Query         gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 170
No_of_seqs    111 out of 3172
Neff          6.1 
Searched_HMMs 23785
Date          Mon May 30 07:51:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780297.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3oca_A Peptide deformylase; ss 100.0       0       0  404.0   5.7  169    1-169    22-207 (209)
  2 1n5n_A Peptide deformylase; me 100.0       0       0  396.3   7.0  167    1-169    13-179 (180)
  3 2w3t_A Peptide deformylase; pr 100.0       0       0  390.6   6.7  165    2-169     1-165 (188)
  4 3cpm_A Peptide deformylase, ch 100.0       0       0  390.7   6.0  168    1-168    14-181 (193)
  5 1lme_A PDF, peptide deformylas 100.0       0       0  393.3   3.6  163    1-168    11-173 (176)
  6 2ew5_A Peptide deformylase; in 100.0       0       0  390.6   5.7  167    2-169     1-170 (181)
  7 1xeo_A Peptide deformylase; co 100.0       0       0  387.6   7.2  165    2-169     1-165 (168)
  8 3e3u_A Peptide deformylase; me 100.0       0       0  381.2   7.0  165    1-165     1-177 (197)
  9 1y6h_A Peptide deformylase; op 100.0       0       0  383.3   0.5  167    2-168     1-175 (177)
 10 1rl4_A Formylmethionine deform 100.0       0       0  375.4   5.7  167    3-169     8-175 (188)
 11 3g5k_A Peptide deformylase, mi 100.0       0       0  377.1   2.4  154    1-154     2-172 (183)
 12 1zxz_A PDF, peptide deformylas 100.0       0       0  383.0  -4.0  161    1-161     1-178 (197)
 13 3dld_A Peptide deformylase; ba 100.0       0       0  372.7   2.5  159    2-160     1-165 (171)
 14 1v3y_A Peptide deformylase; pr 100.0       0       0  368.7   5.5  160    2-163     1-172 (192)
 15 1ws0_A Peptide deformylase 1;  100.0       0       0  370.2   0.9  152    1-156     1-152 (156)
 16 2os0_A Peptide deformylase; PD 100.0       0       0  370.7  -0.7  161    1-161     2-182 (188)
 17 2okl_A Peptide deformylase 2;  100.0       0       0  373.6  -4.8  163    1-163     3-181 (185)
 18 1lm4_A Peptide deformylase PDF 100.0       0       0  357.2   4.0  154    1-154    13-183 (194)
 19 2aia_A Peptide deformylase; hy 100.0       0       0  357.2  -2.0  161    1-161    14-198 (203)

No 1  
>3oca_A Peptide deformylase; ssgcid, structur genomics, seattle structural genomics center for infectious hydrolase; 2.40A {Ehrlichia chaffeensis}
Probab=100.00  E-value=0  Score=404.00  Aligned_cols=169  Identities=41%  Similarity=0.686  Sum_probs=160.0

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCC-----------
Q ss_conf             987736457693105212137878889999999999865004764213022014400037731643233-----------
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR-----------   69 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~-----------   69 (170)
                      |++++|++||||+||++|+||+.+|+++++|++||++||++++||||||||||+++|+||++.+++...           
T Consensus        22 M~vl~Iv~~pdp~Lr~~a~~V~~~d~~l~~li~dM~~Tm~~~~GvGLAApQIG~~~rifvi~~~~~~~~~~~~~~~~~~~  101 (209)
T 3oca_A           22 MSVLSIVTVPDKRLSLCSEEVEKVDQSIRKLVDDMFETMHANQGLGLAAVQVGVHKRILVMNVPEEFEDSEDIENVEDKI  101 (209)
T ss_dssp             -CCCCCCCTTCGGGGSCCBCCSCCCHHHHHHHHHHHHHHHHHTCSEEEGGGGTCCBSEEEEEECC--------CCSSCCC
T ss_pred             CEEEECCCCCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             26412432799799485726896898999999999999987899554266639763489997774223321111211112


Q ss_pred             ------CCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCC
Q ss_conf             ------48210016442010000011100000122321012110000024632358557999729764643270013197
Q gi|254780297|r   70 ------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNG  143 (170)
Q Consensus        70 ------~~~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  143 (170)
                            ..+.+||||+|++.|+++..++|||||+||+++.|+||.+|+|+|+|++|+.++.+++||+|||||||+|||+|
T Consensus       102 ~~~~~~~~~~vlINP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G  181 (209)
T 3oca_A          102 EGYELYGGPYCIINPKIVDISQEKVKLKEGCLSVPGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNG  181 (209)
T ss_dssp             TTCBSSEEEEEEEEEEEEEECSCEEEEEECCTTSTTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCEEEECCEEEECCCCEEEEEECCCCCCCCCCCCCCHHEEEEEEEEECCCEEEEEEEEHHHHHHHHHHHHHCC
T ss_conf             22114678469986737862765788641444448876666362239999998059199999976454688687684388


Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHHC
Q ss_conf             68536478899999999999998504
Q gi|254780297|r  144 ILFIDHLSRLKRDMITKKMSKLVQLR  169 (170)
Q Consensus       144 ~lf~drls~~kr~~~~~k~~k~~k~k  169 (170)
                      +||+||+|+++|.++.+|++|+.|..
T Consensus       182 iLf~Drls~~kr~~~~~k~~k~~k~~  207 (209)
T 3oca_A          182 TVFLKYLSKFKRDFAIEKVKKKERTD  207 (209)
T ss_dssp             CCGGGGSCHHHHHHHHHHHHHHTSCC
T ss_pred             CCHHHHCCHHHHHHHHHHHHHHHHHC
T ss_conf             93468489989999999999987422


No 2  
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A*
Probab=100.00  E-value=0  Score=396.25  Aligned_cols=167  Identities=44%  Similarity=0.773  Sum_probs=161.0

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCC
Q ss_conf             98773645769310521213787888999999999986500476421302201440003773164323348210016442
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKI   80 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I   80 (170)
                      |++++|++||||+||++|.||+.++++++++++||++||++++|+||||||||+++|+||++.++..  ..+.+||||+|
T Consensus        13 Mai~~Iv~~~dpiLr~~~~~v~~~~~~i~~li~dM~~tm~~~~GvGLAApQIGi~~ri~vv~~~~~~--~~~~v~iNP~I   90 (180)
T 1n5n_A           13 MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDK--SEPRVFINPEF   90 (180)
T ss_dssp             CCCCCCCCTTCGGGGCBCBCCSCCCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEECSTTS--CCEEEEEEEEE
T ss_pred             CCCCCCCCCCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEECHHHCEECCEEEEECCCCC--CCCEEEECCEE
T ss_conf             5334327289979937051389699899999999999999779960022223000154876337556--78459989887


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHH
Q ss_conf             01000001110000012232101211000002463235855799972976464327001319768536478899999999
Q gi|254780297|r   81 ITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITK  160 (170)
Q Consensus        81 ~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~  160 (170)
                      ++.|+++..++|||||+||+++.|.||.+|+|+|+|.+|++++.+++||+|||||||+|||||+||+||+++++|.++.+
T Consensus        91 ~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~G~~Ar~~QHEiDHL~Gilf~Drl~~~~~~~~~k  170 (180)
T 1n5n_A           91 EPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRK  170 (180)
T ss_dssp             EESCSCEEEEEECCTTSTTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHBTCCGGGGSCHHHHHHHHH
T ss_pred             ECCCCCEEEECCCCCCCCCCEEEEECHHHHEEEEECCCCCEEEEEEEEHHEEHHHHHHHHHCCEEHHHCCCHHHHHHHHH
T ss_conf             33687566513654357998010277588346678789989999996420312314668759992133049989999999


