HHsearch alignment of GI: 254780297 and MMDB domain: 1lme_A_

>1lme_A (A:) PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima}
Probab=100.00  E-value=0  Score=383.95  Aligned_cols=164  Identities=35%  Similarity=0.625  Sum_probs=159.5

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCC
Q ss_conf             98773645769310521213787888999999999986500476421302201440003773164323348210016442
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKI   80 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I   80 (170)
                      ||+++|++||||+||++|.||+.++++++++++||++||++++|+||||||||+++|+|+++.+++     +++||||+|
T Consensus        11 m~i~~Iv~~~d~~Lr~~~~~V~~~~~~~~~li~dm~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~-----~~~lINP~I   85 (176)
T 1lme_A           11 HHMYRIRVFGDPVLRKRAKPVTKFDENLKKTIERMIETMYHYDGVGLAAPQVGISQRFFVMDVGNG-----PVAVINPEI   85 (176)
T ss_dssp             CSSCCCCCTTCGGGTSCCBCCCBCSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECSSSC-----CEEEEEEEE
T ss_pred             CCEEEEEECCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCEEEEEECCCC-----EEEEECCCC
T ss_conf             617872177996982706358988989999999999999859980973235786412999817998-----589989812


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHH
Q ss_conf             01000001110000012232101211000002463235855799972976464327001319768536478899999999
Q gi|254780297|r   81 ITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITK  160 (170)
Q Consensus        81 ~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~  160 (170)
                      ++.|++...+||||||+||+++.|.||.+|+|+|+|++|++++.+++||+|||+|||+|||+|++|+||+++.++..+.+
T Consensus        86 ~~~s~~~~~~~EgClS~Pg~~~~V~R~~~I~v~~~d~~g~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Drl~~~~~~~~~~  165 (176)
T 1lme_A           86 LEIDPETEVAEEGXLSFPEIFVEIERSKRIKVKYQNTRGEYVEEELEGYAARVFQHEFDHLNGVLIIDRISPAKRLLLRK  165 (176)
T ss_dssp             EEECSCEEEEEECCTTSTTCCEEEEEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGBCC--------
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCEEECCEEEEEEECCCCCEEEEEEECCEEEEEEEHHHHHCCEEEHHCCCHHHHHHHHH
T ss_conf             26787489814665566994762772132799675589939999996254678788438768973012159878899999


Q ss_pred             HHHHHHHHC
Q ss_conf             999998504
Q gi|254780297|r  161 KMSKLVQLR  169 (170)
Q Consensus       161 k~~k~~k~k  169 (170)
                      +++|++|.+
T Consensus       166 ~~~~~~~~~  174 (176)
T 1lme_A          166 KLMDIARTV  174 (176)
T ss_dssp             ---------
T ss_pred             HHHHHHHHH
T ss_conf             999999886