BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780297|ref|YP_003064710.1| peptide deformylase
[Candidatus Liberibacter asiaticus str. psy62]
         (170 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039974|gb|ACT56770.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 170

 Score =  347 bits (890), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 170/170 (100%), Positives = 170/170 (100%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV
Sbjct: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ
Sbjct: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD
Sbjct: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170


>gi|315122858|ref|YP_004063347.1| peptide deformylase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496260|gb|ADR52859.1| peptide deformylase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 165

 Score =  245 bits (625), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 146/167 (87%), Gaps = 4/167 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M KK L+ FPDP+LRRVSR +E I+SDI++LI++M EVMYS+DGIGLAAVQIG+LYR+VV
Sbjct: 1   MKKKSLIFFPDPVLRRVSRSVETIDSDIIHLIEDMFEVMYSSDGIGLAAVQIGILYRVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL    + K+P+VFINP I++ S+D SV  EGCLSIP++RADVKR++F+TV+Y+D NAQ
Sbjct: 61  IDL----NTKSPLVFINPTIVSSSNDCSVRAEGCLSIPNHRADVKRASFVTVKYLDSNAQ 116

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            QIIYADGLLATCLQHE+DHLNGILFIDH+SRLKRDMI  K+ KL++
Sbjct: 117 PQIIYADGLLATCLQHEIDHLNGILFIDHISRLKRDMIINKILKLIR 163


>gi|325291800|ref|YP_004277664.1| polypeptide deformylase peptide deformylase [Agrobacterium sp.
           H13-3]
 gi|325059653|gb|ADY63344.1| polypeptide deformylase peptide deformylase [Agrobacterium sp.
           H13-3]
          Length = 170

 Score =  223 bits (569), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 135/169 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+ SRPIE+++++++ L D+MLE MY   GIGLAA+Q+GV  R++V
Sbjct: 1   MTIKPLIILPDPVLRQQSRPIEQVDAEVLRLADDMLETMYDAPGIGLAAIQVGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P+VFINP+I+  SDD S Y+EGCLSIPDY A+V+R A +TVRY+D + +
Sbjct: 61  IDVSREDEEKKPVVFINPEILRVSDDVSAYEEGCLSIPDYYAEVERPASLTVRYVDRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           HQ++ ADGLLATCLQHE+DHLNGILFIDH+SRLKR+M+ KK +K  + +
Sbjct: 121 HQMVDADGLLATCLQHEIDHLNGILFIDHISRLKREMVIKKFTKAARAK 169


>gi|190890084|ref|YP_001976626.1| peptide deformylase [Rhizobium etli CIAT 652]
 gi|190695363|gb|ACE89448.1| peptide deformylase protein [Rhizobium etli CIAT 652]
          Length = 171

 Score =  223 bits (567), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 132/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR++S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPLLRQLSKPIERVDADLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFIDH+SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMVIKKFTKAAK 167


>gi|86356069|ref|YP_467961.1| peptide deformylase [Rhizobium etli CFN 42]
 gi|86280171|gb|ABC89234.1| peptide deformylase protein [Rhizobium etli CFN 42]
          Length = 171

 Score =  223 bits (567), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 132/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR++S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPVLRQLSKPIERVDADLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SDD SVY+EGCLSIPDY A+V+R A ++V+Y+D   +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDDRSVYEEGCLSIPDYYAEVERPATVSVKYLDREGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q++ ADGLLATCLQHE+DHLNG+LFIDH+SRLKR+M+ KK +K  +
Sbjct: 121 EQMVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMVIKKFTKAAK 167


>gi|327191106|gb|EGE58154.1| peptide deformylase protein [Rhizobium etli CNPAF512]
          Length = 171

 Score =  222 bits (566), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 131/167 (78%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR++S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPLLRQLSKPIERVDADLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V Y+D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVEYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFIDH+SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMVIKKFTKAAK 167


>gi|241202826|ref|YP_002973922.1| peptide deformylase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856716|gb|ACS54383.1| peptide deformylase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 171

 Score =  222 bits (565), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 132/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR++S+PIE+++SD+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPVLRQLSKPIERVDSDLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+++  SD+ SVY+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDIAREGEEKQPQVFINPEVVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFID++SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFTKAAK 167


>gi|218460831|ref|ZP_03500922.1| peptide deformylase [Rhizobium etli Kim 5]
          Length = 171

 Score =  221 bits (563), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 132/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDPILR++S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPILRQLSQPIERVDADLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFID++SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFTKAAK 167


>gi|116250199|ref|YP_766037.1| peptide deformylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254847|emb|CAK05921.1| putative peptide deformylase (polypeptide deformylase) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 171

 Score =  221 bits (563), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 132/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR++S+PIE+++SD+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPVLRQLSKPIERVDSDLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ S+Y+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDISREGEEKQPQVFINPEIVKSSDERSLYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFID++SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFTKAAK 167


>gi|218672914|ref|ZP_03522583.1| peptide deformylase [Rhizobium etli GR56]
          Length = 171

 Score =  221 bits (562), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 133/167 (79%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDPILR++S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPILRQLSQPIERMDADLQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q++ ADGLLATCLQHE+DHLNG+LFID++SRLKR+M+ KK +K  +
Sbjct: 121 EQMVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFTKAAK 167


>gi|218513698|ref|ZP_03510538.1| peptide deformylase [Rhizobium etli 8C-3]
          Length = 171

 Score =  221 bits (562), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 131/167 (78%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP LR++S+PIE++++++  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPFLRQLSKPIERVDAELQRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V+Y+D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKYLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFIDH+SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMVIKKFTKAAK 167


>gi|209547667|ref|YP_002279584.1| peptide deformylase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533423|gb|ACI53358.1| peptide deformylase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 171

 Score =  220 bits (561), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 131/167 (78%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDPILR+ S+PIE++++D+  L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPILRQASKPIERVDADLQGLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VFINP+I+  SD+ SVY+EGCLSIPDY A+V+R A ++V+++D N +
Sbjct: 61  IDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIPDYYAEVERPAVVSVKFLDRNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q + ADGLLATCLQHE+DHLNG+LFID++SRLKR+M+ KK +K  +
Sbjct: 121 EQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFTKAAK 167


>gi|227820644|ref|YP_002824614.1| peptide deformylase [Sinorhizobium fredii NGR234]
 gi|227339643|gb|ACP23861.1| peptide deformylase [Sinorhizobium fredii NGR234]
          Length = 174

 Score =  220 bits (560), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 130/169 (76%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDPILR+VS P+E I++DI  L D+MLE MY   GIGLAA+QIGV  RL+V
Sbjct: 1   MTIKPLIILPDPILRQVSTPVETIDADIRRLADDMLETMYDAPGIGLAAIQIGVPRRLLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K P+VFINPKI+  S++ SVY+EGCLSIPDY A+V+R A I V Y+D + +
Sbjct: 61  LDVSKEGEEKTPLVFINPKIVKSSEERSVYEEGCLSIPDYYAEVERPAAIAVEYLDRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGLLATCLQHE+DHLNG+LFID++S+LKRDM+ +K +K  + R
Sbjct: 121 QQSVEADGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIRKFTKAAKTR 169


>gi|150395282|ref|YP_001325749.1| peptide deformylase [Sinorhizobium medicae WSM419]
 gi|150026797|gb|ABR58914.1| peptide deformylase [Sinorhizobium medicae WSM419]
          Length = 174

 Score =  220 bits (560), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 98/169 (57%), Positives = 130/169 (76%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS P+E +++DI  L D+MLE MY   GIGLAA+QIGV  RL+V
Sbjct: 1   MTIKPLIILPDPVLRQVSTPVETVDADIRRLADDMLETMYDAPGIGLAAIQIGVPKRLLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K P+VFINPK++  S++ SVY+EGCLSIPDY A+V+R A ITV Y+D   +
Sbjct: 61  LDVTKEGEEKQPLVFINPKVVRSSEERSVYEEGCLSIPDYYAEVERPAAITVEYVDREGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGLLATCLQHE+DHLNG+LFID++S+LKRDM+ +K +K  + R
Sbjct: 121 EQAVEADGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIRKFTKAAKTR 169


>gi|222084707|ref|YP_002543236.1| peptide deformylase [Agrobacterium radiobacter K84]
 gi|221722155|gb|ACM25311.1| peptide deformylase [Agrobacterium radiobacter K84]
          Length = 171

 Score =  219 bits (557), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 134/167 (80%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+ S+PIE+++++I+ L D+MLE MY   GIGLAAVQIGV  R++V
Sbjct: 1   MTIKPLIILPDPLLRQASKPIERVDTEILRLADDMLETMYDAPGIGLAAVQIGVARRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P+VFINP+++  SD+ SVY+EGCLSIPDY A+V+R A +TV+++D + +
Sbjct: 61  IDVAREGEDKQPLVFINPEVVASSDERSVYEEGCLSIPDYYAEVERPARVTVKHIDRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q+I ADGLLATCLQHE+DHLNG+LFID++SRLKR+M+ KK +K  +
Sbjct: 121 EQLIEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFTKAAK 167


>gi|23396548|sp|Q92SH6|DEF_RHIME RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
          Length = 174

 Score =  218 bits (555), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 130/169 (76%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS P+E I++DI  L D+MLE MY   GIGLAA+QIGV  RL+V
Sbjct: 1   MTIKPLIILPDPVLRQVSTPVETIDADIRRLADDMLETMYDAPGIGLAAIQIGVPKRLLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K P+VFINPK++  S++ SVY+EGCLSIPDY A+V+R A ITV Y+D   +
Sbjct: 61  LDVTKEGEEKQPLVFINPKVVRSSEERSVYEEGCLSIPDYYAEVERPAAITVEYVDREGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + A+GLLATCLQHE+DHLNG+LFID++S+LKRDM+ ++ +K  + R
Sbjct: 121 EQAVEAEGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIRRFTKAAKTR 169


>gi|15964172|ref|NP_384525.1| peptide deformylase [Sinorhizobium meliloti 1021]
 gi|307301317|ref|ZP_07581079.1| peptide deformylase [Sinorhizobium meliloti BL225C]
 gi|307317988|ref|ZP_07597425.1| peptide deformylase [Sinorhizobium meliloti AK83]
 gi|15073348|emb|CAC41856.1| Probable peptide deformylase [Sinorhizobium meliloti 1021]
 gi|306896390|gb|EFN27139.1| peptide deformylase [Sinorhizobium meliloti AK83]
 gi|306903773|gb|EFN34360.1| peptide deformylase [Sinorhizobium meliloti BL225C]
          Length = 178

 Score =  218 bits (554), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 130/169 (76%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS P+E I++DI  L D+MLE MY   GIGLAA+QIGV  RL+V
Sbjct: 5   MTIKPLIILPDPVLRQVSTPVETIDADIRRLADDMLETMYDAPGIGLAAIQIGVPKRLLV 64

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K P+VFINPK++  S++ SVY+EGCLSIPDY A+V+R A ITV Y+D   +
Sbjct: 65  LDVTKEGEEKQPLVFINPKVVRSSEERSVYEEGCLSIPDYYAEVERPAAITVEYVDREGK 124

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + A+GLLATCLQHE+DHLNG+LFID++S+LKRDM+ ++ +K  + R
Sbjct: 125 EQAVEAEGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIRRFTKAAKTR 173


>gi|15887717|ref|NP_353398.1| peptide deformylase [Agrobacterium tumefaciens str. C58]
 gi|23396541|sp|Q8UID1|DEF_AGRT5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|15155278|gb|AAK86183.1| polypeptide deformylase [Agrobacterium tumefaciens str. C58]
          Length = 170

 Score =  215 bits (547), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 96/169 (56%), Positives = 131/169 (77%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+ S+ IE+++++++ L D+MLE MY   GIGLAA+QIGV  R++V
Sbjct: 1   MTIKPLIILPDPVLRQQSKLIEQVDAEVLRLADDMLETMYDAPGIGLAAIQIGVPRRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P+VFINP+I+  SDD S Y+EGCLSIPDY A+V+R A +TV+Y+  + +
Sbjct: 61  IDVAREGEEKTPVVFINPEILKVSDDISTYEEGCLSIPDYYAEVERPASLTVQYVGRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGLLATCLQHE+DHLNG+LFIDH+SRLKRDM+ KK +K  + +
Sbjct: 121 QQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKRDMVIKKFTKAARAK 169


>gi|254501503|ref|ZP_05113654.1| peptide deformylase [Labrenzia alexandrii DFL-11]
 gi|222437574|gb|EEE44253.1| peptide deformylase [Labrenzia alexandrii DFL-11]
          Length = 189

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (73%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+P++  PDP+LR V  PIEK++++ + L D+MLE MY   GIGLAA Q+G+L R+ V
Sbjct: 18  MTKRPIITIPDPVLREVCAPIEKVDAETIALADDMLETMYDAPGIGLAASQVGILKRIFV 77

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K PMVFINP+II + D+ SVYQEGCLSIPDY  DV+R A + V++MD    
Sbjct: 78  LDVAKEDAPKEPMVFINPEIIWYGDELSVYQEGCLSIPDYYEDVERPAEVAVKFMDREGA 137

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            Q I ADGLLATC+QHELDHLNG LFID+LS+LKRD + KK +K  +L
Sbjct: 138 EQEIKADGLLATCIQHELDHLNGKLFIDYLSKLKRDRVVKKFTKQAKL 185


>gi|163757845|ref|ZP_02164934.1| peptide deformylase [Hoeflea phototrophica DFL-43]
 gi|162285347|gb|EDQ35629.1| peptide deformylase [Hoeflea phototrophica DFL-43]
          Length = 172

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 127/169 (75%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPLV+ PDPILR+ S P+E++++++   ID+MLE MY   GIGLAA+Q+GV  RL+V
Sbjct: 1   MTIKPLVLLPDPILRQQSLPVERVDAELEGFIDDMLETMYDAPGIGLAAIQVGVPRRLLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K+P VFINP+++   D  SVY+EGCLSIPDY ADV+R   ITV+Y+  + +
Sbjct: 61  IDVAGKDEPKSPQVFINPEVVATGDGISVYEEGCLSIPDYYADVERPETITVKYLGRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                ADGLLATCLQHE+DHLNG+LFIDH+S+LKRDM+ +K +KL + R
Sbjct: 121 EHTTEADGLLATCLQHEIDHLNGVLFIDHISKLKRDMVVRKFTKLAKQR 169


>gi|222147432|ref|YP_002548389.1| peptide deformylase [Agrobacterium vitis S4]
 gi|221734422|gb|ACM35385.1| peptide deformylase [Agrobacterium vitis S4]
          Length = 176

 Score =  209 bits (533), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 123/158 (77%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KP++I PDP+LR VS+PIE+I++D+  LID+MLE MY   GIGLAAVQI V  RL+V
Sbjct: 5   MTTKPIIILPDPLLREVSQPIERIDADLERLIDDMLETMYDAPGIGLAAVQIAVPRRLLV 64

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P+VFINP+II  S   S Y+EGCLSIPDY A+V+R A +TV+ +D + +
Sbjct: 65  IDVSKEGEDKQPLVFINPEIIGSSQARSTYEEGCLSIPDYYAEVERPAAVTVKSLDRHGK 124

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
            Q+I ADGLLATCLQHE+DHLNG LFIDH+SRLKR+M+
Sbjct: 125 EQVIEADGLLATCLQHEIDHLNGTLFIDHISRLKREMV 162


>gi|90419800|ref|ZP_01227709.1| peptide deformylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335841|gb|EAS49589.1| peptide deformylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 170

