HHsearch alignment of GI: 254780297 and MMDB domain: 3dld_A_

>3dld_A (A:) Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV}
Probab=100.00  E-value=0  Score=373.52  Aligned_cols=163  Identities=28%  Similarity=0.414  Sum_probs=152.2

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCC-----CCCCEE
Q ss_conf             87736457693105212137878-889999999999865004764213022014400037731643233-----482100
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKI-NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR-----KNPMVF   75 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~-~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~-----~~~~~~   75 (170)
                      |+++|++||||+||++|.||+.+ ++++++++++|.+||++++|+||||||||+++|+|+++.++....     ..+++|
T Consensus         1 M~~~Iv~~~~~~Lr~~a~~V~~~~~~e~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~~~~~~vl   80 (171)
T 3dld_A            1 MIRDIIRMGDKRLLRVAPQVTNLGSAELHALVSDMFETMGAAHGVGLAAPQIAVDLQLMVFGFEASERYPEAPAVPLTAL   80 (171)
T ss_dssp             CCCCCCCTTCGGGGSCCCCCCCTTCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCSSEEEEEESSCSSSCSCCCEEEEEE
T ss_pred             CCCCHHHCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCCCEEEEECCCCCCCCCCCCCCCCEE
T ss_conf             97622118998993767667888988999999999999976899067588809762269985241014555555553010


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHH
Q ss_conf             16442010000011100000122321012110000024632358557999729764643270013197685364788999
Q gi|254780297|r   76 INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKR  155 (170)
Q Consensus        76 iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr  155 (170)
                      |||+|++.|+++..+||||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||+|||+|||+|++|+||+++.++
T Consensus        81 iNP~I~~~s~~~~~~~EgClS~p~~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~  160 (171)
T 3dld_A           81 ANAQIEPLSDEMENGWEGCLSIPGLRAVIPRYRYIRYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGRLYPSRIENFDT  160 (171)
T ss_dssp             EEEEEEESSSCEEEEEEEETTEEEEEEEEEEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGCSCGGG
T ss_pred             CCCEEEECCCCCEECCCCCCCCCCCCEEEEECCEEEEEEECCCCCEEEEEEEECHHHHHHHHHHHHCCEEHHHHCCCCCC
T ss_conf             15343103675046147865679974556642753799995889999999544121244047474188814885685653


Q ss_pred             HHHHHHHHH
Q ss_conf             999999999
Q gi|254780297|r  156 DMITKKMSK  164 (170)
Q Consensus       156 ~~~~~k~~k  164 (170)
                      ..+.++++|
T Consensus       161 ~~~~~~~~~  169 (171)
T 3dld_A          161 FGFDDVLSY  169 (171)
T ss_dssp             CEETTTCCC
T ss_pred             CCCHHHHCC
T ss_conf             344555336