HHsearch results for GI: 254780297 and protein with PDBid: 3e3u_A

>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis}
Probab=100.00  E-value=0  Score=381.23  Aligned_cols=165  Identities=30%  Similarity=0.456  Sum_probs=152.3

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCC-----CCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCC----
Q ss_conf             98773645769310521213787-----888999999999986500476421302201440003773164323348----
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEK-----INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKN----   71 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~-----~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~----   71 (170)
                      |++++|++||||+||++|+||+.     ++.++++|+++|.+||++++|+||||||||+++|+||++.+++.....    
T Consensus         1 Mavl~Iv~~gdpiLr~~a~~V~~~~~~~~~~~l~~li~~m~~tm~~~~GvGLAApQIGv~~rifvi~~~~~~~~~~~~~~   80 (197)
T 3e3u_A            1 MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMDAANGVGLAANQIGCSLRLFVYDCAADRAMTARRRG   80 (197)
T ss_dssp             -CCCCEECTTCGGGSSCCBCCCCCTTSCCCTTHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEECCTTBCTTSCSEE
T ss_pred             CCCCCCCCCCCHHHHCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEHHHCCCCEEEEEEECCCCCCCCCCCCC
T ss_conf             99753255799799093725775564213099999999999999878996850677596500899973775454322454


Q ss_pred             ---CCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEE
Q ss_conf             ---21001644201000001110000012232101211000002463235855799972976464327001319768536
Q gi|254780297|r   72 ---PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFID  148 (170)
Q Consensus        72 ---~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~d  148 (170)
                         ..+++||+|+..|+++..++|||||+||+++.|.||.+|+|+|+|.+|+.++.+++||+|||||||+|||+|+||+|
T Consensus        81 ~~~npvlinp~i~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~V~~~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G~lf~D  160 (197)
T 3e3u_A           81 VVINPVLETSEIPETMPDPDTDDEGCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLD  160 (197)
T ss_dssp             EEEEEEEEESCCCCSCCCTTTCEEECTTSTTCEEECCCCSEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGG
T ss_pred             CCCCCEECCCCCCCCCCCEEEEECCCCCCCCCEEEEECCCCEEEEEECCCCCEEEEEEECHHHHHHHHHHHHHCCEEEHH
T ss_conf             32485210222201158736653478676898158553210589999899989999993156578878868118892063


Q ss_pred             ECCHHHHHHHHHHHHHH
Q ss_conf             47889999999999999
Q gi|254780297|r  149 HLSRLKRDMITKKMSKL  165 (170)
Q Consensus       149 rls~~kr~~~~~k~~k~  165 (170)
                      |+++.+|.++++++++.
T Consensus       161 rl~~~~~~~~~k~~k~~  177 (197)
T 3e3u_A          161 RLIGRYARNAKRAVKSH  177 (197)
T ss_dssp             GCCHHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHHHHHHHHC
T ss_conf             12999999999999974