HHsearch alignment for GI: 254780297 and conserved domain: PRK09218

>PRK09218 peptide deformylase; Validated.
Probab=100.00  E-value=0  Score=317.76  Aligned_cols=134  Identities=34%  Similarity=0.578  Sum_probs=121.4

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH--HCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCC
Q ss_conf             877364576931052121378788899999999998650--047642130220144000377316432334821001644
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMY--STDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPK   79 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~--~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~   79 (170)
T Consensus         1 Mir~Iv-~~~~iLr~~a~pV~~~d---~~l~~dl~dtm~~~~~~gvGLAApQIGv~~ri~vv~~~~-----~~~v~iNP~   71 (136)
T PRK09218          1 MIKPIV-KDQLFLQQKSQPATKED---LQLAQDLQDTLLANRDECVGMAANMIGVQKRIIIVSMGF-----VPVVMFNPV   71 (136)
T ss_pred             CCCCCC-CCCHHHCCCCCCCCHHH---HHHHHHHHHHHHHHCCCCEEECHHHCCCCEEEEEEECCC-----CCEEEECCE
T ss_conf             964420-79777656764297789---999999999998626798696143469875299999689-----877888855


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEE
Q ss_conf             2010000011100000122321012110000024632358557999729764643270013197685
Q gi|254780297|r   80 IITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILF  146 (170)
Q Consensus        80 I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf  146 (170)
T Consensus        72 I~~~s~~~~-~~EGCLS~Pg~-~~v~R~~~I~v~~~d~~g~~~~~~~~g~~Ar~~QHE~DHL~GiLi  136 (136)
T PRK09218         72 IVSKSGPYQ-TEEGCLSLSGE-RPTKRYETITVKYLDRNWKPKTQTFTGFTAQIIQHELDHLEGILI  136 (136)
T ss_pred             EEECCCCEE-CCCCCCCCCCC-CCCCCCCEEEEEEECCCCCEEEEEEECCEEEEEEHHHHCCCCEEC
T ss_conf             897589687-44577277894-534152089999997999899999967214142718566187979