HHsearch results for GI: 254780297 and protein with PDBid: 1y6h_A

>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A*
Probab=100.00  E-value=0  Score=383.28  Aligned_cols=167  Identities=33%  Similarity=0.555  Sum_probs=155.5

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCC---CHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC-----CCCCC
Q ss_conf             87736457693105212137878---88999999999986500476421302201440003773164323-----34821
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKI---NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH-----RKNPM   73 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~---~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~-----~~~~~   73 (170)
                      |+|+|++||||+||++|+||+.+   ++++++++++|++||++++||||||||||+++|+||++.++...     ...+.
T Consensus         1 avr~I~~~~dp~Lr~~a~~V~~~d~~~~~i~~li~dM~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~~~~~~~~~~~~   80 (177)
T 1y6h_A            1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPER   80 (177)
T ss_dssp             CCCCCCCTTCGGGGSCCBCCCGGGTTSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCSSCTTSTTSCCCCCE
T ss_pred             CCCCCCCCCCHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEHHHCCCCEEEEEEECCCCCCCCCCCCCCCE
T ss_conf             96622038996994306457830148989999999999999877994305554787457999855755456666776627


Q ss_pred             EECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHH
Q ss_conf             00164420100000111000001223210121100000246323585579997297646432700131976853647889
Q gi|254780297|r   74 VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRL  153 (170)
Q Consensus        74 ~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~  153 (170)
                      ++|||+|++.|+++..++|||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||+|+||+||+++.
T Consensus        81 v~iNP~I~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~Dr~~~~  160 (177)
T 1y6h_A           81 IILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDT  160 (177)
T ss_dssp             EEEEEEEEECCSCEEEEEEEETTEEEEEEEEEEESEEEEEEECTTCCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGBSCT
T ss_pred             EEECCEEEECCCCEEEEECCCCCCCCCEEEEECCCCCEEEEECCCCCEEEEEECCHHHHHHHHHHHHHCCEECHHCCCHH
T ss_conf             99898998427855776326778799159987756246899989999999998108899999987853889014013843


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999850
Q gi|254780297|r  154 KRDMITKKMSKLVQL  168 (170)
Q Consensus       154 kr~~~~~k~~k~~k~  168 (170)
                      ++..+.+++++..+.
T Consensus       161 k~~~~~~~l~~~~~i  175 (177)
T 1y6h_A          161 KLFGFNETLDSSHNV  175 (177)
T ss_dssp             TSEEEHHHHHHHSCC
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             456789999876651