Q ss_pred             HHHHHHHHC
Q ss_conf             999998504
Q gi|254780297|r  161 KMSKLVQLR  169 (170)
Q Consensus       161 k~~k~~k~k  169 (170)
                      |++|+.|.+
T Consensus       171 k~~k~~k~~  179 (180)
T 1n5n_A          171 KLEKQHRQQ  179 (180)
T ss_dssp             HHHHHHHHC
T ss_pred             HHHHHHHHC
T ss_conf             999988622


No 3  
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A
Probab=100.00  E-value=0  Score=390.58  Aligned_cols=165  Identities=42%  Similarity=0.735  Sum_probs=156.6

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCCC
Q ss_conf             87736457693105212137878889999999999865004764213022014400037731643233482100164420
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKII   81 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I~   81 (170)
                      |+++|++||||+||++|.||+.++++++++++||++||++++|+||||||||+++|+||+++.+..  +.+.+||||+|+
T Consensus         1 ail~Iv~~pdpiLr~~a~~v~~~~~~l~~li~dM~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~--~~~~v~iNP~Ii   78 (188)
T 2w3t_A            1 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENR--DERLVLINPELL   78 (188)
T ss_dssp             CCCCCCCTTCGGGGCCCBCCSCCCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCCTTS--CCCEEEEEEEEE
T ss_pred             CCCCEEECCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCCCEEEEECHHCC--CCCEEEECCEEE
T ss_conf             963300479869948272289799899999999999998689909767666945034775020116--883597797740


Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHHH
Q ss_conf             10000011100000122321012110000024632358557999729764643270013197685364788999999999
Q gi|254780297|r   82 TFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK  161 (170)
Q Consensus        82 ~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~k  161 (170)
                      +.|+++ .+||||||+||+++.|+||.+|+|+|+|.+|++++.+++||+|||||||+|||+|+||+||+|+++|+++.+|
T Consensus        79 ~~s~~~-~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~G~~Ar~iQHEiDHL~G~lf~Dr~s~~k~~~~~kk  157 (188)
T 2w3t_A           79 EKSGET-GIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQK  157 (188)
T ss_dssp             EEESCE-EEEECCTTSTTCCEEEEECSEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGSCHHHHHHHHHH
T ss_pred             CCCCCC-CCCCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEEEEEEEEEEEEHHHHHHHHCCEEHHHCCCHHHHHHHHHH
T ss_conf             467820-2540554777852354452099999984799699999985217734334787588820321699899999999


Q ss_pred             HHHHHHHC
Q ss_conf             99998504
Q gi|254780297|r  162 MSKLVQLR  169 (170)
Q Consensus       162 ~~k~~k~k  169 (170)
                      ++|+.|.+
T Consensus       158 ~~k~~~~~  165 (188)
T 2w3t_A          158 VEKLDRLK  165 (188)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
T ss_conf             99999877


No 4  
>3cpm_A Peptide deformylase, chloroplast; alpha beta, hydrolase, iron, metal-binding, plastid, protein biosynthesis, transit peptide; 2.40A {Arabidopsis thaliana}
Probab=100.00  E-value=0  Score=390.73  Aligned_cols=168  Identities=35%  Similarity=0.602  Sum_probs=161.7

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCC
Q ss_conf             98773645769310521213787888999999999986500476421302201440003773164323348210016442
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKI   80 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I   80 (170)
                      |+.++|++||||+||++|.+|+.++++++++++||++||++++|+||||||||+++|+||++..+......+.++|||+|
T Consensus        14 ~~~l~Iv~~~dpiLr~~~~~v~~~~~~~~~li~dM~~tm~~~~GvGLAApQIG~~~ri~vi~~~~~~~~~~~~v~iNP~I   93 (193)
T 3cpm_A           14 ETPLKIVEYPDPILRAKNKRIDIFDENLKNLVDAMFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKI   93 (193)
T ss_dssp             CSSCCCCCTTCGGGTSCCBCCCCCSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECSSCSTTSSCCEEEEEEEE
T ss_pred             CCCCEEEECCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCHHHHEEECCCCCCCCCCCCCCCCCEE
T ss_conf             67840777899799371634787898999999999999987898174476629325511330231234552100244133


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHH
Q ss_conf             01000001110000012232101211000002463235855799972976464327001319768536478899999999
Q gi|254780297|r   81 ITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITK  160 (170)
Q Consensus        81 ~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~  160 (170)
                      ++.|+++..++|||||+||+++.|.||.+|+|+|+|++|++++.+++||+|||||||+|||||+||+||+++.++..+.+
T Consensus        94 ~~~s~~~~~~~EgCLS~Pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Drl~~~~~~~~~k  173 (193)
T 3cpm_A           94 KKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQVLDSIRE  173 (193)
T ss_dssp             EEECSSEEEEEECCTTSTTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHTTHH
T ss_pred             ECCCCCEEEECCCCCCCCCCCEEEECCCEEEEEEEECCCCEEEEEEECCEEEEEEEHHHHHCCEEHHHHCCHHHHHHHHH
T ss_conf             30477089812455678998537876406999998278989999997464777544357637883478559889999999


Q ss_pred             HHHHHHHH
Q ss_conf             99999850
Q gi|254780297|r  161 KMSKLVQL  168 (170)
Q Consensus       161 k~~k~~k~  168 (170)
                      +++|+.+.
T Consensus       174 ~~~k~~k~  181 (193)
T 3cpm_A          174 ELEALEKK  181 (193)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
T ss_conf             99999998


No 5  
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1
Probab=100.00  E-value=0  Score=393.26  Aligned_cols=163  Identities=36%  Similarity=0.660  Sum_probs=158.0

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCC
Q ss_conf             98773645769310521213787888999999999986500476421302201440003773164323348210016442
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKI   80 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I   80 (170)
                      |++++|++||||+||++|+||+.++++++++++||++||++++|+||||||||+++|+||++.++     .+.++|||+|
T Consensus        11 ~~i~~I~~~~dpvLr~~a~~V~~~d~~~~~li~dm~~tm~~~~GvGLAApQIG~~~ri~vi~~~~-----~~~v~iNP~I   85 (176)
T 1lme_A           11 HHMYRIRVFGDPVLRKRAKPVTKFDENLKKTIERMIETMYHYDGVGLAAPQVGISQRFFVMDVGN-----GPVAVINPEI   85 (176)
T ss_dssp             CSSCCCCCTTCGGGTSCCBCCCBCSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECSSS-----CCEEEEEEEE
T ss_pred             CCEEEEEECCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCEEEEEEECCC-----CEEEEECCCC
T ss_conf             62687307799698270636898898999999999999985898085301279630399983799-----8689989850