 Score =  204 bits (519), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 122/164 (74%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+ S+P+E ++  +  L D+MLE MY   GIGLAA+QIG   R++V
Sbjct: 1   MTIKPLIILPDPVLRQTSKPVETVDDQVRRLADDMLETMYDAPGIGLAAIQIGEPLRMMV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+        P +F+NP+I+T SD  SVY+EGCLSIPDY A+V+R A +TVRY+  + +
Sbjct: 61  IDVSKEEEENAPRIFLNPEILTISDAVSVYEEGCLSIPDYYAEVERPAEVTVRYLGLDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
                ADG+LATC+QHELDHLNG+LFIDH+S+LKRDM+ KK +K
Sbjct: 121 MHEETADGILATCVQHELDHLNGVLFIDHISKLKRDMVVKKFTK 164


>gi|319780347|ref|YP_004139823.1| peptide deformylase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166235|gb|ADV09773.1| peptide deformylase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 176

 Score =  204 bits (519), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 125/164 (76%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           KPL+I PDPILR+VS+P+E++++ +  L D+ML  MY   GIGLAA+QIG   RL+VIDL
Sbjct: 4   KPLIILPDPILRQVSKPVERVDAPLRKLADDMLATMYDAPGIGLAAIQIGEPLRLLVIDL 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                   P VFINP+I+  +D  SVY+EGCLSIPDY A+V+R A + V+Y+D + + Q 
Sbjct: 64  AKEDETPAPHVFINPEILESADARSVYEEGCLSIPDYYAEVERPASVRVKYLDRDGKLQE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           I A+GL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL +
Sbjct: 124 IEAEGLMATCLQHEIDHLNGVLFIDHISKLKRDMVVKKFKKLAR 167


>gi|153008675|ref|YP_001369890.1| peptide deformylase [Ochrobactrum anthropi ATCC 49188]
 gi|151560563|gb|ABS14061.1| peptide deformylase [Ochrobactrum anthropi ATCC 49188]
          Length = 175

 Score =  203 bits (516), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 121/169 (71%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPLVI PDP+LR+VS+P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLVILPDPVLRQVSKPVERFDDQLRKFAGDMFDTMYDAPGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P VFINP+I+  +D+ S Y+EGCLSIPDY A+V+R A I V Y D + +
Sbjct: 61  IDLAKEDEPKAPHVFINPEIVGVTDEVSTYEEGCLSIPDYYAEVERPAAIKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             +I ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 121 QHLIEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 169


>gi|110632755|ref|YP_672963.1| peptide deformylase [Mesorhizobium sp. BNC1]
 gi|122966266|sp|Q11LC7|DEF_MESSB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|110283739|gb|ABG61798.1| peptide deformylase [Chelativorans sp. BNC1]
          Length = 177

 Score =  202 bits (515), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 128/169 (75%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLV  PDP+LR+VS+P+E+++  +     +MLE MY   GIGLAA+Q+G   R++V
Sbjct: 1   MAIRPLVTLPDPLLRQVSKPVERVDESLRKFAGDMLETMYDAPGIGLAAIQVGEPLRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ +    KNP VFINP+I++ SD  S ++EGCLSIPDY A+V+R A +TV+Y+D + +
Sbjct: 61  LDVAEKDEPKNPQVFINPEIVSRSDVPSFHEEGCLSIPDYYAEVERPAEVTVKYVDLDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            QI+ A G+LATCLQHE+DHLNG+LFID+LS+LKRDM+ +K  KL + R
Sbjct: 121 EQIVEAKGILATCLQHEIDHLNGVLFIDYLSKLKRDMVVRKFRKLAKDR 169


>gi|114705885|ref|ZP_01438788.1| peptide deformylase protein [Fulvimarina pelagi HTCC2506]
 gi|114538731|gb|EAU41852.1| peptide deformylase protein [Fulvimarina pelagi HTCC2506]
          Length = 173

 Score =  201 bits (511), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 124/169 (73%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+ S P+ +++  +    D+MLE MY   GIGLAA+Q+G   R++ 
Sbjct: 1   MTIKPLIILPDPVLRKTSEPVARVDDALKRFADDMLETMYEAPGIGLAAIQVGEPLRMLT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P VF+NP+I++ S+DFSVY+EGCLSIP+Y A+V+R A ++VRY+  + +
Sbjct: 61  IDISKEEEAKEPRVFLNPEIVSRSEDFSVYEEGCLSIPEYFAEVERPARVSVRYLGLDGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                A+GLLATCLQHE+DHLNG+LFID+LS+LKRDM+ KK +K  + +
Sbjct: 121 MHEEEAEGLLATCLQHEIDHLNGVLFIDYLSKLKRDMVIKKFTKAARTK 169


>gi|17988608|ref|NP_541241.1| peptide deformylase [Brucella melitensis bv. 1 str. 16M]
 gi|23500757|ref|NP_700197.1| peptide deformylase [Brucella suis 1330]
 gi|62317863|ref|YP_223716.1| peptide deformylase [Brucella abortus bv. 1 str. 9-941]
 gi|83269841|ref|YP_419132.1| peptide deformylase [Brucella melitensis biovar Abortus 2308]
 gi|148557936|ref|YP_001257946.1| peptide deformylase [Brucella ovis ATCC 25840]
 gi|161621082|ref|YP_001594968.1| peptide deformylase [Brucella canis ATCC 23365]
 gi|163845148|ref|YP_001622803.1| peptide deformylase [Brucella suis ATCC 23445]
 gi|225629484|ref|ZP_03787517.1| peptide deformylase [Brucella ceti str. Cudo]
 gi|225686789|ref|YP_002734761.1| peptide deformylase [Brucella melitensis ATCC 23457]
 gi|237817404|ref|ZP_04596396.1| peptide deformylase [Brucella abortus str. 2308 A]
 gi|256015794|ref|YP_003105803.1| peptide deformylase [Brucella microti CCM 4915]
 gi|17984410|gb|AAL53505.1| polypeptide deformylase [Brucella melitensis bv. 1 str. 16M]
 gi|23464412|gb|AAN34202.1| polypeptide deformylase [Brucella suis 1330]
 gi|62198056|gb|AAX76355.1| Def-2, polypeptide deformylase [Brucella abortus bv. 1 str. 9-941]
 gi|82940115|emb|CAJ13163.1| Formylmethionine deformylase [Brucella melitensis biovar Abortus
           2308]
 gi|148369221|gb|ABQ62093.1| peptide deformylase [Brucella ovis ATCC 25840]
 gi|161337893|gb|ABX64197.1| peptide deformylase [Brucella canis ATCC 23365]
 gi|163675871|gb|ABY39981.1| peptide deformylase [Brucella suis ATCC 23445]
 gi|225615980|gb|EEH13029.1| peptide deformylase [Brucella ceti str. Cudo]
 gi|225642894|gb|ACO02807.1| peptide deformylase [Brucella melitensis ATCC 23457]
 gi|237788217|gb|EEP62433.1| peptide deformylase [Brucella abortus str. 2308 A]
 gi|255998454|gb|ACU50141.1| peptide deformylase [Brucella microti CCM 4915]
          Length = 187

 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 119/169 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS+P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 13  MSVKPLIILPDPVLRQVSKPVERFDDQLRKFASDMFDTMYDAPGIGLAAIQVGEPIRMLV 72

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P +F+NP I+  SD  S Y+EGCLSIPDY A+V+R A + V Y D + +
Sbjct: 73  IDLAKEGEPKAPHIFVNPTIVQSSDKRSTYEEGCLSIPDYYAEVERPATVKVNYFDADGK 132

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 133 PQSMEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 181


>gi|254720138|ref|ZP_05181949.1| peptide deformylase [Brucella sp. 83/13]
 gi|265985144|ref|ZP_06097879.1| peptide deformylase [Brucella sp. 83/13]
 gi|306838492|ref|ZP_07471332.1| peptide deformylase [Brucella sp. NF 2653]
 gi|264663736|gb|EEZ33997.1| peptide deformylase [Brucella sp. 83/13]
 gi|306406424|gb|EFM62663.1| peptide deformylase [Brucella sp. NF 2653]
          Length = 175

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 119/169 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLIILPDPVLRQVSAPVERFDDQLRKFASDMFDTMYDAPGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P +FINP I+  SD+ S Y+EGCLSIPDY A+V+R A + V Y D + +
Sbjct: 61  IDLAKEGEPKAPHIFINPTIVQSSDERSTYEEGCLSIPDYYAEVERPATVKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 121 PQSMEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 169


>gi|118589715|ref|ZP_01547120.1| peptide deformylase [Stappia aggregata IAM 12614]
 gi|118437801|gb|EAV44437.1| peptide deformylase [Stappia aggregata IAM 12614]
          Length = 202

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 121/168 (72%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++  PDP+LR V  P+  ++ D+  L D+MLE MY   GIGLAA QIG+L R+ V
Sbjct: 31  MTIRPIITIPDPVLREVCAPVATVDDDVRKLADDMLETMYDAPGIGLAASQIGLLQRIFV 90

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K PMVFINPKI+  SDD SVYQEGCLSIPDY  +V+R A +TV++++    
Sbjct: 91  LDVAKDDAPKEPMVFINPKIVWSSDDLSVYQEGCLSIPDYYEEVERPAEVTVQFLNREGA 150

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            Q I ADGLLATC+QHELDHLNG LFID+LS+LKRD + KK +K  ++
Sbjct: 151 EQEIKADGLLATCIQHELDHLNGKLFIDYLSKLKRDRVVKKFTKQAKM 198


>gi|189023113|ref|YP_001932854.1| peptide deformylase [Brucella abortus S19]
 gi|254690651|ref|ZP_05153905.1| peptide deformylase [Brucella abortus bv. 6 str. 870]
 gi|254696044|ref|ZP_05157872.1| peptide deformylase [Brucella abortus bv. 3 str. Tulya]
 gi|254699153|ref|ZP_05160981.1| peptide deformylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700229|ref|ZP_05162057.1| peptide deformylase [Brucella suis bv. 5 str. 513]
 gi|254703350|ref|ZP_05165178.1| peptide deformylase [Brucella suis bv. 3 str. 686]
 gi|254705509|ref|ZP_05167337.1| peptide deformylase [Brucella pinnipedialis M163/99/10]
 gi|254710740|ref|ZP_05172551.1| peptide deformylase [Brucella pinnipedialis B2/94]
 gi|254732597|ref|ZP_05191175.1| peptide deformylase [Brucella abortus bv. 4 str. 292]
 gi|256029123|ref|ZP_05442737.1| peptide deformylase [Brucella pinnipedialis M292/94/1]
 gi|256043903|ref|ZP_05446822.1| peptide deformylase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256058806|ref|ZP_05449022.1| peptide deformylase [Brucella neotomae 5K33]
 gi|256111033|ref|ZP_05452095.1| peptide deformylase [Brucella melitensis bv. 3 str. Ether]
 gi|256157315|ref|ZP_05455233.1| peptide deformylase [Brucella ceti M490/95/1]
 gi|256253707|ref|ZP_05459243.1| peptide deformylase [Brucella ceti B1/94]
 gi|256255833|ref|ZP_05461369.1| peptide deformylase [Brucella abortus bv. 9 str. C68]
 gi|256262077|ref|ZP_05464609.1| peptide deformylase [Brucella melitensis bv. 2 str. 63/9]
 gi|260167785|ref|ZP_05754596.1| peptide deformylase [Brucella sp. F5/99]
 gi|260545098|ref|ZP_05820919.1| peptide deformylase [Brucella abortus NCTC 8038]
 gi|260565079|ref|ZP_05835564.1| peptide deformylase [Brucella melitensis bv. 1 str. 16M]
 gi|260567720|ref|ZP_05838189.1| peptide deformylase [Brucella suis bv. 4 str. 40]
 gi|260756222|ref|ZP_05868570.1| polypeptide deformylase [Brucella abortus bv. 6 str. 870]
 gi|260760409|ref|ZP_05872757.1| polypeptide deformylase [Brucella abortus bv. 4 str. 292]
 gi|260763649|ref|ZP_05875981.1| polypeptide deformylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882046|ref|ZP_05893660.1| peptide deformylase [Brucella abortus bv. 9 str. C68]
 gi|261216476|ref|ZP_05930757.1| polypeptide deformylase [Brucella abortus bv. 3 str. Tulya]
 gi|261220844|ref|ZP_05935125.1| peptide deformylase [Brucella ceti B1/94]
 gi|261312913|ref|ZP_05952110.1| peptide deformylase [Brucella pinnipedialis M163/99/10]
 gi|261318308|ref|ZP_05957505.1| peptide deformylase [Brucella pinnipedialis B2/94]
 gi|261322743|ref|ZP_05961940.1| peptide deformylase [Brucella neotomae 5K33]
 gi|261750724|ref|ZP_05994433.1| peptide deformylase [Brucella suis bv. 5 str. 513]
 gi|261753980|ref|ZP_05997689.1| peptide deformylase [Brucella suis bv. 3 str. 686]
 gi|261757222|ref|ZP_06000931.1| peptide deformylase [Brucella sp. F5/99]
 gi|265986106|ref|ZP_06098663.1| peptide deformylase [Brucella pinnipedialis M292/94/1]
 gi|265990325|ref|ZP_06102882.1| peptide deformylase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992568|ref|ZP_06105125.1| peptide deformylase [Brucella melitensis bv. 3 str. Ether]
 gi|265995800|ref|ZP_06108357.1| peptide deformylase [Brucella ceti M490/95/1]
 gi|294853988|ref|ZP_06794660.1| polypeptide deformylase [Brucella sp. NVSL 07-0026]
 gi|297249202|ref|ZP_06932903.1| polypeptide deformylase [Brucella abortus bv. 5 str. B3196]
 gi|54036953|sp|P63914|DEF_BRUSU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|54040741|sp|P63913|DEF_BRUME RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189021687|gb|ACD74408.1| Formylmethionine deformylase [Brucella abortus S19]
 gi|260098369|gb|EEW82243.1| peptide deformylase [Brucella abortus NCTC 8038]
 gi|260152722|gb|EEW87815.1| peptide deformylase [Brucella melitensis bv. 1 str. 16M]
 gi|260154385|gb|EEW89466.1| peptide deformylase [Brucella suis bv. 4 str. 40]
 gi|260670727|gb|EEX57667.1| polypeptide deformylase [Brucella abortus bv. 4 str. 292]
 gi|260674070|gb|EEX60891.1| polypeptide deformylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676330|gb|EEX63151.1| polypeptide deformylase [Brucella abortus bv. 6 str. 870]
 gi|260871574|gb|EEX78643.1| peptide deformylase [Brucella abortus bv. 9 str. C68]
 gi|260918083|gb|EEX84944.1| polypeptide deformylase [Brucella abortus bv. 3 str. Tulya]
 gi|260919428|gb|EEX86081.1| peptide deformylase [Brucella ceti B1/94]
 gi|261297531|gb|EEY01028.1| peptide deformylase [Brucella pinnipedialis B2/94]
 gi|261298723|gb|EEY02220.1| peptide deformylase [Brucella neotomae 5K33]
 gi|261301939|gb|EEY05436.1| peptide deformylase [Brucella pinnipedialis M163/99/10]
 gi|261737206|gb|EEY25202.1| peptide deformylase [Brucella sp. F5/99]
 gi|261740477|gb|EEY28403.1| peptide deformylase [Brucella suis bv. 5 str. 513]
 gi|261743733|gb|EEY31659.1| peptide deformylase [Brucella suis bv. 3 str. 686]
 gi|262550097|gb|EEZ06258.1| peptide deformylase [Brucella ceti M490/95/1]
 gi|262763438|gb|EEZ09470.1| peptide deformylase [Brucella melitensis bv. 3 str. Ether]
 gi|263000994|gb|EEZ13684.1| peptide deformylase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091766|gb|EEZ16097.1| peptide deformylase [Brucella melitensis bv. 2 str. 63/9]
 gi|264658303|gb|EEZ28564.1| peptide deformylase [Brucella pinnipedialis M292/94/1]
 gi|294819643|gb|EFG36643.1| polypeptide deformylase [Brucella sp. NVSL 07-0026]
 gi|297173071|gb|EFH32435.1| polypeptide deformylase [Brucella abortus bv. 5 str. B3196]
 gi|326411197|gb|ADZ68261.1| peptide deformylase [Brucella melitensis M28]
 gi|326554488|gb|ADZ89127.1| peptide deformylase [Brucella melitensis M5-90]
          Length = 175

