus AH187]
 gi|228646526|gb|EEL02733.1| tRNA pseudouridine synthase A [Bacillus cereus BDRD-ST26]
          Length = 252

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 120/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE++ V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHKGELIRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVITQVEKKTEEFHARYGVERKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+   +R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINAIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  VG GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|85713087|ref|ZP_01044122.1| tRNA pseudouridine synthase A [Idiomarina baltica OS145]
 gi|85693073|gb|EAQ31036.1| tRNA pseudouridine synthase A [Idiomarina baltica OS145]
          Length = 261

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 86/245 (35%), Positives = 127/245 (51%), Gaps = 2/245 (0%)

Query: 2   IRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQV 61
           +R  + +EY+G  Y+GWQRQ+   S+Q  +E A+  V  + V    AGRTD+GVHA  QV
Sbjct: 1   MRIALGLEYDGRAYYGWQRQREVDSVQQRLENALSKVADQAVETVCAGRTDAGVHATNQV 60

Query: 62  AHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQA 121
            HFD+  +         +N++L     I++     VD  F ARFSA  R Y Y I     
Sbjct: 61  VHFDVSTQRRAAAWTLGVNSHL--PPDIAVRWAQPVDDSFSARFSATARRYRYIIANHAL 118

Query: 122 PLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFG 181
              +           LD + M+ A   L+G HDF+ FR+  CQ+ S  R I H +V+  G
Sbjct: 119 RPGIHSHGVSHYHHPLDVDAMQAATPALLGEHDFSAFRAAQCQSHSAHREITHLNVHRRG 178

Query: 182 NLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYF 241
           + I + + A +FLH  +R+ VGSL ++G  +   + L + L  +DR +    A P GLY 
Sbjct: 179 DFIIVDIKANAFLHHMVRNIVGSLIVIGRHQQDPSWLGELLAGKDRTKAAATAKPGGLYL 238

Query: 242 DSVEY 246
             V+Y
Sbjct: 239 VEVDY 243


>gi|298482201|ref|ZP_07000389.1| tRNA pseudouridine synthase A [Bacteroides sp. D22]
 gi|298271758|gb|EFI13331.1| tRNA pseudouridine synthase A [Bacteroides sp. D22]
          Length = 249

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 119/247 (48%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  + KA+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMKALSTFLRREIEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD       + +   LN  L     ISI  +  V    HARF A  R+Y Y + T  
Sbjct: 61  VAHFDFDEPLDEISVADKLNRLL--PPDISIYRVCRVRPDAHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +     +   W +   LD   M  AA+ L    DFT+F  +H    + I  I H +    
Sbjct: 117 SKYPFNRQYRWRVYNQLDYALMNEAARTLFEYTDFTSFSKLHTDVKTNICHITHAEWTQE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK T     + ++ QDR + G  AP + L
Sbjct: 177 DDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLTVEGFRRVIEQQDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|293364991|ref|ZP_06611708.1| tRNA pseudouridine synthase A [Streptococcus oralis ATCC 35037]
 gi|307703239|ref|ZP_07640185.1| tRNA pseudouridine synthase A [Streptococcus oralis ATCC 35037]
 gi|291316441|gb|EFE56877.1| tRNA pseudouridine synthase A [Streptococcus oralis ATCC 35037]
 gi|307623314|gb|EFO02305.1| tRNA pseudouridine synthase A [Streptococcus oralis ATCC 35037]
          Length = 249

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 85/249 (34%), Positives = 129/249 (51%), Gaps = 5/249 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M RY   I Y+G  + G+QRQ +  S+Q  IEK +  +  G+ + VHGAGRTDSGVHAL 
Sbjct: 1   MTRYKATISYDGFAFAGFQRQPHARSVQEEIEKTLTRLNKGQAIAVHGAGRTDSGVHALE 60

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFDL  +     L  AL+   +  + I ++++ IV   FH R++   ++Y + +   
Sbjct: 61  QVIHFDLPYQMDEEKLRFALDT--QSPEDIDVISIEIVADDFHCRYAKHSKTYEFIVDRG 118

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFD--V 177
           +    + +  A   P  LD E M+ A + L G HDFT F +        +RTI      V
Sbjct: 119 RPKNPMRRHYATHFPYPLDVERMQEAVKKLEGTHDFTGFTASGTSVEDKVRTITEASLSV 178