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHH
Q ss_conf             01000001110000012232101211000002463235855799972976464327001319768536478899999999
Q gi|254780297|r   81 ITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITK  160 (170)
Q Consensus        81 ~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~  160 (170)
                      ++.|++...++|||||+||+++.|+||.+|+|+|+|.+|++++.+++||+|||+|||+|||||+||+||+|+.++.++.+
T Consensus        86 ~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~G~~Ar~iQHEiDHL~Gilf~Drl~~~~~~~~~k  165 (176)
T 1lme_A           86 LEIDPETEVAEEGCLSFPEIFVEIERSKRIKVKYQNTRGEYVEEELEGYAARVFQHEFDHLNGVLIIDRISPAKRLLLRK  165 (176)
T ss_dssp             EEECSCEEEEEECCTTSTTCCEEEEEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGBCC--------
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCEEECHHEEEEEECCCCCEEEEEEECCEEEEEEEHHHHHCCEEEEEECCHHHHHHHHH
T ss_conf             36787589831676556990740870040788653589949999997353678688438669985000449878999999


Q ss_pred             HHHHHHHH
Q ss_conf             99999850
Q gi|254780297|r  161 KMSKLVQL  168 (170)
Q Consensus       161 k~~k~~k~  168 (170)
                      +++|+.|.
T Consensus       166 ~~~k~~r~  173 (176)
T 1lme_A          166 KLMDIART  173 (176)
T ss_dssp             --------
T ss_pred             HHHHHHHH
T ss_conf             99999988


No 6  
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A
Probab=100.00  E-value=0  Score=390.56  Aligned_cols=167  Identities=35%  Similarity=0.676  Sum_probs=156.5

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC---CCCCCEECCC
Q ss_conf             8773645769310521213787888999999999986500476421302201440003773164323---3482100164
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH---RKNPMVFINP   78 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~---~~~~~~~iNP   78 (170)
                      |+++|++||||+||++|.||+.+|++++++++||++||++++||||||||||+++|+||+++++...   ...+++||||
T Consensus         1 Ail~Iv~~~dp~Lr~~a~~V~~~d~~l~~li~dM~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~~~~~~~~~~v~iNP   80 (181)
T 2ew5_A            1 ALLEIIHYPSKILRTISKEVVSFDAKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDGVQHKEDCLEIINP   80 (181)
T ss_dssp             CCCCCCCTTCGGGGCCCBCCCCCSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCCCTTSCCCGGGCEEEEEE
T ss_pred             CCCCEEECCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHHCCCCCEEEEECCCCCCCCCCCCCEECCCC
T ss_conf             96352017986996547237888989999999999999868990867767183503699981654565446641320475


Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHH
Q ss_conf             42010000011100000122321012110000024632358557999729764643270013197685364788999999
Q gi|254780297|r   79 KIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI  158 (170)
Q Consensus        79 ~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~  158 (170)
                      +|++.|++. .++|||||+||+++.|+||.+|+|+|+|.+|++++.+++||+|||||||+|||||+||+||+|+++|.++
T Consensus        81 ~I~~~s~~~-~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Drls~~k~~~~  159 (181)
T 2ew5_A           81 KFIETGGSM-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLSILKRKKF  159 (181)
T ss_dssp             EEEEEECCE-EEEECCTTSTTCCEEEEECSEEEEEEECTTCCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGCCHHHHHHH
T ss_pred             EEECCCCCE-ECCCCCCCCCCCCEEEECCCEEEEEEECCCCCEEEEEECCCEEEEEEEHHHHHCCEEEHHCCCHHHHHHH
T ss_conf             266048842-3104656777776577576369999952689789999777356332614275288953011799899999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999998504
Q gi|254780297|r  159 TKKMSKLVQLR  169 (170)
Q Consensus       159 ~~k~~k~~k~k  169 (170)
                      +++++|+.|.+
T Consensus       160 ~k~~~k~~k~~  170 (181)
T 2ew5_A          160 EKELKELQKKQ  170 (181)
T ss_dssp             HHHHHHC----
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999987


No 7  
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli BL21} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 3k6l_A* 1dff_A 1def_A 2kmn_A* 2def_A ...
Probab=100.00  E-value=0  Score=387.59  Aligned_cols=165  Identities=42%  Similarity=0.742  Sum_probs=156.0

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCCC
Q ss_conf             87736457693105212137878889999999999865004764213022014400037731643233482100164420
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKII   81 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I~   81 (170)
                      |+++|++||||+||++|+||+.+|++++++++||++||++++|+||||||||+++|+||+++++..  ..+.+||||+|+
T Consensus         1 av~~I~~~~dpiLr~~a~~v~~~~~~~~~li~dM~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~--~~~~v~iNP~i~   78 (168)
T 1xeo_A            1 SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENR--DERLVLINPELL   78 (168)
T ss_dssp             CCCCCCCTTCGGGGCCCBCCSCCCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCCTTS--CCCEEEEEEEEE
T ss_pred             CCCCHHCCCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCCCEEEEECCCCC--CCEEEECCCEEC
T ss_conf             965410379869958262389799899999999999998689909777665956034886111146--750783396630


Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHHH
Q ss_conf             10000011100000122321012110000024632358557999729764643270013197685364788999999999
Q gi|254780297|r   82 TFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK  161 (170)
Q Consensus        82 ~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~k  161 (170)
                      +.|++ ..++|||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||||+||+||+|+.+++.+.+|
T Consensus        79 ~~~~~-~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Dr~~~~~~~~~~kk  157 (168)
T 1xeo_A           79 EKSGE-TGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQK  157 (168)
T ss_dssp             EEECC-BCCEECCTTSTTCCEECCBCSEEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHHHHHH
T ss_pred             CCCCC-CCCCCCCCCCCCCEEEEEEEEEEEEEEECCCCCEEEEEEEEHEEEHHHHHHHHHCCEEHHHHCCHHHHHHHHHH
T ss_conf             22664-46652675668803474123289999987899899999970114416656787689921652799899999999


Q ss_pred             HHHHHHHC
Q ss_conf             99998504
Q gi|254780297|r  162 MSKLVQLR  169 (170)
Q Consensus       162 ~~k~~k~k  169 (170)
                      ++|+.|.+
T Consensus       158 ~~k~~~~~  165 (168)
T 1xeo_A          158 VEKLDRLK  165 (168)
T ss_dssp             HHHHHHHC
T ss_pred             HHHHHHHH
T ss_conf             99999887


No 8  
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis}
Probab=100.00  E-value=0  Score=381.23  Aligned_cols=165  Identities=30%  Similarity=0.456  Sum_probs=152.3

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCC-----CCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCC----
Q ss_conf             98773645769310521213787-----888999999999986500476421302201440003773164323348----
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEK-----INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKN----   71 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~-----~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~----   71 (170)
                      |++++|++||||+||++|+||+.     ++.++++|+++|.+||++++|+||||||||+++|+||++.+++.....    
T Consensus         1 Mavl~Iv~~gdpiLr~~a~~V~~~~~~~~~~~l~~li~~m~~tm~~~~GvGLAApQIGv~~rifvi~~~~~~~~~~~~~~   80 (197)
T 3e3u_A            1 MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMDAANGVGLAANQIGCSLRLFVYDCAADRAMTARRRG   80 (197)
T ss_dssp             -CCCCEECTTCGGGSSCCBCCCCCTTSCCCTTHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEECCTTBCTTSCSEE
T ss_pred             CCCCCCCCCCCHHHHCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEHHHCCCCEEEEEEECCCCCCCCCCCCC
T ss_conf             99753255799799093725775564213099999999999999878996850677596500899973775454322454