 Score =  200 bits (508), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 119/169 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS+P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLIILPDPVLRQVSKPVERFDDQLRKFASDMFDTMYDAPGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P +F+NP I+  SD  S Y+EGCLSIPDY A+V+R A + V Y D + +
Sbjct: 61  IDLAKEGEPKAPHIFVNPTIVQSSDKRSTYEEGCLSIPDYYAEVERPATVKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 121 PQSMEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 169


>gi|239832661|ref|ZP_04680990.1| peptide deformylase [Ochrobactrum intermedium LMG 3301]
 gi|239824928|gb|EEQ96496.1| peptide deformylase [Ochrobactrum intermedium LMG 3301]
          Length = 175

 Score =  199 bits (505), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 119/167 (71%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS+P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLLILPDPVLRQVSKPVERFDDQLRKFAGDMFDTMYDAPGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P VFINP+I+  +D+ S Y+EGCLSIPDY A+V+R A I V Y D + +
Sbjct: 61  IDLAKEGEPKAPHVFINPEIVGVTDEASTYEEGCLSIPDYYAEVERPAAIKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL  
Sbjct: 121 PHAMEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLAS 167


>gi|254712790|ref|ZP_05174601.1| peptide deformylase [Brucella ceti M644/93/1]
 gi|254715859|ref|ZP_05177670.1| peptide deformylase [Brucella ceti M13/05/1]
 gi|261217620|ref|ZP_05931901.1| peptide deformylase [Brucella ceti M13/05/1]
 gi|261320497|ref|ZP_05959694.1| peptide deformylase [Brucella ceti M644/93/1]
 gi|260922709|gb|EEX89277.1| peptide deformylase [Brucella ceti M13/05/1]
 gi|261293187|gb|EEX96683.1| peptide deformylase [Brucella ceti M644/93/1]
          Length = 175

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 119/169 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS+P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLIILPDPVLRQVSKPVERFDDQLRKFASDMFDTMYDALGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P +F+NP I+  SD  S Y+EGCLSIPDY A+V+R A + V Y D + +
Sbjct: 61  IDLAKEGEPKAPHIFVNPTIVQSSDKRSTYEEGCLSIPDYYAEVERPATVKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 121 PQSMEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 169


>gi|306840227|ref|ZP_07473002.1| peptide deformylase [Brucella sp. BO2]
 gi|306289832|gb|EFM61011.1| peptide deformylase [Brucella sp. BO2]
          Length = 175

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 118/169 (69%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLIILPDPVLRQVSAPVERFDDQLRKFASDMFDTMYDAPGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P +F+NP I+  SD  S Y+EGCLSIPDY A+V+R A + V Y D + +
Sbjct: 61  IDLAKEGEPKAPHIFVNPTIVQSSDKRSTYEEGCLSIPDYYAEVERPATVKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 121 PQSMEADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 169


>gi|306846236|ref|ZP_07478798.1| peptide deformylase [Brucella sp. BO1]
 gi|306273487|gb|EFM55348.1| peptide deformylase [Brucella sp. BO1]
          Length = 175

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 118/169 (69%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDP+LR+VS P+E+ +  +     +M + MY   GIGLAA+Q+G   R++V
Sbjct: 1   MSVKPLIILPDPVLRQVSAPVERFDDQLRKFASDMFDTMYDAPGIGLAAIQVGEPIRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL      K P +F+NP I+  SD  S Y+EGCLSIPDY A+V+R A + V Y D + +
Sbjct: 61  IDLAKEGEPKAPHIFVNPTIVQSSDKCSTYEEGCLSIPDYYAEVERPATVKVNYFDADGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q + ADGL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ KK  KL   R
Sbjct: 121 PQSMDADGLMATCLQHEIDHLNGVLFIDHISKLKRDMVIKKFKKLASQR 169


>gi|319407942|emb|CBI81596.1| polypeptide deformylase [Bartonella schoenbuchensis R1]
          Length = 174

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 123/167 (73%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           K LV  PDPILR VS+P+E+I+  I  L D+MLE MY   GIGLAA+Q+GV  R++VID+
Sbjct: 2   KSLVTLPDPILREVSKPVEQIDLAIQKLADDMLETMYHAQGIGLAAIQVGVPLRMLVIDI 61

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            ++   KNP+V INP+I+  SD+ ++Y+EGCLSIP+Y A V+R   + VRY D   +   
Sbjct: 62  AENNTPKNPLVVINPEILWLSDERNIYKEGCLSIPEYYAQVERPKRLRVRYSDREGKQTE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           I AD LLATCLQHE+DHLNG LFIDH+S++KRDM+ +K+ K  + +D
Sbjct: 122 IEADDLLATCLQHEIDHLNGCLFIDHISKIKRDMVIRKLKKRAKEKD 168


>gi|154247233|ref|YP_001418191.1| peptide deformylase [Xanthobacter autotrophicus Py2]
 gi|154161318|gb|ABS68534.1| peptide deformylase [Xanthobacter autotrophicus Py2]
          Length = 172

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 86/170 (50%), Positives = 123/170 (72%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++I P+P LR +S  +EKI+S++  L+++M + MY   GIGLAA+Q+GV  R+V 
Sbjct: 1   MATRPILIIPEPKLRTLSASVEKIDSEVKKLVEDMFDTMYDAPGIGLAAIQVGVQRRVVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+      K P+  INP+II  S++ SVY EGCLSIP+Y  +V+R A +TVR+ D   Q
Sbjct: 61  IDVAREGEAKKPIALINPEIIAASEETSVYAEGCLSIPEYYEEVERPARVTVRFQDIEGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            + + ADGL ATC+QHE+DHLNG+LFIDH+S+LKRD + KK +KL + +D
Sbjct: 121 VREVAADGLFATCVQHEIDHLNGVLFIDHISKLKRDRVIKKFTKLARHKD 170


>gi|260461121|ref|ZP_05809370.1| peptide deformylase [Mesorhizobium opportunistum WSM2075]
 gi|259033155|gb|EEW34417.1| peptide deformylase [Mesorhizobium opportunistum WSM2075]
          Length = 176

 Score =  194 bits (494), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/159 (55%), Positives = 121/159 (76%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KPL+I PDPILR+VS+P+E++++ +  L D+ML  MY   GIGLAA+QIG   R++V
Sbjct: 1   MPIKPLIILPDPILRQVSKPVERVDAPLRGLADDMLATMYDAPGIGLAAIQIGEPLRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL        P VFINP+I+  +D  SVY+EGCLSIPDY A+V+R A + V+Y+D + +
Sbjct: 61  IDLAKEDETPAPHVFINPEILESADARSVYEEGCLSIPDYYAEVERPASVRVKYLDRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMIT 159
            Q + A+GL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ 
Sbjct: 121 LQEMEAEGLMATCLQHEIDHLNGVLFIDHISKLKRDMVV 159


>gi|319898269|ref|YP_004158362.1| polypeptide deformylase [Bartonella clarridgeiae 73]
 gi|319402233|emb|CBI75766.1| polypeptide deformylase [Bartonella clarridgeiae 73]
          Length = 171

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 90/161 (55%), Positives = 121/161 (75%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           KPLVI PDPILR VS+P+E I+S I  L D+MLE MY+  GIGLAAVQ+GV  R++V+D+
Sbjct: 4   KPLVILPDPILREVSKPVEHIDSIIQKLADDMLETMYNAQGIGLAAVQVGVPLRMLVLDI 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 KNP+V INP+I+  S++ ++Y+EGCLSIP+Y A+V+R  ++ + Y D   +   
Sbjct: 64  SSKDAPKNPLVVINPEILWISNERNIYREGCLSIPEYYAEVERPKYLRICYRDREGKQAE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           I AD LLATCLQHE+DHLNG LFIDH+S++KRDM+ +K  K
Sbjct: 124 IEADDLLATCLQHEIDHLNGCLFIDHISKIKRDMVIRKFKK 164


>gi|307943158|ref|ZP_07658503.1| peptide deformylase [Roseibium sp. TrichSKD4]
 gi|307773954|gb|EFO33170.1| peptide deformylase [Roseibium sp. TrichSKD4]
          Length = 196

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 122/168 (72%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+ ++  PD  LR V  P+E +++DI  L D+M E MY+  GIGLAA QIGVL RL V
Sbjct: 23  MTKRSILTIPDAQLREVCAPVETVDADIKALADDMFETMYAAPGIGLAASQIGVLKRLFV 82

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K+PMVFINPKI+  S+D SVYQEGCLSIPDY  D++R A + V++++ +  
Sbjct: 83  LDVAKEDAPKDPMVFINPKIVWSSEDTSVYQEGCLSIPDYYEDIERPAKVRVQFLNRDGA 142

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            Q + ADGLLATC+QHELDHL G LFID+LS+LKRD + KK +KL +L
Sbjct: 143 EQEMEADGLLATCIQHELDHLYGRLFIDYLSKLKRDRVMKKFNKLAKL 190


>gi|49473752|ref|YP_031794.1| polypeptide deformylase [Bartonella quintana str. Toulouse]
 gi|81696103|sp|Q6G1G6|DEF_BARQU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|49239255|emb|CAF25576.1| Polypeptide deformylase [Bartonella quintana str. Toulouse]
          Length = 176

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 120/161 (74%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           KPL+I PDPILR VS+P+E ++S I  L D+MLE MY   G+GLAA+QIG+  R++VID+
Sbjct: 4   KPLIILPDPILREVSKPVEHVDSTIQKLADDMLETMYDAQGVGLAAIQIGIPLRMLVIDV 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
             +  +KNP+V INP+I+  SD+ ++ +EGCLSIP+Y  +++R   + VRY D   +   
Sbjct: 64  SRNETQKNPLVIINPEILWLSDERNICKEGCLSIPEYYTEIERPKRLCVRYQDREGKQTE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           I AD LLATCLQHE+DHLNG LFIDH+S++KRDM+ +K  K
Sbjct: 124 IEADHLLATCLQHEIDHLNGRLFIDHISKIKRDMVIRKFKK 164


>gi|13474065|ref|NP_105633.1| peptide deformylase [Mesorhizobium loti MAFF303099]
 gi|23396550|sp|Q98D52|DEF_RHILO RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|14024817|dbj|BAB51419.1| N-formylmethionylaminoacyl-tRNA deformylase [Mesorhizobium loti
           MAFF303099]
          Length = 176

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/156 (55%), Positives = 120/156 (76%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           KPL+I PDPILR+VS+P+E++++ +  L D+ML  MY   GIGLAA+QIG   R++VIDL
Sbjct: 4   KPLIILPDPILRQVSKPVERVDAPLRKLADDMLATMYDAPGIGLAAIQIGEPLRMLVIDL 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                   P VFINP+I+  ++  SVY+EGCLSIPDY A+V+R A + V+Y+D + + Q 
Sbjct: 64  AKEDETPAPHVFINPEILESAEARSVYEEGCLSIPDYYAEVERPASVRVKYLDRDGKLQE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMIT 159
           + A+GL+ATCLQHE+DHLNG+LFIDH+S+LKRDM+ 
Sbjct: 124 MEAEGLMATCLQHEIDHLNGVLFIDHISKLKRDMVV 159


>gi|49474898|ref|YP_032939.1| polypeptide deformylase [Bartonella henselae str. Houston-1]
 gi|81696215|sp|Q6G5F0|DEF_BARHE RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|49237703|emb|CAF26892.1| Polypeptide deformylase [Bartonella henselae str. Houston-1]
          Length = 176

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PDPILR +S+P+E I+S +  L D+MLE MY   G+GLAA+QIG+  R++V
Sbjct: 1   MPMRPLVIVPDPILREISKPVEYIDSAVQKLADDMLETMYHAQGVGLAAIQIGIPLRMLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+  +  +KNP+V INP+++  SD+ ++Y+EGCLSIP+Y A+V+R   + VRY +   +
Sbjct: 61  LDVSRNDEQKNPLVIINPEVLWLSDERNIYKEGCLSIPEYFAEVERPKRLCVRYQNREGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              I AD LLATCLQHE+DHLNG LFID+LS++KRDM+ +K  K
Sbjct: 121 QTEIEADDLLATCLQHEIDHLNGRLFIDYLSKIKRDMVIRKFKK 164


>gi|307294614|ref|ZP_07574456.1| peptide deformylase [Sphingobium chlorophenolicum L-1]
 gi|306879088|gb|EFN10306.1| peptide deformylase [Sphingobium chlorophenolicum L-1]
          Length = 176

 Score =  191 bits (484), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/167 (55%), Positives = 120/167 (71%), Gaps = 7/167 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP LR +S P+E I++D+  LID+MLE MY   GIGLAA+Q+GV  R++VIDLQ
Sbjct: 5   PILEAPDPRLRTISSPVEAIDADLQRLIDDMLETMYDAPGIGLAAIQVGVPKRVLVIDLQ 64

Query: 65  -------DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDC 117
                  D    K PMVFINP+I+  S+D SVY EGCLS+PD  A+V+R A I   +MD 
Sbjct: 65  EPESDEEDAPPVKKPMVFINPEILEGSEDLSVYNEGCLSVPDQFAEVERPASIRASWMDR 124

Query: 118 NAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + +      +GLLATCLQHE+DHL G+LFIDHLSRLKRDM+ KK++K
Sbjct: 125 DGRIHEERLEGLLATCLQHEMDHLQGVLFIDHLSRLKRDMLMKKLTK 171


>gi|158422422|ref|YP_001523714.1| polypeptide or peptide deformylase family protein [Azorhizobium
           caulinodans ORS 571]
 gi|158329311|dbj|BAF86796.1| polypeptide or peptide deformylase family protein [Azorhizobium
           caulinodans ORS 571]
          Length = 172

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 86/160 (53%), Positives = 117/160 (73%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++I P+P LR++S P+ +I+ +I  L  +MLE MY   GIGLAA+Q+GV  R++ ID+ 
Sbjct: 5   PILIIPEPQLRQISAPVPRIDKEIEKLAADMLETMYDAPGIGLAAIQVGVHKRVITIDIA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                KNP+V INP++++ S++ S Y EGCLSIP+Y  +V+R A +TVRY D       I
Sbjct: 65  REDAPKNPIVLINPEVVSASEETSFYNEGCLSIPEYYEEVERPAQVTVRYQDLKGATHEI 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLATCLQHE+DHLNG+LFIDHLSRLKR+ + KK +K
Sbjct: 125 AADGLLATCLQHEIDHLNGVLFIDHLSRLKRERVIKKFTK 164


>gi|319406474|emb|CBI80115.1| polypeptide deformylase [Bartonella sp. 1-1C]
          Length = 176

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 122/167 (73%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           K LVI PDPILR VS+P+E+I+  I  L D+MLE MY+  GIGLAAVQ+GV  R++V+D+
Sbjct: 4   KSLVILPDPILREVSKPVERIDPIIQKLADDMLETMYNAQGIGLAAVQVGVPLRMLVVDI 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 KNP+V INP+I+  SD+ SVY+EGCLSIPDY A+V+R   + + Y D   +   
Sbjct: 64  HPKDAPKNPLVIINPEILWVSDERSVYKEGCLSIPDYFAEVERPKCLCMCYRDREGKQVE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           I A+ LLATCLQHE+DHLNG LFIDH+S+ KRDM+ +K  K  ++++
Sbjct: 124 IEANDLLATCLQHEIDHLNGCLFIDHISKTKRDMVIRKFKKRAKMQN 170


