BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780295|ref|YP_003064708.1| tRNA pseudouridine synthase A
[Candidatus Liberibacter asiaticus str. psy62]
         (247 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780295|ref|YP_003064708.1| tRNA pseudouridine synthase A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 247

 Score =  512 bits (1319), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 247/247 (100%), Positives = 247/247 (100%)

Query: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60
           MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ
Sbjct: 1   MIRYCMIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTDSGVHALRQ 60

Query: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120
           VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ
Sbjct: 61  VAHFDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQ 120

Query: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180
           APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF
Sbjct: 121 APLALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSF 180

Query: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240
           GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY
Sbjct: 181 GNLIEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLY 240

Query: 241 FDSVEYS 247
           FDSVEYS
Sbjct: 241 FDSVEYS 247


>gi|254780745|ref|YP_003065158.1| OstA family protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 181

 Score = 25.0 bits (53), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 6   MIIEYNGSGYFGWQRQKNGSSIQGSIEKAIFLVTGEIVVVHGAGRTD 52
           M I+YN +      R  +    +  +E+ IF+ +GEI V+   G  D
Sbjct: 81  MTIDYNNTN-----RDVSNKINRMDVERNIFIQSGEINVIASNGYVD 122


>gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 963

 Score = 22.3 bits (46), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 25  SSIQGSIEKAIFLVTGEIVVVHGAGRTDS 53
           S+I+G    A   +T +I +VH  G TD+
Sbjct: 877 SNIEGE-NLAEICITSDITIVHSNGPTDA 904


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.325    0.138    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 156,074
Number of Sequences: 1233
Number of extensions: 6121
Number of successful extensions: 17
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 4
length of query: 247
length of database: 328,796
effective HSP length: 72
effective length of query: 175
effective length of database: 240,020
effective search space: 42003500
effective search space used: 42003500
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 37 (18.9 bits)