Q ss_pred             ---CCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEE
Q ss_conf             ---21001644201000001110000012232101211000002463235855799972976464327001319768536
Q gi|254780297|r   72 ---PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFID  148 (170)
Q Consensus        72 ---~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~d  148 (170)
                         ..+++||+|+..|+++..++|||||+||+++.|.||.+|+|+|+|.+|+.++.+++||+|||||||+|||+|+||+|
T Consensus        81 ~~~npvlinp~i~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~V~~~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G~lf~D  160 (197)
T 3e3u_A           81 VVINPVLETSEIPETMPDPDTDDEGCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLD  160 (197)
T ss_dssp             EEEEEEEEESCCCCSCCCTTTCEEECTTSTTCEEECCCCSEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGG
T ss_pred             CCCCCEECCCCCCCCCCCEEEEECCCCCCCCCEEEEECCCCEEEEEECCCCCEEEEEEECHHHHHHHHHHHHHCCEEEHH
T ss_conf             32485210222201158736653478676898158553210589999899989999993156578878868118892063


Q ss_pred             ECCHHHHHHHHHHHHHH
Q ss_conf             47889999999999999
Q gi|254780297|r  149 HLSRLKRDMITKKMSKL  165 (170)
Q Consensus       149 rls~~kr~~~~~k~~k~  165 (170)
                      |+++.+|.++++++++.
T Consensus       161 rl~~~~~~~~~k~~k~~  177 (197)
T 3e3u_A          161 RLIGRYARNAKRAVKSH  177 (197)
T ss_dssp             GCCHHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHHHHHHHHC
T ss_conf             12999999999999974


No 9  
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A*
Probab=100.00  E-value=0  Score=383.28  Aligned_cols=167  Identities=33%  Similarity=0.555  Sum_probs=155.5

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCC---CHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC-----CCCCC
Q ss_conf             87736457693105212137878---88999999999986500476421302201440003773164323-----34821
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKI---NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH-----RKNPM   73 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~---~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~-----~~~~~   73 (170)
                      |+|+|++||||+||++|+||+.+   ++++++++++|++||++++||||||||||+++|+||++.++...     ...+.
T Consensus         1 avr~I~~~~dp~Lr~~a~~V~~~d~~~~~i~~li~dM~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~~~~~~~~~~~~   80 (177)
T 1y6h_A            1 SVRKILRMGDPILRKISEPVTEDEIQTKEFKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYPGTPDVPER   80 (177)
T ss_dssp             CCCCCCCTTCGGGGSCCBCCCGGGTTSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCSSCTTSTTSCCCCCE
T ss_pred             CCCCCCCCCCHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEHHHCCCCEEEEEEECCCCCCCCCCCCCCCE
T ss_conf             96622038996994306457830148989999999999999877994305554787457999855755456666776627


Q ss_pred             EECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHH
Q ss_conf             00164420100000111000001223210121100000246323585579997297646432700131976853647889
Q gi|254780297|r   74 VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRL  153 (170)
Q Consensus        74 ~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~  153 (170)
                      ++|||+|++.|+++..++|||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||+|+||+||+++.
T Consensus        81 v~iNP~I~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~Dr~~~~  160 (177)
T 1y6h_A           81 IILNPVITPLTKDTSGFWEGCLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDT  160 (177)
T ss_dssp             EEEEEEEEECCSCEEEEEEEETTEEEEEEEEEEESEEEEEEECTTCCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGBSCT
T ss_pred             EEECCEEEECCCCEEEEECCCCCCCCCEEEEECCCCCEEEEECCCCCEEEEEECCHHHHHHHHHHHHHCCEECHHCCCHH
T ss_conf             99898998427855776326778799159987756246899989999999998108899999987853889014013843


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999850
Q gi|254780297|r  154 KRDMITKKMSKLVQL  168 (170)
Q Consensus       154 kr~~~~~k~~k~~k~  168 (170)
                      ++..+.+++++..+.
T Consensus       161 k~~~~~~~l~~~~~i  175 (177)
T 1y6h_A          161 KLFGFNETLDSSHNV  175 (177)
T ss_dssp             TSEEEHHHHHHHSCC
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             456789999876651


No 10 
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide deformylase, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum 3D7} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A
Probab=100.00  E-value=0  Score=375.44  Aligned_cols=167  Identities=32%  Similarity=0.616  Sum_probs=158.4

Q ss_pred             CCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC-CCCCCEECCCCCC
Q ss_conf             773645769310521213787888999999999986500476421302201440003773164323-3482100164420
Q gi|254780297|r    3 KKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH-RKNPMVFINPKII   81 (170)
Q Consensus         3 ~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~-~~~~~~~iNP~I~   81 (170)
                      .++|++||||+|+++|.||+.+++++++++++|++||++++|+||||||||+++|+||++..+... ...+.+++||.|+
T Consensus         8 ~lkIv~~~dpiLr~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~rifvi~~~~~~~~~~~~~~~iNp~ii   87 (188)
T 1rl4_A            8 EIKIVKYPDPILRRRSEEVTNFDDNLKRVVRKMFDIMYESKGIGLSAPQVNISKRIIVWNALYEKRKEENERIFINPSIV   87 (188)
T ss_dssp             --CCCCTTCGGGGSCCBCCCCCSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEC-----------CEEEEEEEE
T ss_pred             CCCEEECCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCHHHCCCCCCCCCCCCCCCEEEECCCCC
T ss_conf             76277689979966161489899899999999999998789919887776950320012565211235575588768865


Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHHHHHHH
Q ss_conf             10000011100000122321012110000024632358557999729764643270013197685364788999999999
Q gi|254780297|r   82 TFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK  161 (170)
Q Consensus        82 ~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~~~~~k  161 (170)
                      ..|+++...+||||||||+++.|+||.+|+|+|+|.+|++++.+++||+|||||||+|||||++|+||+|+.++++++++
T Consensus        88 ~~s~~~~~~~EgCLS~Pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~G~~Ar~~QHEiDHL~Gilf~Drl~~~~~~~~~kk  167 (188)
T 1rl4_A           88 EQSLVKLKLIEGCLSFPGIEGKVERPSIVSISYYDINGYKHLKILKGIHSRIFQHEFDHLNGTLFIDKMTQVDKKKVRPK  167 (188)
T ss_dssp             EECSCEEEEEECCTTSTTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGBCHHHHHHHHHH
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEEEEEECEEEEEEEHHHHHCCEEEHHHCCHHHHHHHHHH
T ss_conf             66750575367602468965433401316899980665357899962334530614486688850441799899999999


Q ss_pred             HHHHHHHC
Q ss_conf             99998504
Q gi|254780297|r  162 MSKLVQLR  169 (170)
Q Consensus       162 ~~k~~k~k  169 (170)
                      ++|+.|..
T Consensus       168 ~~~~~k~~  175 (188)
T 1rl4_A          168 LNELIRDY  175 (188)
T ss_dssp             HHHHHHC-
T ss_pred             HHHHHHHH
T ss_conf             99999988


