HHsearch alignment of GI: 254780297 and MMDB domain: 3g5k_A_

>3g5k_A (A:) Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal- binding, mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A
Probab=100.00  E-value=0  Score=369.59  Aligned_cols=154  Identities=29%  Similarity=0.510  Sum_probs=144.9

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCC---CHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC---------
Q ss_conf             987736457693105212137878---88999999999986500476421302201440003773164323---------
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKI---NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH---------   68 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~---~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~---------   68 (170)
                      |++++|++||||+||++|+||+.+   ++++++++++|++||++++||||||||||+++|+|++++++...         
T Consensus         2 M~i~~Iv~~g~pvLr~~a~~V~~~~~~~~~i~~li~~M~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~~~~~   81 (183)
T 3g5k_A            2 MSFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRA   81 (183)
T ss_dssp             CCCCCCCCTTCGGGTSCCBCCCGGGTTCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEEECHHHHHTSCHHHHH
T ss_pred             CCCCCCCCCCCHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEEEEEEECCCCCCCCCCCCCCC
T ss_conf             88121141198799464624876677889999999999999876588524313662310089997265444336400123


Q ss_pred             -----CCCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCC
Q ss_conf             -----348210016442010000011100000122321012110000024632358557999729764643270013197
Q gi|254780297|r   69 -----RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNG  143 (170)
Q Consensus        69 -----~~~~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  143 (170)
                           ...+.+||||+|++.|+++..++|||||+||+++.|.||.+|+|+|+|++|++++.+++||+|||||||+|||+|
T Consensus        82 ~~~~~~~~~~v~iNP~I~~~s~~~~~~~EGClS~p~~~~~V~R~~~I~v~~~d~~g~~~~~~~~g~~Ar~~QHEiDHL~G  161 (183)
T 3g5k_A           82 LRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQG  161 (183)
T ss_dssp             HHTCCCEEEEEEEEEEEEEEEEEEEEEEECCTTSTTEEEEEEEEEEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCEEECCEEEEEECCCCEEEECCCCCCCCCCEECCCCCEEEEEEEECCCCEEEEEECCCEEEHHHHHHHHHCC
T ss_conf             22246765145255099995266303410243324633012631207888875156256899812044012036384189


Q ss_pred             EEEEEECCHHH
Q ss_conf             68536478899
Q gi|254780297|r  144 ILFIDHLSRLK  154 (170)
Q Consensus       144 ~lf~drls~~k  154 (170)
                      ++|+||+++..
T Consensus       162 ~l~~Drl~~~~  172 (183)
T 3g5k_A          162 CLFIDKMDSRT  172 (183)
T ss_dssp             CCGGGTSCGGG
T ss_pred             EEEEEECCCCC
T ss_conf             88898528552