>gi|328545268|ref|YP_004305377.1| peptide deformylase 1 [polymorphum gilvum SL003B-26A1]
 gi|326415010|gb|ADZ72073.1| Peptide deformylase 1 [Polymorphum gilvum SL003B-26A1]
          Length = 172

 Score =  189 bits (481), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 119/164 (72%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+ ++I PDP+LR+   P+ K++  I  L D+MLE MY+  GIGLAA QIGVL RL V
Sbjct: 1   MTKRDILIIPDPVLRQHCEPVVKVDDAIRKLADDMLETMYAAPGIGLAASQIGVLKRLFV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      + PMVFINP+I+  S++ SVYQEGCLSIP+Y  +V+R A + VR+ + +  
Sbjct: 61  LDVAKEDQPRAPMVFINPEIVWASEEMSVYQEGCLSIPEYYEEVERPASVRVRFFNRDGD 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q + ADGLLATC+QHE DHLNG LFID+LS+LKRD + KK +K
Sbjct: 121 EQELQADGLLATCIQHEYDHLNGRLFIDYLSKLKRDRVVKKFAK 164


>gi|163867376|ref|YP_001608570.1| peptide deformylase [Bartonella tribocorum CIP 105476]
 gi|189083066|sp|A9ILK4|DEF_BART1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|161017017|emb|CAK00575.1| polypeptide deformylase [Bartonella tribocorum CIP 105476]
          Length = 178

 Score =  187 bits (476), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 123/166 (74%), Gaps = 2/166 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + LV  PDPILR VS+P+E++++ +  L D+MLE MY   GIGLAA+QIG+  R++V
Sbjct: 1   MPMRSLVTLPDPILREVSKPVEQVDTALQELADDMLETMYHAKGIGLAAIQIGIPLRMLV 60

Query: 61  IDLQDHAH--RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           ID+  +A   +K P+V INP+I+  SD+ +VY+EGCLSIPDY A+V+R   + VRY +  
Sbjct: 61  IDVSGNAEDTQKKPLVIINPEILWLSDERNVYKEGCLSIPDYFAEVERPKRLRVRYQNRE 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            + + I AD LLATCLQHE+DHL+G LFID++SR+KRDM+ +K  K
Sbjct: 121 GKQKEIEADDLLATCLQHEIDHLDGRLFIDYISRIKRDMVIRKFKK 166


>gi|319404989|emb|CBI78592.1| polypeptide deformylase [Bartonella sp. AR 15-3]
          Length = 171

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 118/161 (73%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           KPLVI PDPILR VS+P+E I+  I  L D+MLE MY+  G+GLAAVQ+G+  R++V+D+
Sbjct: 4   KPLVILPDPILREVSKPVEHIDPIIQKLADDMLETMYNAQGVGLAAVQVGIPLRMLVVDI 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 KN +V INP+I+  SD+ SVY+EGCLSIP+Y A+V+R   + + Y +   + + 
Sbjct: 64  SPKDAPKNSLVVINPEILWISDERSVYREGCLSIPEYFAEVERPKCLRISYKNREGKQEE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           I A+ LLATCLQHE+DHLNG LFIDH+S+ KRDM+ +K  K
Sbjct: 124 IEANDLLATCLQHEIDHLNGYLFIDHISKTKRDMVIRKFKK 164


>gi|323135726|ref|ZP_08070809.1| peptide deformylase [Methylocystis sp. ATCC 49242]
 gi|322398817|gb|EFY01336.1| peptide deformylase [Methylocystis sp. ATCC 49242]
          Length = 188

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 119/164 (72%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP LR+VS P+E+I+++I  L+D+MLE MY+  GIGLAA+Q+ V  R+VV+D+ 
Sbjct: 5   PIITLPDPRLRKVSEPVERIDAEIHRLLDDMLETMYAAPGIGLAAIQVAVAKRIVVVDIG 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                ++P+  INP+II  S++ S YQEGCLS+PDY  DVKR A + VR++D + Q Q  
Sbjct: 65  KTEDERSPLFLINPEIIWASEELSSYQEGCLSVPDYFDDVKRPAMVKVRHLDRHGQTQEF 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            A GLLAT +QHEL+HL G LFID+LSRLKR+ + KK SK  + 
Sbjct: 125 DAVGLLATVVQHELEHLEGGLFIDNLSRLKRERVVKKFSKAARF 168


>gi|294012439|ref|YP_003545899.1| N-formylmethionyl-tRNA deformylase [Sphingobium japonicum UT26S]
 gi|292675769|dbj|BAI97287.1| N-formylmethionyl-tRNA deformylase [Sphingobium japonicum UT26S]
          Length = 176

 Score =  187 bits (474), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 118/167 (70%), Gaps = 7/167 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP LR +S P+E I+ D+  LID+M E MY   GIGLAA+Q+GV  R++VIDLQ
Sbjct: 5   PILEAPDPRLRTISSPVEAIDDDLQRLIDDMFETMYDAPGIGLAAIQVGVPKRVLVIDLQ 64

Query: 65  DHAHR-------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDC 117
           +           K PMVFINP+I+  S+D SVY EGCLS+PD  A+V+R A I   +MD 
Sbjct: 65  EPESDEEGAPPVKKPMVFINPEILDGSEDLSVYNEGCLSVPDQFAEVERPASIRASWMDR 124

Query: 118 NAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + +      +GLLATCLQHE+DHL G+LFIDHLSRLKRDM+ KK++K
Sbjct: 125 DGRIHEERLEGLLATCLQHEMDHLQGVLFIDHLSRLKRDMLMKKLTK 171


>gi|319403561|emb|CBI77143.1| polypeptide deformylase [Bartonella rochalimae ATCC BAA-1498]
          Length = 176

 Score =  186 bits (473), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 121/167 (72%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           K LVI PDPILR VS+ +E+I+  I  L D+MLE MY+  GIGLAAVQ+GV  R++V+D+
Sbjct: 4   KSLVILPDPILREVSKLVERIDPIIQKLADDMLETMYNAQGIGLAAVQVGVPLRMLVVDI 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 KNP+V INP+I+  SD+ SVY+EGCLSIPDY A+V+R   + + Y D   +   
Sbjct: 64  HSKDAPKNPLVIINPEILWVSDERSVYKEGCLSIPDYFAEVERPKCLRMCYRDREGKQVE 123

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           I A+ LLATCLQHE+DHLNG LFIDH+S+ KRDM+ +K  K  ++++
Sbjct: 124 IEANDLLATCLQHEIDHLNGCLFIDHISKTKRDMVIRKFKKRAKMQN 170


>gi|332185304|ref|ZP_08387053.1| peptide deformylase [Sphingomonas sp. S17]
 gi|332015028|gb|EGI57084.1| peptide deformylase [Sphingomonas sp. S17]
          Length = 173

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 119/166 (71%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PDP LR VS+P+E ++  +  L+ +M+E MY   GIGLAA+Q+GV  R++VIDLQ
Sbjct: 5   PIVEVPDPRLRLVSKPVEAVDDSVRQLVTDMIETMYDAHGIGLAAIQVGVDKRVLVIDLQ 64

Query: 65  DHAHR-----KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +         KNP  +INP+I++ S++ S Y EGCLSIP+  A+VKR A   V+++D   
Sbjct: 65  EEEDEEGKPVKNPKAYINPEILSVSEELSTYNEGCLSIPEQYAEVKRPARCQVKWLDEKG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +      DGLLATC+QHE+DHLNG+LFIDH+SRLKRDM+ +K+SK+
Sbjct: 125 EAHEAEFDGLLATCMQHEMDHLNGVLFIDHVSRLKRDMLMRKLSKI 170


>gi|209886650|ref|YP_002290507.1| peptide deformylase [Oligotropha carboxidovorans OM5]
 gi|229487488|sp|B6JJP8|DEF_OLICO RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|209874846|gb|ACI94642.1| peptide deformylase [Oligotropha carboxidovorans OM5]
          Length = 171

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (69%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PD  LRRVS P+EKI S++  L ++M E MY   GIGLAA+Q+ V  RL+ 
Sbjct: 1   MAIREIISIPDKRLRRVSEPVEKITSEVRALAEDMFETMYDAPGIGLAAIQVAVPLRLIT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL        P VFINP+I++ S+D +VY+EGCLSIP+Y  +V+R A + VR+MD   +
Sbjct: 61  MDLAKKEGESAPRVFINPEILSKSEDIAVYEEGCLSIPEYYEEVERPASVRVRFMDLEGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
                A+GL ATC+QHE+DHLNG+LFID+LS+LKRD + KK +K  +L
Sbjct: 121 VHEEDAEGLFATCIQHEIDHLNGVLFIDYLSKLKRDRVMKKFTKAAKL 168


>gi|240849749|ref|YP_002971137.1| polypeptide deformylase [Bartonella grahamii as4aup]
 gi|240266872|gb|ACS50460.1| polypeptide deformylase [Bartonella grahamii as4aup]
          Length = 178

 Score =  184 bits (466), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 86/166 (51%), Positives = 122/166 (73%), Gaps = 2/166 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + LV  PDPILR VS+P+++++S +  L D+MLE MY+  GIGLAA+QIG+  R++V
Sbjct: 1   MPMRSLVTLPDPILREVSKPVDQVDSALQKLADDMLETMYNAKGIGLAAIQIGIPLRMLV 60

Query: 61  IDLQDHAH--RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           ID+  ++   RK P V INP+I+  SD+ ++Y+EGCLSIPDY A+V+R   + VRY +  
Sbjct: 61  IDVSGNSEDERKKPFVIINPEILWLSDERNIYKEGCLSIPDYFAEVERPKRLCVRYQNRE 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            +   I AD LLATCLQHE+DHL+G LFID++S++KRDM+ +K  K
Sbjct: 121 GKQTEIEADDLLATCLQHEIDHLDGRLFIDYISKIKRDMVIRKFKK 166


>gi|23009516|ref|ZP_00050535.1| COG0242: N-formylmethionyl-tRNA deformylase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 171

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PD  LR +S P+E +  +I  L  +M+E MY   G+GLAA+QIGV  R+V 
Sbjct: 1   MTVRPLVILPDAQLRLISEPVEAVTDEIRTLARDMIETMYDAPGVGLAAIQIGVPKRVVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID       KNP V++NP+I+  S++  VY EGCLSIP++  +V+R   + VRYM  + +
Sbjct: 61  IDTSKDETAKNPTVYLNPEIVWASEEKRVYDEGCLSIPEFYGEVERPDRVRVRYMTLDGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLATCLQHE+DHLNG+LFIDHLS+LKRD + KK SK  +
Sbjct: 121 TVEREADGLLATCLQHEIDHLNGVLFIDHLSKLKRDRVMKKFSKAAK 167


>gi|94495737|ref|ZP_01302317.1| polypeptide deformylase [Sphingomonas sp. SKA58]
 gi|94425125|gb|EAT10146.1| polypeptide deformylase [Sphingomonas sp. SKA58]
          Length = 176

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (69%), Gaps = 7/171 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++  PDP LR +S  ++ I+ D+  LID+M + MY   GIGLAA+Q+GV  R++V
Sbjct: 1   MAIRPILEAPDPRLRTISTRVDAIDDDLQTLIDDMFDTMYDAPGIGLAAIQVGVPKRVLV 60

Query: 61  IDLQDHAHR-------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVR 113
           IDLQ+           KNPMVFINP+I+  SDD SVY EGCLS+PD  A+V+R + I   
Sbjct: 61  IDLQEPESDEEGAPPVKNPMVFINPEILKGSDDLSVYNEGCLSVPDQFAEVERPSVIRAS 120

Query: 114 YMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           +MD   +      +GLLATCLQHE+DHL GILFIDHLSRLKRDM+ KK++K
Sbjct: 121 WMDREGRIHEEQLEGLLATCLQHEMDHLEGILFIDHLSRLKRDMLMKKLNK 171


>gi|170749551|ref|YP_001755811.1| peptide deformylase [Methylobacterium radiotolerans JCM 2831]
 gi|170656073|gb|ACB25128.1| peptide deformylase [Methylobacterium radiotolerans JCM 2831]
          Length = 171

 Score =  183 bits (465), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/167 (50%), Positives = 116/167 (69%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PDP+LR  S P+  I ++I  L+ +M E MY   G+GLAA+QIGV  R+V 
Sbjct: 1   MTIRPLVILPDPVLRLGSEPVGPITAEIRTLVADMFETMYDAPGVGLAAIQIGVPKRVVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID       ++  VFINP+I+  S++  VY EGCLSIPDY A+V+R   + V++ D +  
Sbjct: 61  IDTSKEEGVRDARVFINPEIVWSSEEKRVYDEGCLSIPDYYAEVERPDRVRVKFRDLDGT 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            + I ADGLL+TC+QHE+DHLNG+LFIDHLS+LKRD + KK +K  +
Sbjct: 121 EREIEADGLLSTCIQHEIDHLNGVLFIDHLSKLKRDRVIKKFTKAAK 167


>gi|296447194|ref|ZP_06889124.1| peptide deformylase [Methylosinus trichosporium OB3b]
 gi|296255253|gb|EFH02350.1| peptide deformylase [Methylosinus trichosporium OB3b]
          Length = 179

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 113/164 (68%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++  PDP LR VS P+  I+++I  L+D+MLE MY   G+GLAA+Q+ V  R++V
Sbjct: 1   MAIRPIITLPDPRLRLVSEPVAVIDAEIRQLLDDMLETMYDAPGVGLAAIQVAVAKRILV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D       KNPMVFINP+I+  S++  VYQEGCLS+PDY  +V+R A + V ++D    
Sbjct: 61  ADATRGDEPKNPMVFINPQIVWASEELGVYQEGCLSVPDYFEEVQRPARVRVSFLDREGA 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              I ADGLLAT LQHE+DHL G LFIDHLSRLKR+ + KK  K
Sbjct: 121 TCEIEADGLLATVLQHEIDHLEGGLFIDHLSRLKRERVVKKFVK 164


>gi|163851063|ref|YP_001639106.1| peptide deformylase [Methylobacterium extorquens PA1]
 gi|218529893|ref|YP_002420709.1| peptide deformylase [Methylobacterium chloromethanicum CM4]
 gi|240138197|ref|YP_002962669.1| peptide deformylase [Methylobacterium extorquens AM1]
 gi|254560757|ref|YP_003067852.1| peptide deformylase [Methylobacterium extorquens DM4]
 gi|163662668|gb|ABY30035.1| peptide deformylase [Methylobacterium extorquens PA1]
 gi|218522196|gb|ACK82781.1| peptide deformylase [Methylobacterium chloromethanicum CM4]
 gi|240008166|gb|ACS39392.1| peptide deformylase [Methylobacterium extorquens AM1]
 gi|254268035|emb|CAX23906.1| peptide deformylase [Methylobacterium extorquens DM4]
          Length = 171

 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/167 (50%), Positives = 114/167 (68%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PD  LR  S P+  +  +I  L  +M+E MY   G+GLAA+QIGV  R+V 
Sbjct: 1   MTVRPLVILPDAQLRLTSEPVAAVTDEIRTLARDMIETMYDAPGVGLAAIQIGVAKRVVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID     + KNP V++NP+I+  S++  VY EGCLSIP++  +V+R   + VRYM+ + Q
Sbjct: 61  IDTSKDENAKNPTVYLNPEIVWVSEEKRVYDEGCLSIPEFYGEVERPDRVRVRYMNLDGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLATCLQHE+DHLNG+LFIDHLS+LKRD + KK +K  +
Sbjct: 121 IVEQEADGLLATCLQHEIDHLNGVLFIDHLSKLKRDRVMKKFTKAAK 167