No 11 
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal- binding, mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A
Probab=100.00  E-value=0  Score=377.14  Aligned_cols=154  Identities=29%  Similarity=0.511  Sum_probs=143.5

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCC---HHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCC---------
Q ss_conf             9877364576931052121378788---8999999999986500476421302201440003773164323---------
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKIN---SDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH---------   68 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~---~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~---------   68 (170)
                      |++++|++||||+||++|+||+.++   ++++++++||++||++++||||||||||+++|+||++.++...         
T Consensus         2 M~~~~Iv~~gdpiLr~~a~~V~~~~~~~~~l~~li~dM~~tm~~~~GvGLAApQIG~~~rifvi~~~~~~~~~~~~~~~~   81 (183)
T 3g5k_A            2 MSFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRA   81 (183)
T ss_dssp             CCCCCCCCTTCGGGTSCCBCCCGGGTTCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEEECHHHHHTSCHHHHH
T ss_pred             CCCCCCCCCCCHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCEEEEEEECCCCCCCCCCCCCCC
T ss_conf             88123140698789440636874467889999999999999987899487302458601089997375323336621121


Q ss_pred             -----CCCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCC
Q ss_conf             -----348210016442010000011100000122321012110000024632358557999729764643270013197
Q gi|254780297|r   69 -----RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNG  143 (170)
Q Consensus        69 -----~~~~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  143 (170)
                           ...+.++|||+|+..|+++..++|||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||+|
T Consensus        82 ~~~~~~~~~~v~iNP~i~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G  161 (183)
T 3g5k_A           82 LRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQG  161 (183)
T ss_dssp             HHTCCCEEEEEEEEEEEEEEEEEEEEEEECCTTSTTEEEEEEEEEEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCEEECCCEEEEECCCCEEECCCCCCCCCCEEEEECCCCEEEEEECCCCCEEEEEEEEEEEHHHHHHHHHCCC
T ss_conf             00136766166345089994264102014445889951771757730899987999799999940022112046471088


Q ss_pred             EEEEEECCHHH
Q ss_conf             68536478899
Q gi|254780297|r  144 ILFIDHLSRLK  154 (170)
Q Consensus       144 ~lf~drls~~k  154 (170)
                      +||+||+|+..
T Consensus       162 ~lf~Drls~~~  172 (183)
T 3g5k_A          162 CLFIDKMDSRT  172 (183)
T ss_dssp             CCGGGTSCGGG
T ss_pred             EEEEEECCCCC
T ss_conf             87888518463


No 12 
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A
Probab=100.00  E-value=0  Score=383.02  Aligned_cols=161  Identities=32%  Similarity=0.493  Sum_probs=147.2

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCC---CHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCC----------
Q ss_conf             987736457693105212137878---8899999999998650047642130220144000377316432----------
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKI---NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA----------   67 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~---~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~----------   67 (170)
                      |++++|+++|||+||++|++|+.+   ++++++|+++|++||++++||||||||||+++|+||++.++..          
T Consensus         1 M~~~~Iv~~gdP~Lr~~a~~V~~~d~~~~~l~~li~~M~~tm~~~~GvGLAApQIGi~~rifvi~~~~~~~~~~~~~~~~   80 (197)
T 1zxz_A            1 MDLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMRLAPGVGLAAPQIGVPLRIIVLEDTKEYISYAPKEEIL   80 (197)
T ss_dssp             -CCCCCCCTTSGGGTSCCBCCCTTTTTSHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEEECHHHHHSSCHHHHH
T ss_pred             CCCCCCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCEEEEEEECCCCCCCCCCCHHCC
T ss_conf             97056142899788154710795457889999999999999987899377544538641099998663224558511102


Q ss_pred             ----CCCCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCC
Q ss_conf             ----3348210016442010000011100000122321012110000024632358557999729764643270013197
Q gi|254780297|r   68 ----HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNG  143 (170)
Q Consensus        68 ----~~~~~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  143 (170)
                          ....+.+||||+|+..|+++...+|||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||||
T Consensus        81 ~~~~~~~~~~v~INP~I~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~V~y~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  160 (197)
T 1zxz_A           81 AQERRHFDLMVMVNPVLKERSNKKALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARILQHECDHLDG  160 (197)
T ss_dssp             HTTCCCEEEEEEEEEEEEESSSCEEEEEEEETTEEEEEEEEEEESEEEEEEECTTCCEEEEEEEHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCEEEECCEEEEECCCEEEECCCCCCCCCCCEEEECCCCCEEEEECCCCCEEEEEEEEHHHHHHHHHHHCCCC
T ss_conf             21224567459867716871341566236653679965773887505699885899889999810201446178674288


Q ss_pred             EEEEEECCHHHHHHHHHH
Q ss_conf             685364788999999999
Q gi|254780297|r  144 ILFIDHLSRLKRDMITKK  161 (170)
Q Consensus       144 ~lf~drls~~kr~~~~~k  161 (170)
                      +||+||+++.+++.+++.
T Consensus       161 ~lf~Drl~~~~~~~~~~~  178 (197)
T 1zxz_A          161 NLYVDKMVPRTFRTVDNL  178 (197)
T ss_dssp             CCGGGTBCTTCCEEGGGT
T ss_pred             EEEEECCCHHHHHHHHHH
T ss_conf             986751298899999988


No 13 
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV}
Probab=100.00  E-value=0  Score=372.73  Aligned_cols=159  Identities=28%  Similarity=0.422  Sum_probs=146.7

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCC-----CCCCEE
Q ss_conf             87736457693105212137878-889999999999865004764213022014400037731643233-----482100
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKI-NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR-----KNPMVF   75 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~-~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~-----~~~~~~   75 (170)
                      |+++|++||||+||++|.||+.+ ++++++++++|++||++++||||||||||+++|+||++.++....     ..+.++
T Consensus         1 Mi~~Iv~~~dp~Lr~~~~~v~~~~~~~~~~li~dm~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~~~~~~~~~~~~v~   80 (171)
T 3dld_A            1 MIRDIIRMGDKRLLRVAPQVTNLGSAELHALVSDMFETMGAAHGVGLAAPQIAVDLQLMVFGFEASERYPEAPAVPLTAL   80 (171)
T ss_dssp             CCCCCCCTTCGGGGSCCCCCCCTTCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCSSEEEEEESSCSSSCSCCCEEEEEE
T ss_pred             CCCCHHCCCCHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEHHHCCCCCCEEEEECCCCCCCCCCCCCCCEEE
T ss_conf             97641008998995767668888998999999999999976899067688828653479961440014555544342031


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHH
Q ss_conf             16442010000011100000122321012110000024632358557999729764643270013197685364788999
Q gi|254780297|r   76 INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKR  155 (170)
Q Consensus        76 iNP~I~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr  155 (170)
                      |||+|++.|+++..++|||||+||+++.|+||.+|+|+|+|++|++++.+++||+|||||||+|||+|+||+||+|+.++
T Consensus        81 iNP~I~~~s~~~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Dr~~~~~~  160 (171)
T 3dld_A           81 ANAQIEPLSDEMENGWEGCLSIPGLRAVIPRYRYIRYRGFAPDGSPIEREAEGFHARVVQHEYDHLVGRLYPSRIENFDT  160 (171)
T ss_dssp             EEEEEEESSSCEEEEEEEETTEEEEEEEEEEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGCSCGGG
T ss_pred             CCCEEECCCCCCEEECCCCCCCCCCCEEEEECCEEEEEEECCCCCEEEEEEECCEEHHHHHHHHCCCCEEHHHHCCCCCC
T ss_conf             06575035785067325765679972786644761699993789899999912100213158570088814885786653


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|254780297|r  156 DMITK  160 (170)
Q Consensus       156 ~~~~~  160 (170)
                      ..+++
T Consensus       161 ~~~~~  165 (171)
T 3dld_A          161 FGFDD  165 (171)
T ss_dssp             CEETT
T ss_pred             CCCHH
T ss_conf             44644


No 14 
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1
Probab=100.00  E-value=0  Score=368.68  Aligned_cols=160  Identities=36%  Similarity=0.645  Sum_probs=140.3

Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCC-----------C
Q ss_conf             87736457693105212137878889999999999865004764213022014400037731643233-----------4
Q gi|254780297|r    2 VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR-----------K   70 (170)
Q Consensus         2 ~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~-----------~   70 (170)
                      |+++|++||||+||++|+||+.++ +++++++||++||++++|+||||||||+++|+||++.......           .
T Consensus         1 Mil~Iv~~gdpvLr~~a~~V~~~~-~~~~li~dM~~tm~~~~GvGLAApQIGi~~rifvi~~~~~~~~~~~~~~~~~~~~   79 (192)
T 1v3y_A            1 MVYPIRLYGDPVLRRKARPVEDFS-GIKRLAEDMLETMFEAKGVGLAAPQIGLSQRLFVAVEYADEPEGEEERPLRELVR   79 (192)
T ss_dssp             CCCCCCCTTCGGGGSCCBCCCCCT-THHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEEC------------CTTTCS
T ss_pred             CCCCCCCCCCHHHHCCCEECCCCC-HHHHHHHHHHHHHHHCCCCCCCCHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             915603089968947173478850-6999999999999876996011211382245899971377753211353000467


Q ss_pred             CCCEECCCCCCCHHHHHHHHHHHCCCCCCCC-HHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEE
Q ss_conf             8210016442010000011100000122321-012110000024632358557999729764643270013197685364
Q gi|254780297|r   71 NPMVFINPKIITFSDDFSVYQEGCLSIPDYR-ADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDH  149 (170)
Q Consensus        71 ~~~~~iNP~I~~~s~e~~~~~EGCLS~Pg~~-~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~dr  149 (170)
                      .+++++||.| ..|+++..+||||||+||++ +.|+||.+|+|+|+|.+|+.++.+++||+|||||||+|||||+||+||
T Consensus        80 ~~~~~~npii-~~~~~~~~~~EGCLS~Pg~~~~~V~R~~~I~v~y~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G~lf~Dr  158 (192)
T 1v3y_A           80 RVYVVANPVI-TYREGLVEGTEGCLSLPGLYSEEVPRAERIRVEYQDEEGRGRVLELEGYMARVFQHEIDHLDGILFFER  158 (192)
T ss_dssp             CEEEEEEEEE-EEEECCEEEEECCTTSTTCCEEEEEECSEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGG
T ss_pred             CEEEECCCEE-EEECCCEEECCCCCCCCCCCCEEEECCCEEEEEEECCCCCEEEEEEECHHHHHHHHHHHCCCCEEEHHC
T ss_conf             4399759689-872560650357667899751487657889999986799699999960101335168574298963440


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             78899999999999
Q gi|254780297|r  150 LSRLKRDMITKKMS  163 (170)
Q Consensus       150 ls~~kr~~~~~k~~  163 (170)
                      +|+.+|+.+.++.+
T Consensus       159 l~~~k~~~~~~~~~  172 (192)
T 1v3y_A          159 LPKPKREAFLEANR  172 (192)
T ss_dssp             SCHHHHHHHHHHTH
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             99989999999999


No 15 
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A*
Probab=100.00  E-value=0  Score=370.18  Aligned_cols=152  Identities=32%  Similarity=0.613  Sum_probs=143.2

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCCCCCCCCEECCCCC
Q ss_conf             98773645769310521213787888999999999986500476421302201440003773164323348210016442
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKI   80 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~~~~~li~dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~~~~~~~~~iNP~I   80 (170)
                      |++++|+++|||+||++|.||+.+|++++++++||++||++++|+||||||||+++|+||++..+..   ...+++||+|
T Consensus         1 Mai~~Iv~~~dp~Lr~~~~~V~~~d~~~~~li~dM~~tm~~~~GvGLAApQIG~~~rifv~~~~~~~---~~~~~inp~i   77 (156)
T 1ws0_A            1 MAVLEIIKHPNEVLETPCERVINFDKKLVKLLKDMHETMLIADGVGLAAPQVGVSLQVAVVDVDDDT---GKIELINPSI   77 (156)
T ss_dssp             CCCCCCCCSSCGGGGSCCBCCCCCCHHHHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEECCTTT---CEEEEEEEEE
T ss_pred             CCCCEECCCCCHHHHCCCEECCCCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHEEEEECCCC---CCCCCCCCCE
T ss_conf             9961213589969949061078789899999999999998779960652146832344464202457---8521258745


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCEEEEEECCHHHHH
Q ss_conf             0100000111000001223210121100000246323585579997297646432700131976853647889999
Q gi|254780297|r   81 ITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRD  156 (170)
Q Consensus        81 ~~~s~e~~~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~lf~drls~~kr~  156 (170)
                      +..|++. .++|||||+||+++.|+||.+|+|+|+|.+|+.++.+++||.|||||||+|||||+||+||+|+++|+
T Consensus        78 ~~~s~~~-~~~EGCLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHE~DHL~Gilf~Dr~sk~~~~  152 (156)
T 1ws0_A           78 LEKRGEQ-VGPEGCLSFPGLYGEVERADYIKVRAQNRRGKVFLLEAEGFLARAIQHEIDHLHGVLFTSKVTRYYEE  152 (156)
T ss_dssp             EEEEEEE-EEEECCTTSTTCCEEEEEEEEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGTEEEECC-
T ss_pred             EECCCCE-ECCCCCCCCCCCEEEEECCCEEEEEEECCCCCEEEEEEECCEEHHHHHHHHHHCCEEHHHHCCCHHHH
T ss_conf             6226634-34234689999216657896899999438997899994477334776887853899558854602236


No 16 
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A
Probab=100.00  E-value=0  Score=370.66  Aligned_cols=161  Identities=29%  Similarity=0.447  Sum_probs=143.9

