HHsearch alignment of GI: 254780297 and MMDB domain: 3e3u_A_22-180

>3e3u_A (A:22-180) Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis}
Probab=100.00  E-value=0  Score=340.36  Aligned_cols=151  Identities=28%  Similarity=0.374  Sum_probs=142.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCC-------CCCEECCCCCCCHHHHHHH
Q ss_conf             121378788899999999998650047642130220144000377316432334-------8210016442010000011
Q gi|254780297|r   17 VSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK-------NPMVFINPKIITFSDDFSV   89 (170)
Q Consensus        17 ~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~-------~~~~~iNP~I~~~s~e~~~   89 (170)
                      .|+||+.+|+++++++++|++||++++|+||||||||+++|+|+++.++.....       .+.++|||+|++.|+++..
T Consensus         1 va~~V~~~~~~l~~li~dm~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~~~~~~~~~~iNP~i~~~s~~~~~   80 (159)
T 3e3u_A            1 TVAADGSLPADLAQLIATMYDTMDAANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDT   80 (159)
T ss_dssp             CCCTTSCCCTTHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEECCTTBCTTSCSEEEEEEEEEEESCCCCSCCCTTT
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCCCEEECHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECCCCEEE
T ss_conf             75565203199999999999999878996850677496501899973765453322443335870002323012787464


Q ss_pred             HHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             100000122321012110000024632358557999729764643270013197685364788999999999999985
Q gi|254780297|r   90 YQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ  167 (170)
Q Consensus        90 ~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~k~~k~~k  167 (170)
                      ++|||||+||+++.|.||.+|+|+|+|++|++++.+++||+|||+|||+|||+|++|+||+++.++..+.++++++.|
T Consensus        81 ~~EgClS~p~~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~~~~~  158 (159)
T 3e3u_A           81 DDEGCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLIGRYARNAKRAVKSHGW  158 (159)
T ss_dssp             CEEECTTSTTCEEECCCCSEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGCCHHHHHHHHHHHHHHTC
T ss_pred             EECCCCCCCCCCCEEECCCEEEEEEECCCCCEEEEEEEEHHHHHHHHHHHHHCCEECHHHCCHHHHHHHHHHHHHCCC
T ss_conf             121686768983265546327999997889999999802342688788684388920753399999999999997388