>gi|188580852|ref|YP_001924297.1| peptide deformylase [Methylobacterium populi BJ001]
 gi|179344350|gb|ACB79762.1| peptide deformylase [Methylobacterium populi BJ001]
          Length = 171

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 114/167 (68%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PD  LR +S P+  +  +I  L  +M+E MY   G+GLAA+QIGV  R+V 
Sbjct: 1   MTVRPLVILPDAQLRLISEPVGTVTEEIRTLARDMIETMYDAPGVGLAAIQIGVAKRVVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID     + KNP V++NP+I+  S++  VY EGCLSIP++  +V+R   + VRYM  + +
Sbjct: 61  IDTSKDENAKNPTVYLNPEIVWSSEEKRVYDEGCLSIPEFYGEVERPDRVRVRYMTLDGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLATCLQHE+DHLNG+LFIDHLS+LKRD + KK +K  +
Sbjct: 121 TVEQEADGLLATCLQHEIDHLNGVLFIDHLSKLKRDRVMKKFTKAAK 167


>gi|330813514|ref|YP_004357753.1| peptide deformylase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486609|gb|AEA81014.1| peptide deformylase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 170

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 80/155 (51%), Positives = 112/155 (72%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR 69
           PDPILR+ S P++++N +I  L+ NMLE MY+  GIGLAAVQ+G+L R++VID+      
Sbjct: 10  PDPILRKKSLPVKEVNGEIKKLMKNMLETMYAAPGIGLAAVQVGILKRIIVIDISGETSL 69

Query: 70  KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGL 129
           K P+ F+NPKI+  SD     QEGCLSIP +  ++KR     V+Y+D + + + + ADGL
Sbjct: 70  KKPIFFVNPKIVWKSDILETKQEGCLSIPGHFGNIKRPEACHVKYLDYSGKEKTLKADGL 129

Query: 130 LATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LATC+QHE+DH NG LFID+LS+LK+  I KK++K
Sbjct: 130 LATCIQHEIDHCNGTLFIDYLSKLKKAFIIKKLTK 164


>gi|304320578|ref|YP_003854221.1| peptide deformylase [Parvularcula bermudensis HTCC2503]
 gi|303299480|gb|ADM09079.1| peptide deformylase [Parvularcula bermudensis HTCC2503]
          Length = 170

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 115/164 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P+V  PDP LR +S P++ ++ ++  L+D+MLE MY+  GIGLAA+QIGV  R++V
Sbjct: 1   MTIRPIVTAPDPRLREISTPVDGVDDELRALMDDMLETMYAAPGIGLAAIQIGVPKRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL        P  F+NP I   + D + YQEGCLS+PDY  +++R A  TV Y+D +  
Sbjct: 61  MDLAGEGEPPAPRYFVNPVIRNPATDLAPYQEGCLSVPDYYEEIERPATCTVDYLDYDGT 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            + + A+GLLATC+QHE+DHL G+LFIDHLSRLKR+ I KK+ +
Sbjct: 121 PRTLEAEGLLATCIQHEMDHLEGVLFIDHLSRLKRERILKKLKR 164


>gi|310815113|ref|YP_003963077.1| peptide deformylase [Ketogulonicigenium vulgare Y25]
 gi|308753848|gb|ADO41777.1| peptide deformylase [Ketogulonicigenium vulgare Y25]
          Length = 173

 Score =  181 bits (458), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 116/169 (68%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++I PDP LR +++P+  I+ +I  L D+MLE MY   GIGLA  Q+G L R++V
Sbjct: 1   MTTRPILIHPDPRLRAIAKPLPDISDEIRRLADDMLETMYDAPGIGLAGPQVGQLQRIIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D         P+V +NP+I+  SDD SVY+EGCLSIPD  A+V+R A + VR++D N  
Sbjct: 61  LDCAKDPDAPQPLVMVNPQIVWSSDDRSVYEEGCLSIPDQYAEVERPASVKVRWLDLNGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    +GL ATC+QHE+DHL+G LFID+L  +KR +IT+KM KL + R
Sbjct: 121 EQDREMEGLWATCVQHEIDHLDGKLFIDYLGPMKRQLITRKMEKLKRER 169


>gi|260426170|ref|ZP_05780149.1| peptide deformylase [Citreicella sp. SE45]
 gi|260420662|gb|EEX13913.1| peptide deformylase [Citreicella sp. SE45]
          Length = 176

 Score =  180 bits (457), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/170 (50%), Positives = 121/170 (71%), Gaps = 2/170 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L+++  P+  ++ D+  L D+MLE MY   GIGLAA Q+G+L+RL+V+
Sbjct: 4   MKRPILIHPDPRLKKLCDPVADLSDDLRTLADDMLETMYDAPGIGLAAPQVGILHRLIVL 63

Query: 62  DL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           D   QD+     P+V INP+I+  SD+ SVY+EGCLSIPD  ADV+R   + V ++D + 
Sbjct: 64  DCAKQDNGETPRPLVMINPRILASSDERSVYEEGCLSIPDQYADVERPKMVEVEWLDRDG 123

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 124 KLQKEEFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMVKLKRER 173


>gi|121602173|ref|YP_989567.1| peptide deformylase [Bartonella bacilliformis KC583]
 gi|158513863|sp|A1UUB4|DEF_BARBK RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|120614350|gb|ABM44951.1| peptide deformylase [Bartonella bacilliformis KC583]
          Length = 182

 Score =  180 bits (456), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 83/167 (49%), Positives = 120/167 (71%), Gaps = 6/167 (3%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           KPLVI PDPILR +S+P+E I+S I  L D+MLE MY+  GIGLAA+Q+G+  R++V+D+
Sbjct: 4   KPLVILPDPILREISKPVEHIDSTIQQLADDMLETMYNAGGIGLAAIQVGIPLRMLVVDV 63

Query: 64  Q------DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDC 117
                  +    ++P++ INP+I+  SD+ ++  EGCLSIP Y A+V+R   + +RY + 
Sbjct: 64  SIFTSIFEPDAPQDPIIVINPEILWLSDERNICMEGCLSIPGYSAEVERPKRLCIRYRNR 123

Query: 118 NAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             + + I AD +LATCLQHE+DHLNG LFIDHLS++KR+M+ +K  K
Sbjct: 124 EGEQKEIEADNILATCLQHEIDHLNGCLFIDHLSKVKRNMVIRKFEK 170


>gi|182677492|ref|YP_001831638.1| peptide deformylase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633375|gb|ACB94149.1| peptide deformylase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 193

 Score =  180 bits (456), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 119/176 (67%), Gaps = 9/176 (5%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDP+LRRV  P+  ++S+I  L+D+MLE MY   GIGLAA QI V+ R++V
Sbjct: 1   MALRSIITIPDPLLRRVCDPVADVDSEIRRLMDDMLETMYDAPGIGLAASQIAVMKRVIV 60

Query: 61  IDL------QDHAHR---KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFIT 111
           +D+      +D A       P+   NP+I+  S++ S Y+EGCLSIPDY  +V R A + 
Sbjct: 61  MDVAKRRKGEDGAEADVAPQPLALANPEILWASEELSTYEEGCLSIPDYYEEVVRPARVR 120

Query: 112 VRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           V Y+D   Q Q + ADG+LATC+QHE+DHLNG+LFIDH+SRLKR+ I KK SK  +
Sbjct: 121 VGYLDRQGQRQELEADGILATCVQHEIDHLNGVLFIDHISRLKRERIVKKFSKAAK 176


>gi|103485746|ref|YP_615307.1| peptide deformylase [Sphingopyxis alaskensis RB2256]
 gi|98975823|gb|ABF51974.1| peptide deformylase [Sphingopyxis alaskensis RB2256]
          Length = 180

 Score =  179 bits (455), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 116/169 (68%), Gaps = 8/169 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP LR +S+P+E  ++++  L+ +M E MY   GIGLAA+Q+GV  R++VIDLQ
Sbjct: 8   PIIETPDPRLRVISKPVETFDAELKQLVADMFETMYDAPGIGLAAIQVGVPKRILVIDLQ 67

Query: 65  DHAHR--------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +            + P VFINP    FSD+ SVYQEGCLS+P+  ADV R A +TV + D
Sbjct: 68  EADPEDPEGKKVIRTPRVFINPVFSDFSDEHSVYQEGCLSVPEQYADVTRPAEVTVDWQD 127

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            + +H      GL+ATC+QHE DHL GILFIDHLSRLKR+M+ KK++KL
Sbjct: 128 EDGKHHQERMTGLMATCIQHEHDHLEGILFIDHLSRLKREMVLKKLAKL 176


>gi|299132603|ref|ZP_07025798.1| peptide deformylase [Afipia sp. 1NLS2]
 gi|298592740|gb|EFI52940.1| peptide deformylase [Afipia sp. 1NLS2]
          Length = 189

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 117/168 (69%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PD  LR VS P++KI  +I  L ++M E MY   GIGLAA+Q+ V  RL+ 
Sbjct: 19  MAIREIISIPDKRLRLVSEPVDKITPEIRALAEDMFETMYDAPGIGLAAIQVAVPLRLIT 78

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+      K P VFINP+I++ SDD SVY+EGCLSIP+Y  +V+R A + +RYMD + +
Sbjct: 79  MDVSKKEGEKVPRVFINPEILSKSDDVSVYEEGCLSIPEYYEEVERPASVRIRYMDLDGK 138

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
                A+GL ATC+QHE+DH+NG+LFID+LS+LKRD + KK +K  +L
Sbjct: 139 VHEEDAEGLFATCIQHEIDHINGVLFIDYLSKLKRDRVMKKFTKAAKL 186


>gi|300024230|ref|YP_003756841.1| peptide deformylase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526051|gb|ADJ24520.1| peptide deformylase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 171

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/163 (47%), Positives = 117/163 (71%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP+LR++S P+E+++  ++ L+D+MLE MY   GIGLAAVQ+GVL R++V+D  
Sbjct: 5   PIITIPDPVLRKISDPVERVDDAVVKLMDDMLETMYDAPGIGLAAVQVGVLKRVLVVDAA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +     NP+   NP+++       +++EGCLSIPD   +++R A +TVRY+D + + Q +
Sbjct: 65  EDGAPHNPIAMANPELVALGSTTRLHEEGCLSIPDVHVEIERPASVTVRYIDRHGKEQEL 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            A+GLLAT +QHELDHL+G L ID LSRLKRDM+ +K  K V+
Sbjct: 125 AAEGLLATAVQHELDHLDGQLIIDFLSRLKRDMVIRKFKKQVR 167


>gi|260432735|ref|ZP_05786706.1| peptide deformylase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416563|gb|EEX09822.1| peptide deformylase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 172

 Score =  177 bits (450), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/165 (52%), Positives = 118/165 (71%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L++V  P++ ++ ++  L D+MLE MY   GIGLAA QIGVL RL+V+
Sbjct: 1   MKRNILIHPDPRLKKVCAPVDDLSDELRALADDMLETMYDAPGIGLAAPQIGVLERLIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP+II+ SD+ SVY+EGCLSIPD  A+V R A + V +MD N +
Sbjct: 61  DCVKEEGATPRPLVMFNPEIISASDETSVYEEGCLSIPDQFAEVTRPAEVEVAWMDQNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q    DGL ATC+QHE+DHLNG LFID+L  LKR MIT+KM KL
Sbjct: 121 AQRETFDGLWATCVQHEIDHLNGKLFIDYLKPLKRQMITRKMVKL 165


>gi|288959246|ref|YP_003449587.1| peptide deformylase [Azospirillum sp. B510]
 gi|288911554|dbj|BAI73043.1| peptide deformylase [Azospirillum sp. B510]
          Length = 170

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 122/165 (73%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M + P+++ P PIL+R ++P+ ++++ ++ L+D+M+E MY   GIGLAA Q+GVL R++V
Sbjct: 1   MARLPILVAPHPILKRKAQPVAEVDARVVKLMDDMVETMYDAAGIGLAAPQVGVLDRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ +     NP+   NP+II  S+D +V +EGCLS+P+  A+V R   + VRY+D   Q
Sbjct: 61  VDVHEKGEPPNPIRLANPEIIWSSEDKAVCEEGCLSVPEQYAEVTRPQRVRVRYLDERNQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q I A+G+LATCLQHE+DHLNG+LF+D+LS LKR+++ KK+ K+
Sbjct: 121 PQEIEAEGMLATCLQHEIDHLNGVLFVDYLSMLKRNILLKKVQKM 165


>gi|298290074|ref|YP_003692013.1| peptide deformylase [Starkeya novella DSM 506]
 gi|296926585|gb|ADH87394.1| peptide deformylase [Starkeya novella DSM 506]
          Length = 182

 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 128/178 (71%), Gaps = 8/178 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PD  LR +S PI ++++ +  ++++M E MY   GIGLAAVQ+G+  R++ 
Sbjct: 1   MSIRPLVIIPDSRLRLISDPIVRVDARVRAIVEDMFETMYDAPGIGLAAVQVGIPERIIT 60

Query: 61  IDL--------QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
           +D+        +    +KNP+  INP+II+ S++ SVY EGCLSIP+Y ADV+R A + V
Sbjct: 61  VDVVRREEGEEEGAEEKKNPIALINPEIISSSEEISVYSEGCLSIPEYYADVERPARVKV 120

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           RYMD N + Q I ADGLLATC+QHE+DHLNG+LFIDH+S+LKRD + KK +K+ + ++
Sbjct: 121 RYMDLNGETQEIDADGLLATCVQHEIDHLNGVLFIDHISKLKRDRVMKKFTKIAKEKE 178


>gi|218510166|ref|ZP_03508044.1| peptide deformylase [Rhizobium etli Brasil 5]
          Length = 133

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 78/131 (59%), Positives = 102/131 (77%)

Query: 39  MYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIP 98
           MY   GIGLAA+QIGV  R++VID+      K P VFINP+I+  SD+ SVY+EGCLSIP
Sbjct: 1   MYDAPGIGLAAIQIGVPRRMLVIDVSREGEEKQPQVFINPEIVKSSDERSVYEEGCLSIP 60

Query: 99  DYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
           DY A+V+R A ++V+Y+D N + Q + ADGLLATCLQHE+DHLNG+LFIDH+SRLKR+M+
Sbjct: 61  DYYAEVERPAVVSVKYLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDHISRLKREMV 120

Query: 159 TKKMSKLVQLR 169
            KK +K  + +
Sbjct: 121 IKKFTKAAKSK 131


>gi|296284446|ref|ZP_06862444.1| peptide deformylase [Citromicrobium bathyomarinum JL354]
          Length = 190

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 122/186 (65%), Gaps = 21/186 (11%)

Query: 1   MVKKPLVIFPDPILRRVSRPIE--KINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRL 58
           M  + ++  PDP L+ VS+P+E  + + D+  L+D+M E MY+ +GIGLAA+Q+GV  R+
Sbjct: 1   MAIREILEVPDPRLKTVSQPVEAGEFDDDLRTLVDDMFETMYAANGIGLAAIQVGVPKRI 60

Query: 59  VVIDLQ-----------DH--------AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPD 99
           +VIDLQ           DH        A +K P VFINP+I+  +++ + YQEGCLS+PD
Sbjct: 61  LVIDLQPEDPDAEPIECDHDGHKHTHPATKKEPRVFINPEILDPNEELATYQEGCLSVPD 120

Query: 100 YRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMIT 159
             ADV R A  TVR+ D + +      +GLLATC+QHE+DHL GILFIDHLSRLKR M  
Sbjct: 121 IYADVDRPATCTVRWKDLDGKEHTEAMEGLLATCIQHEMDHLEGILFIDHLSRLKRQMAL 180

