HHsearch results for GI: 254780297 and protein with PDBid: 1lm4_A

>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A*
Probab=100.00  E-value=0  Score=357.24  Aligned_cols=154  Identities=29%  Similarity=0.491  Sum_probs=139.9

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCC-CCHHHHHHHHHHHHHHHHC------------CCCCEEEHHHCCCCCEEEEECCCCC
Q ss_conf             98773645769310521213787-8889999999999865004------------7642130220144000377316432
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEK-INSDIMNLIDNMLEVMYST------------DGIGLAAVQIGVLYRLVVIDLQDHA   67 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~-~~~~~~~li~dm~~tm~~~------------~GvGLAA~QIG~~~ri~vv~~~~~~   67 (170)
                      |++++|+++|||+||++|.+|+. .++++++++++|.+||+++            +||||||||||+++|+||++.++..
T Consensus        13 m~~~~Iv~~g~p~Lr~~a~~V~~~~~~~~~~~i~~m~~tm~~~~~~~~~~~~~~~~GvGLAApQIGi~~Rifvv~~~~~~   92 (194)
T 1lm4_A           13 LTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDG   92 (194)
T ss_dssp             CCGGGSCCTTCGGGGSCCBCCCSSCCHHHHHHHHHHHHHHHHHHSHHHHHHHTCCCBSEEEGGGGTCCBSEEEEEECCCS
T ss_pred             EEHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECHHCCHHHHEEEEECCCCC
T ss_conf             07623541899799268734788889899999999999999846566775325789769860114854736564158655


Q ss_pred             C-CCCCCEECCCCCCCHHHH--HHHHHHHCCCC-CCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCC
Q ss_conf             3-348210016442010000--01110000012-2321012110000024632358557999729764643270013197
Q gi|254780297|r   68 H-RKNPMVFINPKIITFSDD--FSVYQEGCLSI-PDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNG  143 (170)
Q Consensus        68 ~-~~~~~~~iNP~I~~~s~e--~~~~~EGCLS~-Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  143 (170)
                      . ...+++||||+|++.|.+  +...+|||||+ ||+++.|+||.+|+|+|+|.+|+.++.+++||+|||||||+|||||
T Consensus        93 ~~~~~~~vlINP~Ii~~s~~~~~~~~~EGCLS~pp~~~~~V~R~~~I~v~~~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G  172 (194)
T 1lm4_A           93 SGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNG  172 (194)
T ss_dssp             SSCCEEEEEEEEEEEEECSSEEECTTCCCCTTCSSCCCSCCCEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHEEEEEEECCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             43445300028610011342011125666334544546403572469999997999999999887210446168671088


Q ss_pred             EEEEEECCHHH
Q ss_conf             68536478899
Q gi|254780297|r  144 ILFIDHLSRLK  154 (170)
Q Consensus       144 ~lf~drls~~k  154 (170)
                      +||+||+|+.+
T Consensus       173 ilf~Drl~~~~  183 (194)
T 1lm4_A          173 VMFYDHIDKNH  183 (194)
T ss_dssp             CCGGGGCCSSS
T ss_pred             EEEEEECCCCC
T ss_conf             87687038656