HHsearch alignment of GI: 254780297 and MMDB domain: 1rl4_A_

>1rl4_A (A:) Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide deformylase, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum 3D7}
Probab=100.00  E-value=0  Score=386.13  Aligned_cols=169  Identities=31%  Similarity=0.600  Sum_probs=162.2

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC-CCCCCEECCCC
Q ss_conf             98773645769310521213787888999999999986500476421302201440003773164323-34821001644
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH-RKNPMVFINPK   79 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~-~~~~~~~iNP~   79 (170)
                      |++++|++||||+||++|.||+.++++++++++||++||++++|+||||||||+++|+|+|++++... ...+.+||||+
T Consensus         6 m~~~~I~~~~d~~Lr~~a~~V~~~~~~~~~li~dM~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~~v~INP~   85 (188)
T 1rl4_A            6 KDEIKIVKYPDPILRRRSEEVTNFDDNLKRVVRKMFDIMYESKGIGLSAPQVNISKRIIVWNALYEKRKEENERIFINPS   85 (188)
T ss_dssp             ----CCCCTTCGGGGSCCBCCCCCSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEC-----------CEEEEEE
T ss_pred             CCCCCEEECCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHEEECCCCCCCCCCEEEEEECCC
T ss_conf             88862766899799742711898998999999999999855366553234425132203533563322220147862144


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHH
Q ss_conf             20100000111000001223210121100000246323585579997297646432700131976853647889999999
Q gi|254780297|r   80 IITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMIT  159 (170)
Q Consensus        80 I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~  159 (170)
                      |++.|+++..+||||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||+|+||+||+++.++..+.
T Consensus        86 I~~~s~e~~~~~EgClS~p~~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Drl~~~~~~~~~  165 (188)
T 1rl4_A           86 IVEQSLVKLKLIEGCLSFPGIEGKVERPSIVSISYYDINGYKHLKILKGIHSRIFQHEFDHLNGTLFIDKMTQVDKKKVR  165 (188)
T ss_dssp             EEEECSCEEEEEECCTTSTTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGBCHHHHHHHH
T ss_pred             CCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECEEEEEEEHHHHHCCEEEHHHCCHHHHHHHH
T ss_conf             33332057765125455798653322344545555322221122689502224325054876888404517999999999


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999998504
Q gi|254780297|r  160 KKMSKLVQLR  169 (170)
Q Consensus       160 ~k~~k~~k~k  169 (170)
                      ++++++.+.+
T Consensus       166 ~~~~~~~~~~  175 (188)
T 1rl4_A          166 PKLNELIRDY  175 (188)
T ss_dssp             HHHHHHHHC-
T ss_pred             HHHHHHHHHH
T ss_conf             9999999988