Query: 160 KKMSKL 165
           KK+ KL
Sbjct: 181 KKLKKL 186


>gi|91762408|ref|ZP_01264373.1| peptide deformylase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718210|gb|EAS84860.1| peptide deformylase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 172

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 120/169 (71%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KP++  P+ +LR++S+P+E +  +   L+D+ML+ MY+  GIGLAA+QIGV  R++V
Sbjct: 1   MSVKPILTEPNKLLRQISKPVENVGDEERRLMDDMLDTMYAAPGIGLAAIQIGVPKRIIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+     +K P  F+NP I   +D  S Y+EGCLS+PD  A+++R     V Y+D N +
Sbjct: 61  MDISRDEDKKEPRYFVNPLIKNKNDITSKYEEGCLSVPDQFAEIERPNECEVEYLDYNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q++ ADGLLATC+QHE+DHL G+LFID+LS+LK+ MI KK+SK+   R
Sbjct: 121 KQLLKADGLLATCIQHEMDHLEGVLFIDYLSKLKKSMIIKKLSKIKSNR 169


>gi|87200909|ref|YP_498166.1| peptide deformylase [Novosphingobium aromaticivorans DSM 12444]
 gi|123763380|sp|Q2G491|DEF_NOVAD RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|87136590|gb|ABD27332.1| peptide deformylase [Novosphingobium aromaticivorans DSM 12444]
          Length = 188

 Score =  176 bits (445), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 120/184 (65%), Gaps = 19/184 (10%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDP L++VS P+EK + ++  L+++M E MY   GIGLAA+Q+GV  R++V
Sbjct: 1   MAIREIIEVPDPRLKQVSVPVEKFDDELKTLVEDMFETMYDAPGIGLAAIQVGVPLRVLV 60

Query: 61  IDLQD-------------------HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYR 101
           IDLQ                       +K P VFINP+I+  S+++SVYQEGCLS+P+  
Sbjct: 61  IDLQPDDPDAEPVACDHDGHHHHHQPTKKEPRVFINPEILDPSEEYSVYQEGCLSVPEIY 120

Query: 102 ADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK 161
           A+V+R A I  R+ D + +      +GL+ATCLQHE+DHL G+LFIDHLSRLKR+M  KK
Sbjct: 121 AEVERPATIRARWQDLDGKVHEEQMEGLMATCLQHEMDHLEGVLFIDHLSRLKRNMALKK 180

Query: 162 MSKL 165
           + KL
Sbjct: 181 LEKL 184


>gi|254473716|ref|ZP_05087111.1| peptide deformylase [Pseudovibrio sp. JE062]
 gi|211957102|gb|EEA92307.1| peptide deformylase [Pseudovibrio sp. JE062]
          Length = 175

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/170 (51%), Positives = 113/170 (66%), Gaps = 6/170 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +   P+  LR    PIE IN +I  L D+ML+ MY   GIGLAA QIGV+ R+ V
Sbjct: 1   MTIREIKFVPEACLREKCAPIEDINDEIRTLADDMLQTMYDAPGIGLAASQIGVMKRMFV 60

Query: 61  IDL------QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRY 114
           +D+      +D +  K PMVFINP+I   S++ + YQEGCLSIP    DV+R A + V +
Sbjct: 61  LDVAERESEEDDSVEKEPMVFINPEITWSSEEKNTYQEGCLSIPGIYEDVERPAEVRVSF 120

Query: 115 MDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ++   + Q I A GLLATC+QHELDHLNG+LFID+LSRLKRD I KKM K
Sbjct: 121 LNIEGEKQEIEAGGLLATCIQHELDHLNGVLFIDYLSRLKRDRIVKKMIK 170


>gi|27383220|ref|NP_774749.1| peptide deformylase [Bradyrhizobium japonicum USDA 110]
 gi|39930882|sp|Q89BN9|DEF_BRAJA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|27356394|dbj|BAC53374.1| polypeptide deformylase [Bradyrhizobium japonicum USDA 110]
          Length = 174

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 117/171 (68%), Gaps = 4/171 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR VS+PIEK+ ++I  L D+M E MY   GIGLAA+QI    RL+ 
Sbjct: 1   MALREIIILPDKQLRLVSKPIEKVTTEIRKLADDMFETMYDAPGIGLAAIQIAQPLRLIT 60

Query: 61  IDL----QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +DL    ++   +  P VFINP++I  S++ SVY+EGCLSIP+Y  +V+R A + VR+ D
Sbjct: 61  MDLAKRDENGETKPEPRVFINPEVIASSEELSVYEEGCLSIPEYYEEVERPAKVRVRFTD 120

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            + +     A+GL ATC+QHE+DHLNG+LF+D+LS+LKRD + KK  K  +
Sbjct: 121 LDGKVHEEDAEGLYATCIQHEIDHLNGVLFVDYLSKLKRDRVLKKFEKAAK 171


>gi|217977312|ref|YP_002361459.1| peptide deformylase [Methylocella silvestris BL2]
 gi|254767594|sp|B8ENG6|DEF_METSB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|217502688|gb|ACK50097.1| peptide deformylase [Methylocella silvestris BL2]
          Length = 196

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 120/171 (70%), Gaps = 3/171 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++I PD  LR V+RP+  ++S++  L+D+MLE MY   GIGLAA QI V  R++V
Sbjct: 1   MPLRPIIILPDKRLRLVARPVASVDSEVRALMDDMLETMYEAPGIGLAATQIAVDRRVIV 60

Query: 61  IDL---QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDC 117
           +D+   +D + + +P+   NP+I+  S++ S Y+EGCLSIP++  +V R   + V Y+D 
Sbjct: 61  LDVAKRRDDSAKADPICLANPEILWASEELSSYEEGCLSIPEFYEEVFRPEKVRVGYLDR 120

Query: 118 NAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           + + + I ADGLLATCLQHE+DHLNG+LFIDH+SRLKR  I KK  K  +L
Sbjct: 121 DGRRREIEADGLLATCLQHEIDHLNGVLFIDHISRLKRARIIKKFEKAAKL 171


>gi|84685501|ref|ZP_01013399.1| peptide deformylase [Maritimibacter alkaliphilus HTCC2654]
 gi|84666658|gb|EAQ13130.1| peptide deformylase [Rhodobacterales bacterium HTCC2654]
          Length = 173

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 118/170 (69%), Gaps = 1/170 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  KP++I PDP L++ +  +  +  +++ L D+MLE MY   GIGLAA Q+GVL RL+V
Sbjct: 1   MALKPILIHPDPRLKKEAEKVRDVTDELLTLADDMLETMYDAPGIGLAAPQVGVLQRLIV 60

Query: 61  ID-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D ++D +    P+V  NP++I  SDD +VY+EGCLSIPD  A+V R A + VR+++   
Sbjct: 61  LDCIKDESAEPQPLVMFNPEVILSSDDTNVYEEGCLSIPDQYAEVTRPAAVKVRWLNRAG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + Q    +GL ATC+QHE+DHLNG LFID+LS +KR MIT+K  KL + R
Sbjct: 121 EEQERDFEGLWATCVQHEIDHLNGKLFIDYLSPMKRQMITRKSQKLKRER 170


>gi|260752714|ref|YP_003225607.1| peptide deformylase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552077|gb|ACV75023.1| peptide deformylase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 177

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 115/170 (67%), Gaps = 4/170 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP LR  S  +E  + ++  LID+M E MY   GIGLAA+Q+GV  RL+VIDLQ
Sbjct: 5   PILEVPDPRLREKSTVVEVFDDNLQRLIDDMFETMYKAPGIGLAAIQVGVAKRLLVIDLQ 64

Query: 65  ----DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
               D   ++NPMVFINP++    ++  +Y EGCLS+PD  A+V+R + I  ++ D +  
Sbjct: 65  QPEEDGEAKRNPMVFINPELTPEGEEKRLYNEGCLSVPDQYAEVRRPSVINAKWQDRDGN 124

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
                 +GLLATCLQHE+DHL GILFIDHLSRLKR M+ KK+ K  +LR+
Sbjct: 125 FHEERIEGLLATCLQHEMDHLEGILFIDHLSRLKRGMLMKKLLKERKLRE 174


>gi|154250717|ref|YP_001411541.1| peptide deformylase [Parvibaculum lavamentivorans DS-1]
 gi|154154667|gb|ABS61884.1| peptide deformylase [Parvibaculum lavamentivorans DS-1]
          Length = 173

 Score =  174 bits (441), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/155 (50%), Positives = 111/155 (71%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDP L+ VS+P+E++++D+  L+D+MLE MY+  GIGLAA+QIGV  +++V
Sbjct: 1   MAIREIITAPDPRLKEVSKPVERVDADLRALMDDMLETMYAAPGIGLAAIQIGVPKQVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL        P  FINP+I+  S+D +VY+EGCLS+P++  DV+R A   VRY+D   +
Sbjct: 61  MDLAREGEEPQPRYFINPEILWTSEDVAVYEEGCLSVPEFYEDVERPARCRVRYLDYQGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKR 155
            +    D LLATCLQHE+DHL GILFIDHLSR KR
Sbjct: 121 IREEECDDLLATCLQHEMDHLKGILFIDHLSRTKR 155


>gi|304392301|ref|ZP_07374242.1| peptide deformylase [Ahrensia sp. R2A130]
 gi|303295405|gb|EFL89764.1| peptide deformylase [Ahrensia sp. R2A130]
          Length = 193

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 122/181 (67%), Gaps = 18/181 (9%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PDPILR  S+ +E+++ ++   +D+M + MY   GIGLAAVQ+G   R+ V+D  
Sbjct: 5   PIVHLPDPILRVRSQEVERVDDELRKFLDDMADTMYDAPGIGLAAVQVGEPRRIFVVDCS 64

Query: 65  DH------------------AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKR 106
           +                     +++P+  INPKI+TFSD+ S+Y+EGCLSIPDY A+V+R
Sbjct: 65  ERAEAEEEAEDDAPIRAEAVEEKRDPIFLINPKIVTFSDEPSMYEEGCLSIPDYYAEVER 124

Query: 107 SAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV 166
            A   + ++D + + Q + ADGLL+TC+QHE+DHL+G LFIDH+S+LK++M+ KK +K+ 
Sbjct: 125 PATCRIEFLDRDGKEQSLEADGLLSTCIQHEMDHLDGTLFIDHISKLKKNMVIKKFTKIA 184

Query: 167 Q 167
           +
Sbjct: 185 K 185


>gi|85713819|ref|ZP_01044809.1| formylmethionine deformylase [Nitrobacter sp. Nb-311A]
 gi|85699723|gb|EAQ37590.1| formylmethionine deformylase [Nitrobacter sp. Nb-311A]
          Length = 175

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 117/172 (68%), Gaps = 4/172 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR VSRPIEK+  +I  L D+M E MY   GIGLA +QI    R++ 
Sbjct: 1   MAIREIIILPDKQLRLVSRPIEKVTPEIRKLADDMFETMYDAPGIGLAGIQIAQPLRIIT 60

Query: 61  IDL----QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +DL    +D      P +FINP+I++ S++ SVY+EGCLSIP+Y  +V+R A + +R+ D
Sbjct: 61  MDLARRDEDGELNPRPRIFINPEILSASEELSVYEEGCLSIPEYYEEVERPARVRIRFTD 120

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            + +     A+GL ATC+QHE+DHLNG+LF+D+LS+LKRD + KK +K  +L
Sbjct: 121 LDGKLHEEDAEGLFATCIQHEIDHLNGVLFVDYLSKLKRDRVMKKFTKAAKL 172


>gi|254456015|ref|ZP_05069444.1| peptide deformylase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083017|gb|EDZ60443.1| peptide deformylase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 172

 Score =  174 bits (440), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 117/165 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  K ++  P+P+LR+VS+P++++  +   L+D+MLE MY   GIGLAA+Q+GV  R++V
Sbjct: 1   MTIKTIITEPNPLLRQVSKPVDQVGKEEQILMDDMLETMYDAPGIGLAAIQVGVPKRIIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+     +K P  F+NP I       S Y+EGCLS+P+  A++ R +   V Y+D + +
Sbjct: 61  MDISKEEGKKEPRYFVNPVIKNKDSIKSTYEEGCLSVPNQFAEIDRPSKCEVEYLDYHGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q++ ADGLLATC+QHE+DHL G+LFID+LS+LK+ MI KK+SKL
Sbjct: 121 KQLLKADGLLATCIQHEMDHLEGVLFIDYLSKLKKSMIIKKLSKL 165


>gi|148556945|ref|YP_001264527.1| peptide deformylase [Sphingomonas wittichii RW1]
 gi|166198523|sp|A5VDM3|DEF_SPHWW RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|148502135|gb|ABQ70389.1| peptide deformylase [Sphingomonas wittichii RW1]
          Length = 177

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 113/165 (68%), Gaps = 5/165 (3%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR 69
           PDP LR +S P+E ++ ++  LI +M E MY   GIGLAA+Q+GV  R++VIDLQ+    
Sbjct: 10  PDPRLRTISTPVEAVDDELRALIADMFETMYDAPGIGLAAIQVGVPKRVLVIDLQEEEDA 69

Query: 70  -----KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                ++P VFINP++   S++ SVY EGCLS+P+  A+V+R A I  R++D        
Sbjct: 70  EGKPIRHPRVFINPELFDPSEEQSVYNEGCLSVPEQYAEVERPAVIHARWLDEQGAKHEE 129

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             +GLLATCLQHE+DHL GILFIDHLSRLKR+M+ KK+ K  + R
Sbjct: 130 RLEGLLATCLQHEMDHLEGILFIDHLSRLKREMVMKKLEKARRAR 174


>gi|71083162|ref|YP_265881.1| peptide deformylase [Candidatus Pelagibacter ubique HTCC1062]
 gi|123748062|sp|Q4FNG1|DEF_PELUB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|71062275|gb|AAZ21278.1| peptide deformylase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 172

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 119/169 (70%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  K ++  P+ +LR++S+P+E +  +   L+D+ML+ MY+  GIGLAA+QIGV  R++V
Sbjct: 1   MSVKSILTEPNKLLRQISKPVENVGDEERRLMDDMLDTMYAAPGIGLAAIQIGVPKRIIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+     +K P  F+NP I   +D  S Y+EGCLS+PD  A+++R     V Y+D N +
Sbjct: 61  MDISRDEDKKEPRYFVNPVIKNKNDITSKYEEGCLSVPDQFAEIERPNECEVEYLDYNGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q++ ADGLLATC+QHE+DHL G+LFID+LS+LK+ MI KK+SK+   R
Sbjct: 121 KQLLKADGLLATCIQHEMDHLEGVLFIDYLSKLKKSMIIKKLSKIKSNR 169


>gi|197103839|ref|YP_002129216.1| polypeptide deformylase [Phenylobacterium zucineum HLK1]
 gi|238690164|sp|B4RDT8|DEF_PHEZH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|196477259|gb|ACG76787.1| polypeptide deformylase [Phenylobacterium zucineum HLK1]
          Length = 169

 Score =  173 bits (438), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 113/156 (72%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +++ P P L++VS+P+EK++ ++  L+D+MLE MY+  GIGLAA+QIGV  R++V
Sbjct: 1   MAIREILVVPHPALKQVSQPVEKVDDELRALMDDMLETMYAAPGIGLAAIQIGVPKRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL      K P  F+NP+I+  SDD + Y+EGCLS+P+Y  +V+R A + +RY++   +
Sbjct: 61  MDLAREGEEKQPRYFVNPEILWASDDTAPYEEGCLSVPEYYDEVERPARVKLRYLNYQGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRD 156
                A+GL A C+QHE+DHL G+LFIDHLSRLKR+
Sbjct: 121 QVEEDAEGLFAVCIQHEMDHLEGVLFIDHLSRLKRE 156


>gi|56551709|ref|YP_162548.1| peptide deformylase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762296|ref|ZP_04760377.1| peptide deformylase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|81789136|sp|Q9REQ2|DEF_ZYMMO RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|6685122|gb|AAF23793.1|AF213822_8 polypeptide deformylase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543283|gb|AAV89437.1| peptide deformylase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373199|gb|EER62829.1| peptide deformylase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 177

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 114/170 (67%), Gaps = 4/170 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP LR  S  +E  + ++  LID+M E MY   GIGLAA+Q+GV  RL+VIDLQ
Sbjct: 5   PILEVPDPRLREKSTVVEVFDDNLQRLIDDMFETMYKAPGIGLAAIQVGVAKRLLVIDLQ 64

Query: 65  DHAH----RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
                   ++NPMVFINP++    ++  +Y EGCLS+PD  A+V+R + I  ++ D +  
Sbjct: 65  QPEEGGEAKRNPMVFINPELTPEGEEKRLYNEGCLSVPDQYAEVRRPSVINAKWQDRDGN 124

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
                 +GLLATCLQHE+DHL GILFIDHLSRLKR M+ KK+ K  +LR+
Sbjct: 125 FHEERIEGLLATCLQHEMDHLEGILFIDHLSRLKRGMLMKKLLKERKLRE 174


>gi|84500579|ref|ZP_00998828.1| peptide deformylase [Oceanicola batsensis HTCC2597]
 gi|84391532|gb|EAQ03864.1| peptide deformylase [Oceanicola batsensis HTCC2597]
          Length = 172

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 117/167 (70%), Gaps = 1/167 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID- 62
           +P++I PDP L++V+ P+  I  ++    D+MLE MY   GIGLA  QIG++ RL+V+D 
Sbjct: 3   RPILIHPDPRLKKVAEPVADITDELRTTADDMLETMYDAPGIGLAGPQIGLMARLIVLDC 62

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           +++      P+V  NP+++  SD+ SVY+EGCLSIPD  A+V+R A +TV ++D +   Q
Sbjct: 63  VKEETLPPRPLVMFNPRVVASSDEKSVYEEGCLSIPDQYAEVERPAEVTVEWLDRDGVLQ 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
               DGL ATC+QHE+DHLNG LFID++S +KR MIT+KM KL + R
Sbjct: 123 EESFDGLWATCVQHEIDHLNGKLFIDYISPIKRQMITRKMQKLKRER 169


>gi|89070116|ref|ZP_01157446.1| peptide deformylase [Oceanicola granulosus HTCC2516]
 gi|89044337|gb|EAR50480.1| peptide deformylase [Oceanicola granulosus HTCC2516]
          Length = 176

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 114/166 (68%), Gaps = 1/166 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+P++I PDP L+  + P+ +I  ++  L D+MLE MY   GIGLAA Q+GVL R++V
Sbjct: 4   MTKRPILIHPDPRLKTAATPVGEITDEVRRLADDMLETMYDAPGIGLAAPQVGVLKRVLV 63

Query: 61  ID-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D ++D      P+V  +P+I+  SD  +VY+EGCLSIPD  A+V+R A + VR+ D   
Sbjct: 64  MDCVKDEGEAPRPLVLCDPEIVWTSDARNVYEEGCLSIPDQYAEVERPAEVEVRWTDLEG 123

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
             +    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL
Sbjct: 124 GARRERFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKL 169


>gi|254467295|ref|ZP_05080706.1| peptide deformylase [Rhodobacterales bacterium Y4I]
 gi|206688203|gb|EDZ48685.1| peptide deformylase [Rhodobacterales bacterium Y4I]
          Length = 182

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 117/169 (69%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L++V   +  ++ D+  L D+MLE MY+  GIGLAA QIG+L RL+V+
Sbjct: 11  MKRPILIHPDPRLKKVCAAVPDLSDDLRVLADDMLETMYAAPGIGLAAPQIGILQRLIVL 70

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP+II  SD+ +VY+EGCLSIPD  A+V R   + V +MD +  
Sbjct: 71  DCVKEEDGDPRPLVMFNPEIIASSDETNVYEEGCLSIPDQYAEVTRPKVVEVEWMDRSGN 130

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHLNG LFID+L  LKR MIT+KM KL + R
Sbjct: 131 AQRETFDGLWATCVQHEIDHLNGKLFIDYLKPLKRQMITRKMQKLKRER 179


>gi|149913450|ref|ZP_01901983.1| peptide deformylase [Roseobacter sp. AzwK-3b]
 gi|149812570|gb|EDM72399.1| peptide deformylase [Roseobacter sp. AzwK-3b]
          Length = 174

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 115/165 (69%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L++V  P+  ++ D+  L D+MLE MY   GIGLAA QIGVL RL+V+
Sbjct: 1   MKRPILIHPDPRLKKVCAPLGDLSDDLRVLADDMLETMYDAPGIGLAAPQIGVLDRLIVM 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D ++       P+V  NP+I+  SD  +VY+EGCLSIP+  A+VKR   + VR++D +  
Sbjct: 61  DCVKGENETPRPLVMFNPEIVASSDVMNVYEEGCLSIPEEYAEVKRPEAVDVRWIDRDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q    DGL ATC+QHE+DHLNG LFID+L  +KR MIT++M KL
Sbjct: 121 EQTETFDGLWATCVQHEIDHLNGKLFIDYLGPMKRQMITRRMQKL 165


>gi|85707836|ref|ZP_01038902.1| polypeptide deformylase [Erythrobacter sp. NAP1]
 gi|85689370|gb|EAQ29373.1| polypeptide deformylase [Erythrobacter sp. NAP1]
          Length = 190

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/188 (47%), Positives = 117/188 (62%), Gaps = 21/188 (11%)

Query: 1   MVKKPLVIFPDPILRRVSRPI--EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRL 58
           M  + ++  PDP L+ VS P+  ++ N ++  L ++M E MY   GIGLAA+Q+GV  RL
Sbjct: 1   MAIREILEVPDPRLKVVSEPVREDEFNDELKQLAEDMFETMYDAPGIGLAAIQVGVPKRL 60

Query: 59  VVIDLQ----------------DHAH---RKNPMVFINPKIITFSDDFSVYQEGCLSIPD 99
           +VIDLQ                 H H   +K P VF+NP I+  +D+ S Y EGCLS+P+
Sbjct: 61  LVIDLQPDDPDAEPVECEHDGHKHTHPATKKEPRVFVNPVILDPADELSTYNEGCLSVPE 120

Query: 100 YRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMIT 159
             ADV R A  TV+Y D +  H     +GLLATCLQHE+DHL GILFIDHLSRLKR+M  
Sbjct: 121 IYADVDRPATCTVKYQDLDGNHHEEQLEGLLATCLQHEMDHLEGILFIDHLSRLKRNMAL 180

Query: 160 KKMSKLVQ 167
           KK+ KL Q
Sbjct: 181 KKLKKLRQ 188


>gi|89052957|ref|YP_508408.1| peptide deformylase [Jannaschia sp. CCS1]
 gi|88862506|gb|ABD53383.1| peptide deformylase [Jannaschia sp. CCS1]
          Length = 174

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 111/169 (65%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K P++I PDP L++V+ P+  +  ++  L DNML  MY   GIGLAA Q+GV  RL+V+
Sbjct: 1   MKLPILIHPDPRLKKVAAPVPDVTDELRALADNMLSTMYDAPGIGLAAPQVGVGQRLIVL 60

Query: 62  DLQDHAH-RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +        P+   NP++I  SD+ + Y EGCLSIPD  ADV R   +TVR+MD N  
Sbjct: 61  DCEKGDDVTPRPLAMFNPEVIASSDEMNTYDEGCLSIPDIYADVTRPEAVTVRWMDVNGA 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHL G LFID+LS LKR +IT+KM KL + R
Sbjct: 121 EQEETFDGLWATCVQHEIDHLEGKLFIDYLSGLKRQLITRKMVKLKRDR 169


>gi|146337885|ref|YP_001202933.1| peptide deformylase [Bradyrhizobium sp. ORS278]
 gi|158514293|sp|A4YLB9|DEF_BRASO RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|146190691|emb|CAL74695.1| Peptide deformylase (PDF) (Polypeptide deformylase) [Bradyrhizobium
           sp. ORS278]
          Length = 175

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 117/171 (68%), Gaps = 4/171 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR VS+P+EK+  +I  L+D+M + MY   GIGLAA+Q+    R++ 
Sbjct: 1   MSLREIIILPDRQLRLVSKPVEKVTPEIRQLVDDMFQTMYDAPGIGLAAIQVAQPLRVIT 60

Query: 61  IDL----QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +DL         ++ P VFINP+II  SD+ SVY+EGCLSIP+Y  +V+R A + VR+ D
Sbjct: 61  MDLAKPDSGGETKREPRVFINPEIIAKSDELSVYEEGCLSIPEYYEEVERPARVRVRFTD 120

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +   +   A+GL ATC+QHE+DHLNG+LFID+LS+LKRD + KK +K  +
Sbjct: 121 LDGVVREEDAEGLYATCIQHEIDHLNGVLFIDYLSKLKRDRVMKKFTKAAK 171


>gi|254429252|ref|ZP_05042959.1| peptide deformylase [Alcanivorax sp. DG881]
 gi|196195421|gb|EDX90380.1| peptide deformylase [Alcanivorax sp. DG881]
          Length = 168

 Score =  171 bits (434), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 79/165 (47%), Positives = 116/165 (70%), Gaps = 2/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ FPDP LR V++P+EK++ ++  LID+M+E MY   GIGLAA Q+ V  RL+V
Sbjct: 1   MAKLEILEFPDPRLRTVAKPVEKVDDELRKLIDDMIETMYDASGIGLAATQVNVHQRLLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL +   R  P V+INP+I   +D+ + Y+EGCLS+P +   VKR+A + +  +D +  
Sbjct: 61  MDLSEE--RNEPKVYINPQITPLTDELAPYEEGCLSVPGFYEKVKRAARVRINALDRDGN 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              + AD LLATC+QHE+DHL+G LF+D++SRLKRD I KK+ K+
Sbjct: 119 AFEVEADELLATCIQHEIDHLDGKLFVDYVSRLKRDRIKKKLEKI 163


>gi|148258522|ref|YP_001243107.1| peptide deformylase [Bradyrhizobium sp. BTAi1]
 gi|158513291|sp|A5ESQ7|DEF_BRASB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|146410695|gb|ABQ39201.1| peptide deformylase [Bradyrhizobium sp. BTAi1]
          Length = 175

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 117/171 (68%), Gaps = 4/171 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR VS+P+EK+  +I  L+D+M + MY   GIGLAA+Q+    R++ 
Sbjct: 1   MSLREIIILPDKQLRLVSKPVEKVTPEIRQLVDDMFQTMYDAPGIGLAAIQVAQPLRVIT 60

Query: 61  IDLQ----DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +DL         ++ P VFINP+II  SD+ S+Y+EGCLSIP+Y  +V+R A + VR+ D
Sbjct: 61  MDLAKPDAGGETKREPRVFINPEIIAKSDELSIYEEGCLSIPEYYEEVERPARVRVRFTD 120

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +   +   A+GL ATC+QHE+DHLNG+LFID+LS+LKRD + KK +K  +
Sbjct: 121 LDGVLREEDAEGLYATCIQHEIDHLNGVLFIDYLSKLKRDRVLKKFTKAAK 171


>gi|91974563|ref|YP_567222.1| peptide deformylase [Rhodopseudomonas palustris BisB5]
 gi|123722270|sp|Q13F18|DEF_RHOPS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|91681019|gb|ABE37321.1| peptide deformylase [Rhodopseudomonas palustris BisB5]
          Length = 175

 Score =  171 bits (432), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 115/169 (68%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR +S+P+ ++  +I  L D+M E MY   GIGLAA+QI    RL+ 
Sbjct: 1   MALREIIILPDKRLREISKPVAEVTPEIRKLADDMFESMYDAPGIGLAAIQIAEPVRLIT 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +D+  ++   + +P  FINP+I+  S + +VY+EGCLSIP+Y ADV+R A + +RY D +
Sbjct: 61  MDIVRKEGNGKSDPRAFINPEIVGASAEMNVYEEGCLSIPEYYADVERPAVVRIRYTDLD 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              +   ADGL ATC+QHE+DHL+G+LF+DHLS+LKR M+ +K  K  +
Sbjct: 121 GNVKEEDADGLFATCIQHEIDHLDGVLFVDHLSKLKRAMVVRKFEKAAK 169


>gi|108761299|ref|YP_629687.1| peptide deformylase [Myxococcus xanthus DK 1622]
 gi|108465179|gb|ABF90364.1| peptide deformylase [Myxococcus xanthus DK 1622]
          Length = 177

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 116/170 (68%), Gaps = 2/170 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           MV++ ++I+PDP+L++ ++P+ K++     L+ +M E MYS +G+GLAA QIGVL R++V
Sbjct: 1   MVRE-ILIWPDPVLKQKAKPVAKVDDSTRTLVKDMFETMYSAEGVGLAAPQIGVLQRVIV 59

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D         P+  INP+II    D + Y EGCLSIP   ADV R+A +TV+++D + Q
Sbjct: 60  LDTTHSQPELKPVAMINPEIIAMEGD-TTYNEGCLSIPGEAADVDRAAVVTVKFLDPDGQ 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            Q +  DGLL+  +QHE DHLNG +F+DH+S LKR+ I K+M +L   R+
Sbjct: 119 EQTLRCDGLLSIAVQHETDHLNGTVFVDHISSLKREFIRKRMKRLKTSRE 168


>gi|39933698|ref|NP_945974.1| peptide deformylase [Rhodopseudomonas palustris CGA009]
 gi|192289055|ref|YP_001989660.1| peptide deformylase [Rhodopseudomonas palustris TIE-1]
 gi|81698398|sp|Q6NC51|DEF_RHOPA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|229487564|sp|B3QCH1|DEF_RHOPT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|39647544|emb|CAE26065.1| putative N-formylmethionylaminoacyl-tRNA deformylase
           [Rhodopseudomonas palustris CGA009]
 gi|192282804|gb|ACE99184.1| peptide deformylase [Rhodopseudomonas palustris TIE-1]
          Length = 175

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 115/169 (68%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR +S+P+ ++ ++I  L D+M E MY   GIGLAA+QI    RL+ 
Sbjct: 1   MALREIIILPDKRLREISKPVTEVTTEIRKLADDMFESMYEAPGIGLAAIQIAEPVRLIT 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +D+  ++   + +P  FINP+I+  S + +VY+EGCLSIP+Y A+V+R   + +RY D +
Sbjct: 61  MDIVRKEGDGKSDPRAFINPEIVGASSEMNVYEEGCLSIPEYYAEVERPKTVRIRYTDLD 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              +   ADGL ATC+QHE+DHLNG+LF+DHLS+LKR M+ +K  K  +
Sbjct: 121 GNVKEEDADGLFATCIQHEIDHLNGVLFVDHLSKLKRAMVIRKFEKAAK 169


>gi|75677243|ref|YP_319664.1| formylmethionine deformylase [Nitrobacter winogradskyi Nb-255]
 gi|74422113|gb|ABA06312.1| peptide deformylase [Nitrobacter winogradskyi Nb-255]
          Length = 187

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 114/172 (66%), Gaps = 4/172 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR VSRPIE +  +I  L D+M E MY   GIGLA +QI    R+V 
Sbjct: 13  MAIREIIILPDKQLRLVSRPIETVTPEIRKLADDMFETMYDAPGIGLAGIQIAQPLRIVT 72

