HHsearch alignment for GI: 254780297 and conserved domain: KOG3137

>KOG3137 consensus.
Probab=100.00  E-value=1.3e-44  Score=289.43  Aligned_cols=151  Identities=34%  Similarity=0.616  Sum_probs=139.5

Q ss_pred             CCHHHCCCCCCCCCCCCCC---CCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCC-------CC-----
Q ss_conf             7364576931052121378---78889999999999865004764213022014400037731643-------23-----
Q gi|254780297|r    4 KPLVIFPDPILRRVSRPIE---KINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-------AH-----   68 (170)
Q Consensus         4 ~~Iv~~~dp~L~~~~~~v~---~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~-------~~-----   68 (170)
T Consensus        79 ~~iv~~gDPVLr~ka~~Vdraqig~e~lq~lvd~m~~VMr~~~gVGLsAPQvGvp~q~~vle~~~alcrecP~~~ra~rq  158 (267)
T KOG3137          79 LKIVEYGDPVLRAKAKRVDRAQIGDENLQNLVDAMFDVMRKTDGVGLSAPQVGVPVQLMVLEPAGALCRECPEPGRAERQ  158 (267)
T ss_pred             HHHHCCCCHHHHHCCCCCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCHHHHHHCCCCHHHHHHH
T ss_conf             78632697766411254785560798899999999999971787654675468854799854707777508973466763


Q ss_pred             --CCCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEE
Q ss_conf             --348210016442010000011100000122321012110000024632358557999729764643270013197685
Q gi|254780297|r   69 --RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILF  146 (170)
Q Consensus        69 --~~~~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf  146 (170)
T Consensus       159 mepf~l~V~VNP~lk~~s~klv~F~EGClSv~Gf~A~V~R~q~V~i~g~D~~Ger~~~~aSgw~ARI~QHE~DHL~G~Lf  238 (267)
T KOG3137         159 MEPFKLIVLVNPKLKKYSDKLVPFDEGCLSVPGFYAEVVRPQSVKIDGRDITGERFSISASGWPARIFQHEYDHLEGVLF  238 (267)
T ss_pred             CCCCCEEEEECCHHHHHCCCCCCCCCCCCCCCCHHHCCCCCCEEEEEEECCCCCEEEEECCCCHHHHHHHHHHHHCCEEE
T ss_conf             36787699956067542365233655322454366400333067874005888789996264358898867642025055


Q ss_pred             EEECCHHH
Q ss_conf             36478899
Q gi|254780297|r  147 IDHLSRLK  154 (170)
Q Consensus       147 ~drls~~k  154 (170)
T Consensus       239 ~DkM~~rt  246 (267)
T KOG3137         239 FDKMTDRT  246 (267)
T ss_pred             EEECCCHH
T ss_conf             54135176