Query: 178 NSFGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPE 237
           +  G  +        FL+ QIR+ VG+L  +G+ +     ++  L+ +DR+  GP A P 
Sbjct: 179 DETGQFLTFTFSGNGFLYKQIRNMVGTLLKIGNNRMPVEQIDLILEKKDRQLAGPTAAPN 238

Query: 238 GLYFDSVEY 246
           GLY   + Y
Sbjct: 239 GLYLKEIRY 247


>gi|237715548|ref|ZP_04546029.1| tRNA pseudouridine synthase A [Bacteroides sp. D1]
 gi|262408556|ref|ZP_06085102.1| tRNA pseudouridine synthase A [Bacteroides sp. 2_1_22]
 gi|294643196|ref|ZP_06721024.1| tRNA pseudouridine synthase A [Bacteroides ovatus SD CC 2a]
 gi|294809320|ref|ZP_06768031.1| tRNA pseudouridine synthase A [Bacteroides xylanisolvens SD CC 1b]
 gi|229444257|gb|EEO50048.1| tRNA pseudouridine synthase A [Bacteroides sp. D1]
 gi|262353421|gb|EEZ02515.1| tRNA pseudouridine synthase A [Bacteroides sp. 2_1_22]
 gi|292641462|gb|EFF59652.1| tRNA pseudouridine synthase A [Bacteroides ovatus SD CC 2a]
 gi|294443478|gb|EFG12234.1| tRNA pseudouridine synthase A [Bacteroides xylanisolvens SD CC 1b]
          Length = 249

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 85/247 (34%), Positives = 120/247 (48%), Gaps = 5/247 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           M RY + + Y+G+ Y GWQ Q NG S+Q  + KA+       + V GAGRTD+GVHA   
Sbjct: 1   MQRYFIYLAYDGTNYHGWQIQPNGISVQECLMKALSTFLRREIEVIGAGRTDAGVHASLM 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFD       V +   LN  L     IS+  +  V+   HARF A  R+Y Y + T  
Sbjct: 61  VAHFDFDELLDEVSVADKLNRLL--PPDISVYRVCRVNPDAHARFDATARTYKYYVTT-- 116

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           +     +   W +   LD   M  AA+ L    DFT+F  +H    + I  I H +    
Sbjct: 117 SKYPFNRQYRWRVYNQLDYALMNEAARTLFEYTDFTSFSKLHTDVKTNICHITHAEWTQE 176

Query: 181 GN-LIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
            +      + A  FL   +R+ VG+L  VG GK T     + ++ QDR + G  AP + L
Sbjct: 177 DDATWVFTIRADRFLRNMVRAIVGTLIEVGRGKLTVEGFRRVIEQQDRCKAGTSAPGQAL 236

Query: 240 YFDSVEY 246
           +  +VEY
Sbjct: 237 FLVNVEY 243


>gi|229153920|ref|ZP_04282050.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 4342]
 gi|228629601|gb|EEK86298.1| tRNA pseudouridine synthase A [Bacillus cereus ATCC 4342]
          Length = 252

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 3/248 (1%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVT-GEIVVVHGAGRTDSGVHALR 59
           M R    + Y+G  + G+Q Q    ++Q  IEKA+  +  GE+V V  +GRTDS VHA  
Sbjct: 6   MDRIKCTVAYDGIHFCGYQIQPQHRTVQQEIEKALQKLHKGELVRVQASGRTDSTVHAKG 65

Query: 60  QVAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITR 119
           QV HFD            ALN  L   D I I  +    ++FHAR+   R+ Y YR++  
Sbjct: 66  QVIHFDTPLSLEEWQWSNALNTML--PDDIVITQVEKKTEEFHARYGVERKEYRYRVLLS 123

Query: 120 QAPLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNS 179
           +      +   +  P  L+  ++R A  + +G HDFT+F S        +RTI   ++  
Sbjct: 124 KTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFCSAKTDKKDKVRTIYEIELIE 183

Query: 180 FGNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGL 239
             + +  R V   FL+  +R  VG+L  +G GK     + + L  Q+R+  G +AP  GL
Sbjct: 184 QDDELIFRFVGNGFLYNMVRIIVGTLLSIGQGKLDPDSIPEILAKQNRQFAGKMAPGHGL 243

Query: 240 YFDSVEYS 247
           Y   V Y+
Sbjct: 244 YLWQVNYN 251


>gi|332827815|gb|EGK00550.1| tRNA pseudouridine synthase A [Dysgonomonas gadei ATCC BAA-286]
          Length = 254

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 121/248 (48%), Gaps = 5/248 (2%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLV