BLAST/PSIBLAST alignment of GI: 254780297 and GI: 190890084 at iteration 1
>gi|190890084|ref|YP_001976626.1| peptide deformylase [Rhizobium etli CIAT 652] Length = 171
>gi|190695363|gb|ACE89448.1| peptide deformylase protein [Rhizobium etli CIAT 652] Length = 171
 Score =  223 bits (567), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 132/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR++S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPLLRQLSKPIERVDADLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFIDH+SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMVIKKFTKAAK 167