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCC-CCCHHHHHHHHHHHHHHHH------------CCCCCEEEHHHCCCCCEEEEECCCCC
Q ss_conf             9877364576931052121378-7888999999999986500------------47642130220144000377316432
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIE-KINSDIMNLIDNMLEVMYS------------TDGIGLAAVQIGVLYRLVVIDLQDHA   67 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~-~~~~~~~~li~dm~~tm~~------------~~GvGLAA~QIG~~~ri~vv~~~~~~   67 (170)
                      |++++|++||||+||++|+||+ +++++++++++||++||++            .+||||||||||+++|+||++.++..
T Consensus         2 m~~~~Iv~~gdp~Lr~~a~~v~~~~~~~~~~l~~dm~~~m~~~~~~~~~~~~~~~~GvGLAApQIGi~~rifvv~~~~~~   81 (188)
T 2os0_A            2 ITMKDIIREGNPTLRAVAEEVPVPITEEDRQLGEDMLTFLKNSQDPVKAEELQLRGDVGLAAPQLDISKRIIAVHVPSND   81 (188)
T ss_dssp             CCGGGSCCTTCGGGGSCCBCCCSSCCHHHHHHHHHHHHHHHHHHSHHHHHHHTCCCCSEEEGGGGTCCBSEEEEEECC--
T ss_pred             CCCCHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEHHHCCCCCEEEEEECCCCC
T ss_conf             87322533799799184621798889899999999999999704223455403579868772236862138999747543


Q ss_pred             CC----CCCCEECCCCCCCHHHHHH--HHHHHCCCCC-CCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHH
Q ss_conf             33----4821001644201000001--1100000122-321012110000024632358557999729764643270013
Q gi|254780297|r   68 HR----KNPMVFINPKIITFSDDFS--VYQEGCLSIP-DYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDH  140 (170)
Q Consensus        68 ~~----~~~~~~iNP~I~~~s~e~~--~~~EGCLS~P-g~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDH  140 (170)
                      ..    ..+.++|||+|++.|.+..  ..||||||+| |+++.|.||.+|+|+|+|++|++++.+++||+|||||||+||
T Consensus        82 ~~~~~~~~~~v~iNP~I~~~s~e~~~~~~~EGCLS~P~~~~~~V~R~~~I~v~y~d~~G~~~~~~~~g~~Ar~~QHE~DH  161 (188)
T 2os0_A           82 PENETPSLSTVMYNPKILSHSVQDVCLGEGEGCLSVDRDVPGYVVRHNKITVSYFDMAGEKHKVRLKNYEAIVVQHEIDH  161 (188)
T ss_dssp             -------EEEEEEEEEEEEECSCEEEETTCCCCTTCCSCCCSCCCEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEECCCEECCCCCCCEEECCCCCCCCCCCCCEEEECCCEEEEEEECCCCCEEEEEEECCEEEEEEEHHHH
T ss_conf             44436667513357812014622000202345536665675268702589999996899999999826758887862264


Q ss_pred             HCCEEEEEECCHHHHHHHHHH
Q ss_conf             197685364788999999999
Q gi|254780297|r  141 LNGILFIDHLSRLKRDMITKK  161 (170)
Q Consensus       141 L~G~lf~drls~~kr~~~~~k  161 (170)
                      |||+||+||+|+.++..++++
T Consensus       162 L~Gil~~Drl~~~~~~~~k~~  182 (188)
T 2os0_A          162 INGIMFYDHINKENPFALKEG  182 (188)
T ss_dssp             HTTCCGGGGSCSSSTTCCCTT
T ss_pred             HCCEEEEEECCCCCHHHHHHH
T ss_conf             088877763280145676520


No 17 
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus atcc 14579} PDB: 1lqy_A*
Probab=100.00  E-value=0  Score=373.62  Aligned_cols=163  Identities=32%  Similarity=0.469  Sum_probs=143.6

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCC-CHH----HHHHHH--------HHHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCC
Q ss_conf             987736457693105212137878-889----999999--------9998650047642130220144000377316432
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKI-NSD----IMNLID--------NMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA   67 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~-~~~----~~~li~--------dm~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~   67 (170)
                      |++++|++||||+||++|++|+.+ +++    ++++++        +|.+||++.+|+||||||||+++|+||+++++..
T Consensus         3 M~v~~Iv~~~dp~Lr~~~~~V~~~~~~~~~~~i~~li~~~~~~~~~~m~~tm~~~~GvGLAApQIGi~~rifvi~~~~~~   82 (185)
T 2okl_A            3 LTMKDVIREGDPILRNVAEEVSLPASEEDTTTLKEMIEFVINSQDPEMAEKYSLRPGIGLAAPQIGVSKKMIAVHVTDAD   82 (185)
T ss_dssp             CCGGGCCCTTCGGGGSCCBCCCSSCCHHHHHHHHHHHHHHHHHTSHHHHHHTTCCCCSEEEGGGGTCCBSEEEEEEECTT
T ss_pred             CCHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEHHHCCCCCCEEEEEEEECC
T ss_conf             62301522799799176701687742566799999999999746889999874489818764454875416999986121


Q ss_pred             CCCCCCEECCCCCCCHHHHHHH--HHHHCCCCCC-CCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCCE
Q ss_conf             3348210016442010000011--1000001223-210121100000246323585579997297646432700131976
Q gi|254780297|r   68 HRKNPMVFINPKIITFSDDFSV--YQEGCLSIPD-YRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGI  144 (170)
Q Consensus        68 ~~~~~~~~iNP~I~~~s~e~~~--~~EGCLS~Pg-~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~  144 (170)
                      +...+.++|||+|++.|+++..  .||||||+|| +++.|+||.+|+|+|+|++|++++.+++||.|||||||+|||+|+
T Consensus        83 ~~~~~~v~iNP~I~~~s~e~~~~~~~EGCLS~Pg~~~~~V~R~~~I~v~~~d~~G~~~~~~~~G~~Ar~~QHE~DHL~G~  162 (185)
T 2okl_A           83 GTLYSHALFNPKIISHSVERTYLQGGEGCLSVDREVPGYVPRYTRITVKATSINGEEVKLRLKGLPAIVFQHEIDHLNGV  162 (185)
T ss_dssp             CCEEEEEEEEEEEEEECSSEEECTTCCCCTTCCSCCCSCCCEESEEEEEEEETTSCEEEEEEEHHHHHHHHHHHHHHTTC
T ss_pred             CCCCCCCCCCCCEEECCCCCEECCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEECCHHHHHHHHHHHHHCCE
T ss_conf             23454325577246306651111456797076655542335532899999889995999998866657897888974888


Q ss_pred             EEEEECCHHHHHHHHHHHH
Q ss_conf             8536478899999999999
Q gi|254780297|r  145 LFIDHLSRLKRDMITKKMS  163 (170)
Q Consensus       145 lf~drls~~kr~~~~~k~~  163 (170)
                      ||+||+|+.++..+.++++
T Consensus       163 lf~Drl~~~~~~~~~~e~~  181 (185)
T 2okl_A          163 MFYDHINKENPFAAPDDSK  181 (185)
T ss_dssp             CGGGGSCSSCTTCCCSSEE
T ss_pred             EEEECCCCCCHHHHHHHHH
T ss_conf             1045158115324067778


No 18 
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A*
Probab=100.00  E-value=0  Score=357.24  Aligned_cols=154  Identities=29%  Similarity=0.491  Sum_probs=139.9

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCC-CCHHHHHHHHHHHHHHHHC------------CCCCEEEHHHCCCCCEEEEECCCCC
Q ss_conf             98773645769310521213787-8889999999999865004------------7642130220144000377316432
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEK-INSDIMNLIDNMLEVMYST------------DGIGLAAVQIGVLYRLVVIDLQDHA   67 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~-~~~~~~~li~dm~~tm~~~------------~GvGLAA~QIG~~~ri~vv~~~~~~   67 (170)
                      |++++|+++|||+||++|.+|+. .++++++++++|.+||+++            +||||||||||+++|+||++.++..
T Consensus        13 m~~~~Iv~~g~p~Lr~~a~~V~~~~~~~~~~~i~~m~~tm~~~~~~~~~~~~~~~~GvGLAApQIGi~~Rifvv~~~~~~   92 (194)
T 1lm4_A           13 LTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDG   92 (194)
T ss_dssp             CCGGGSCCTTCGGGGSCCBCCCSSCCHHHHHHHHHHHHHHHHHHSHHHHHHHTCCCBSEEEGGGGTCCBSEEEEEECCCS
T ss_pred             EEHHHHHHCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECHHCCHHHHEEEEECCCCC
T ss_conf             07623541899799268734788889899999999999999846566775325789769860114854736564158655


Q ss_pred             C-CCCCCEECCCCCCCHHHH--HHHHHHHCCCC-CCCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEEEHHHHCC
Q ss_conf             3-348210016442010000--01110000012-2321012110000024632358557999729764643270013197
Q gi|254780297|r   68 H-RKNPMVFINPKIITFSDD--FSVYQEGCLSI-PDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNG  143 (170)
Q Consensus        68 ~-~~~~~~~iNP~I~~~s~e--~~~~~EGCLS~-Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G  143 (170)
                      . ...+++||||+|++.|.+  +...+|||||+ ||+++.|+||.+|+|+|+|.+|+.++.+++||+|||||||+|||||
T Consensus        93 ~~~~~~~vlINP~Ii~~s~~~~~~~~~EGCLS~pp~~~~~V~R~~~I~v~~~d~~G~~~~~~~~G~~Ar~~QHEiDHL~G  172 (194)
T 1lm4_A           93 SGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNG  172 (194)
T ss_dssp             SSCCEEEEEEEEEEEEECSSEEECTTCCCCTTCSSCCCSCCCEESEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHEEEEEEECCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             43445300028610011342011125666334544546403572469999997999999999887210446168671088


Q ss_pred             EEEEEECCHHH
Q ss_conf             68536478899
Q gi|254780297|r  144 ILFIDHLSRLK  154 (170)
Q Consensus       144 ~lf~drls~~k  154 (170)
                      +||+||+|+.+
T Consensus       173 ilf~Drl~~~~  183 (194)
T 1lm4_A          173 VMFYDHIDKNH  183 (194)
T ss_dssp             CCGGGGCCSSS
T ss_pred             EEEEEECCCCC
T ss_conf             87687038656


No 19 
>2aia_A Peptide deformylase; hydrolase; HET: SB8; 1.70A {Streptococcus pneumoniae} PDB: 2ai7_A* 2aie_P* 1lm6_A 2os3_A*
Probab=100.00  E-value=0  Score=357.20  Aligned_cols=161  Identities=28%  Similarity=0.412  Sum_probs=137.8

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCH--------HHHHHHHH-----HHHHHHHCCCCCEEEHHHCCCCCEEEEECCCCC
Q ss_conf             98773645769310521213787888--------99999999-----998650047642130220144000377316432
Q gi|254780297|r    1 MVKKPLVIFPDPILRRVSRPIEKINS--------DIMNLIDN-----MLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA   67 (170)
Q Consensus         1 M~~~~Iv~~~dp~L~~~~~~v~~~~~--------~~~~li~d-----m~~tm~~~~GvGLAA~QIG~~~ri~vv~~~~~~   67 (170)
                      |++++|+++|||+||++|+||+.+.+        ++.+++++     |.+||++++||||||||||+++|+|+++.++..
T Consensus        14 ~~i~~Iv~~g~p~Lr~~a~~V~~~~~~~~~~~~~~~~~~i~d~~~~~m~~tm~~~~GvGLAApQIGi~~ri~vv~~~~~~   93 (203)
T 2aia_A           14 IDMCDIIREGNPSLRTVAEEVTFPLSDQEIILGEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAVLVPNIV   93 (203)
T ss_dssp             CCGGGSCCTTCGGGGSCCBCCCSSCCHHHHHHHHHHHHHHHHHTCHHHHHHHTCCCCSEEEGGGGTCCBSEEEEEEEC--
T ss_pred             CCHHHHHCCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCEEEEECCCCCCCEEEEEECCCCH
T ss_conf             77633200899799387702588875788888999999998620378999887679959850212875118999847712


Q ss_pred             C--------CCCCCEECCCCCCCHHHH--HHHHHHHCCCCC-CCCHHHHHCCHHEEEEECCCCCEEEEEEECCEEEEEEE
Q ss_conf             3--------348210016442010000--011100000122-32101211000002463235855799972976464327
Q gi|254780297|r   68 H--------RKNPMVFINPKIITFSDD--FSVYQEGCLSIP-DYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQH  136 (170)
Q Consensus        68 ~--------~~~~~~~iNP~I~~~s~e--~~~~~EGCLS~P-g~~~~V~R~~~I~v~~~d~~G~~~~~~~~g~~Ar~~QH  136 (170)
                      .        ...+.+||||+|++.|.+  +...+|||||+| |+++.|+||.+|+|+|+|.+|++++.+++||+||||||
T Consensus        94 ~~~~~~~~~~~~~~vlINP~Ii~~s~~~~~~~~~EGCLS~P~~~~g~V~R~~~I~v~y~d~~G~~~~~~~~G~~Ar~~QH  173 (203)
T 2aia_A           94 EEGETPQEAYDLEAIMYNPKIVSHSVQDAALGEGEGCLSVDRNVPGYVVRHARVTVDYFDKDGEKHRIKLKGYNSIVVQH  173 (203)
T ss_dssp             --------CEEEEEEEEEEEEEEECSSEEEETTCCCCTTCCSCCCSCBCEESCEEEEEECTTSCEEEEEECHHHHHHHHH
T ss_pred             HCCCCCCCCCCCCCEEECCCEEECCCCCEEEEECCCCCCCCCCCCEEEEEEEEEEEEEECCCCCEEEEEEECHHHHHHHH
T ss_conf             10568433456661578883310256540452025763667677148998899999999799999999993567778978


Q ss_pred             EHHHHCCEEEEEECCHHHHHHHHHH
Q ss_conf             0013197685364788999999999
Q gi|254780297|r  137 ELDHLNGILFIDHLSRLKRDMITKK  161 (170)
Q Consensus       137 EiDHL~G~lf~drls~~kr~~~~~k  161 (170)
                      |+|||+|+||+||+|+.++..++++
T Consensus       174 EiDHL~G~Lf~Drls~~~~~~~~~~  198 (203)
T 2aia_A          174 EIDHINGIMFYDRINEKDPFAVKDG  198 (203)
T ss_dssp             HHHHHTTCCGGGGBCSSCTTCCCTT
T ss_pred             HHHHCCCEECCEEECCCCHHHHHHH
T ss_conf             8780088801211083434667766


Done!