Query: 61  IDL----QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +DL    ++      P VFINP+I++ S++ SVY+EGCLSIP+Y   V+R + + +R+ D
Sbjct: 73  MDLARRDEEGELTPRPRVFINPEILSASEELSVYEEGCLSIPEYYEAVERPSRVRIRFTD 132

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            + +     A+GL ATC+QHE+DHLNG+LF+DHLS+LKRD + KK +K  + 
Sbjct: 133 LDGKVHEEDAEGLFATCIQHEIDHLNGVLFVDHLSKLKRDRVMKKFTKAAKF 184


>gi|86747799|ref|YP_484295.1| peptide deformylase [Rhodopseudomonas palustris HaA2]
 gi|123099181|sp|Q2J2C6|DEF_RHOP2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|86570827|gb|ABD05384.1| peptide deformylase [Rhodopseudomonas palustris HaA2]
          Length = 175

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 115/169 (68%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR +S+P+ ++  +I  L D+M E MY   GIGLAA+QI    RL+ 
Sbjct: 1   MALREIIILPDKRLREISKPVAEVTPEIRKLADDMFESMYEAPGIGLAAIQIAEPVRLIT 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +D+  ++   + +P  FINP+I+  S + +VY+EGCLSIP+Y A+V+R   + +RY D +
Sbjct: 61  MDIVRKEGNGKSDPRAFINPEIVGASAELNVYEEGCLSIPEYYAEVERPKTVRIRYTDLD 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q +   ADGL ATC+QHE+DHLNG+LF+DH+S+LK+ M+ +K  K  +
Sbjct: 121 GQVKEEDADGLFATCIQHEIDHLNGVLFVDHISKLKKAMVVRKFEKAAK 169


>gi|163738219|ref|ZP_02145635.1| Peptide deformylase [Phaeobacter gallaeciensis BS107]
 gi|163743813|ref|ZP_02151186.1| peptide deformylase [Phaeobacter gallaeciensis 2.10]
 gi|161382962|gb|EDQ07358.1| peptide deformylase [Phaeobacter gallaeciensis 2.10]
 gi|161388835|gb|EDQ13188.1| Peptide deformylase [Phaeobacter gallaeciensis BS107]
          Length = 172

 Score =  170 bits (430), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 116/169 (68%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L++V   +  ++  +  L D+MLE MY+  GIGLAA QIGVL RL+V+
Sbjct: 1   MKRPILIHPDPRLKKVCAAVPDMSDALRTLADDMLETMYAAPGIGLAAPQIGVLDRLIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP+++  SD+ +VY+EGCLSIPD  A+V R   + V +MD +  
Sbjct: 61  DCVKEEDGPARPLVMFNPEVVASSDETNVYEEGCLSIPDQYAEVTRPKVVEVEWMDRDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHLNG LFID+L  LKR MIT+KM KL + R
Sbjct: 121 AQRETFDGLWATCVQHEIDHLNGKLFIDYLKPLKRQMITRKMQKLKRER 169


>gi|90422323|ref|YP_530693.1| peptide deformylase [Rhodopseudomonas palustris BisB18]
 gi|123089811|sp|Q21B62|DEF_RHOPB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|90104337|gb|ABD86374.1| peptide deformylase [Rhodopseudomonas palustris BisB18]
          Length = 175

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 116/169 (68%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR +S+P+E +++++  L D+M E MY   GIGLAA+Q+    RL+ 
Sbjct: 1   MALREIIIIPDKQLRLISKPVETVSAEVRRLADDMFETMYEAPGIGLAAIQVAQPVRLIT 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +DL  ++      P  FINP++I+ S++ +VY+EGCLSIP+Y A+V+R   + +RY D +
Sbjct: 61  MDLVRKEGNSLTEPRAFINPEVISASEEMNVYEEGCLSIPEYYAEVERPKQVRIRYTDLD 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              +   ADGL ATC+QHE+DHLNG+LF+DH+S+LKR M+ +K  K  +
Sbjct: 121 GNVKEEDADGLFATCIQHEIDHLNGVLFVDHISKLKRAMVMRKFEKAAK 169


>gi|92119150|ref|YP_578879.1| peptide deformylase [Nitrobacter hamburgensis X14]
 gi|122990031|sp|Q1QH78|DEF_NITHX RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|91802044|gb|ABE64419.1| peptide deformylase [Nitrobacter hamburgensis X14]
          Length = 175

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 115/172 (66%), Gaps = 4/172 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR VSRPIE +  +I  L D+M E MY   GIGLA +QI    R++ 
Sbjct: 1   MAIREIIILPDKQLRLVSRPIETVTPEIRKLADDMFETMYDAPGIGLAGIQIAQPLRIIT 60

Query: 61  IDL----QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           +DL    ++      P +FINP+I++ S++ S Y+EGCLSIP+Y  +V+R A + VR+ D
Sbjct: 61  MDLARRDEEGELTPRPRIFINPEILSASEELSTYEEGCLSIPEYYEEVERPARVRVRFTD 120

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            + +     A+G+ ATC+QHE+DHLNG+LF+DH+S+LKRD + KK +K  +L
Sbjct: 121 LDGKVHEEDAEGIYATCIQHEIDHLNGVLFVDHISKLKRDRVVKKFTKAAKL 172


>gi|83309342|ref|YP_419606.1| N-formylmethionyl-tRNA deformylase [Magnetospirillum magneticum
           AMB-1]
 gi|82944183|dbj|BAE49047.1| N-formylmethionyl-tRNA deformylase [Magnetospirillum magneticum
           AMB-1]
          Length = 190

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 114/160 (71%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP+L+  S+P+  ++  I  L+ +ML+ MY   GIGLAA QIGVL R++V+D+ 
Sbjct: 25  PILTAPDPVLKSKSKPVATVDDRIRTLLADMLDTMYHAPGIGLAAPQIGVLERVIVMDIG 84

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                + P+  +NP+I+  SD+ + Y+EGCLS+P++ ++V R A + VRY+D     Q I
Sbjct: 85  RKEEDRAPIRMVNPEIVWASDEDNTYEEGCLSVPEHYSNVVRPASVKVRYLDETGAKQEI 144

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLAT +QHE+DHL+GILFIDHLS LKR+MI +K+ K
Sbjct: 145 LADGLLATVVQHEMDHLDGILFIDHLSSLKRNMILRKLLK 184


>gi|254510174|ref|ZP_05122241.1| peptide deformylase [Rhodobacteraceae bacterium KLH11]
 gi|221533885|gb|EEE36873.1| peptide deformylase [Rhodobacteraceae bacterium KLH11]
          Length = 172

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/165 (50%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L++V  P+  I  D+  L D+MLE MY   GIGLAA QIGVL RL+V+
Sbjct: 1   MKRNILIHPDPRLKKVCAPVADITDDLRKLADDMLETMYDAPGIGLAAPQIGVLDRLIVV 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP++I  SD+ +VY+EGCLSIPD  A+V R   + V +MD +  
Sbjct: 61  DCVKEEGETPRPLVMFNPQVIASSDEINVYEEGCLSIPDQYAEVTRPRTVDVTWMDRDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q    D L ATC+QHE+DHLNG LFID+L  LKR MIT+KM KL
Sbjct: 121 LQQETFDDLWATCVQHEIDHLNGKLFIDYLKPLKRQMITRKMQKL 165


>gi|316932090|ref|YP_004107072.1| peptide deformylase [Rhodopseudomonas palustris DX-1]
 gi|315599804|gb|ADU42339.1| peptide deformylase [Rhodopseudomonas palustris DX-1]
          Length = 175

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 115/169 (68%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR +S+P+ ++ ++I  L D+M E MY   GIGLAA+QI    RL+ 
Sbjct: 1   MALREIIILPDKRLREISKPVAEVTTEIRKLADDMFESMYDAPGIGLAAIQIAEPVRLIT 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +D+  ++   + +P  FINP+I+  S + +VY+EGCLSIP+Y A+V+R   + +RY D +
Sbjct: 61  MDIVRKEGDGKSDPRAFINPEIVGASAEMNVYEEGCLSIPEYYAEVERPKTVRIRYTDLD 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              +   ADGL ATC+QHE+DHLNG+LF+DHLS+LKR M+ +K  K  +
Sbjct: 121 GNVREEDADGLFATCIQHEIDHLNGVLFVDHLSKLKRAMVIRKFEKAAK 169


>gi|297182651|gb|ADI18809.1| N-formylmethionyl-tRNA deformylase [uncultured SAR11 cluster
           bacterium HF4000_37C10]
          Length = 185

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 119/175 (68%), Gaps = 11/175 (6%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  P+ +LR  S  +E+++ D+  L+D+MLE MY+  GIGLAA+Q+GV  R++V
Sbjct: 1   MALREILTEPNKLLREKSLAVEEVDEDLQKLMDDMLETMYAAPGIGLAAIQVGVPKRVIV 60

Query: 61  IDL-----------QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAF 109
           +D+           +    RKNPM F+NP+II  S + S+Y+EGCLS+P   A++ RS  
Sbjct: 61  LDIRWRDKSESTSDEKQVERKNPMCFVNPEIIAKSTNNSIYEEGCLSVPGQFAEIARSDK 120

Query: 110 ITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             V+Y+D   Q +   A+G+LATC+QHE+DHL GILFID+LS+LK+ MI KK++K
Sbjct: 121 CHVKYLDYYGQPKEFVAEGMLATCIQHEIDHLEGILFIDYLSKLKKSMIVKKLAK 175


>gi|85373243|ref|YP_457305.1| peptide deformylase [Erythrobacter litoralis HTCC2594]
 gi|123409710|sp|Q2NCT3|DEF_ERYLH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|84786326|gb|ABC62508.1| polypeptide deformylase [Erythrobacter litoralis HTCC2594]
          Length = 194

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 119/192 (61%), Gaps = 25/192 (13%)

Query: 1   MVKKPLVIFPDPILRRVSRPIE--KINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRL 58
           M  + ++  PDP L+ VS P++  + N D+  L+D+M E MY+  GIGLAA+Q+GV  R+
Sbjct: 1   MAIREILEVPDPRLKTVSEPVQPDEFNDDLKQLVDDMFETMYAAPGIGLAAIQVGVPKRV 60

Query: 59  VVIDLQD--------------------HAH---RKNPMVFINPKIITFSDDFSVYQEGCL 95
           +VIDLQ+                    H H   + +P +FINP+II  +++ S YQEGCL
Sbjct: 61  LVIDLQEPDMDAEPEECGHDHGDGEGAHKHYPVKNDPRIFINPEIIDPNEELSTYQEGCL 120

Query: 96  SIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKR 155
           S+P+  ADV R    TV+Y D   +      DGLLATCLQHE+DHL GILFIDHLSRLK+
Sbjct: 121 SVPEIYADVDRPKTCTVKYQDLTGKTHQEDLDGLLATCLQHEMDHLEGILFIDHLSRLKK 180

Query: 156 DMITKKMSKLVQ 167
            M  KK+ K+ Q
Sbjct: 181 QMALKKLKKMRQ 192


>gi|23016537|ref|ZP_00056292.1| COG0242: N-formylmethionyl-tRNA deformylase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 170

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 114/160 (71%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP+L+  S+P+  ++  I  L+ +MLE MY   GIGLAA QIGVL R++V+D+ 
Sbjct: 5   PILTAPDPVLKSKSKPVAAVDDRIRALLADMLETMYHAPGIGLAAPQIGVLERVIVMDIG 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                + P+  +NP+II  SD+ + Y+EGCLS+P++ ++V R A + VRY+D     Q +
Sbjct: 65  RKEEDRAPIRMVNPEIIWASDEDNTYEEGCLSVPEHYSNVVRPASVKVRYLDETGAKQEL 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLAT +QHE+DHL+G+LFIDHLS LKR+MI +K+ K
Sbjct: 125 LAEGLLATVVQHEMDHLDGVLFIDHLSSLKRNMILRKLLK 164


>gi|163744872|ref|ZP_02152232.1| peptide deformylase [Oceanibulbus indolifex HEL-45]
 gi|161381690|gb|EDQ06099.1| peptide deformylase [Oceanibulbus indolifex HEL-45]
          Length = 172

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 116/165 (70%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P+++ PDP L++ + P+  ++ ++  L D+ML  MY   GIGLAA Q+GVL R++V+
Sbjct: 1   MKRPILLHPDPRLKKAAAPVADLSDELRVLGDDMLATMYDAPGIGLAAPQVGVLSRVIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P++  NP+I+  SDD + Y+EGCLSIP+  ADV R A + VR++D + +
Sbjct: 61  DCVKEEGEAPRPLLMFNPEIVASSDDLNTYEEGCLSIPEQFADVTRPAEVEVRWLDRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL
Sbjct: 121 EQREGFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMVKL 165


>gi|149201578|ref|ZP_01878552.1| peptide deformylase [Roseovarius sp. TM1035]
 gi|149144626|gb|EDM32655.1| peptide deformylase [Roseovarius sp. TM1035]
          Length = 172

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 118/166 (71%), Gaps = 3/166 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP LR+V  P++ +   +  L  +MLE MY   GIGLAA Q+GV+ RL+V+
Sbjct: 1   MKRSILIHPDPRLRKVCTPVKDVTDALRKLSQDMLETMYDAPGIGLAAPQVGVMDRLIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA- 119
           D ++D      P+V +NP+I  FS++ SVY+EGCLSIPD  ADV R A + +R+MD +  
Sbjct: 61  DCVKDEGATPRPIVMLNPEITAFSEEKSVYEEGCLSIPDQFADVTRPAEVEMRWMDLDGV 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +HQ  +  GL ATC+QHE+DHL+G LFID+LS +KR +IT++M KL
Sbjct: 121 EHQEGFG-GLWATCVQHEIDHLDGKLFIDYLSAMKRQLITRRMQKL 165


>gi|323142780|ref|ZP_08077493.1| peptide deformylase [Succinatimonas hippei YIT 12066]
 gi|322417425|gb|EFY08046.1| peptide deformylase [Succinatimonas hippei YIT 12066]
          Length = 175

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/167 (50%), Positives = 112/167 (67%), Gaps = 3/167 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +V FPD  LR++  P+ + ++ +  L D+M E MY  +GIGLAA QIG+  R+VV
Sbjct: 1   MAIREIVTFPDERLRQICAPVTEFDAALKELTDDMFETMYDDEGIGLAAPQIGIEKRIVV 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           ID+  +D    KN +V INPKI T  +     +EGCLS+P+YRA++KR   IT+   D N
Sbjct: 61  IDIPEEDGKQGKNKLVLINPKI-TAKEGEVASEEGCLSVPEYRAEIKRYEKITLECQDLN 119

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q QI  ADGLLA C+QHELDHL+G LFID+LSRLKRD +  K  KL
Sbjct: 120 GQKQIYEADGLLAICMQHELDHLDGKLFIDYLSRLKRDRLLTKYRKL 166


>gi|115522683|ref|YP_779594.1| peptide deformylase [Rhodopseudomonas palustris BisA53]
 gi|122297684|sp|Q07TX0|DEF_RHOP5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|115516630|gb|ABJ04614.1| peptide deformylase [Rhodopseudomonas palustris BisA53]
          Length = 180

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 111/169 (65%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PD  LR  S+P+E ++ ++  L D+M E MY   GIGLAA+QI    RL+ 
Sbjct: 1   MALREIIIVPDKQLRLTSKPVETVSPEVRKLADDMFETMYDAPGIGLAAIQIAEPVRLIT 60

Query: 61  IDL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +DL  ++   +  P  FINP+II  S +  VY+EGCLSIP+Y A+V+R A + +RY D +
Sbjct: 61  MDLVRKEGNGKTEPRAFINPEIIGASTETRVYEEGCLSIPEYYAEVERPAQVRIRYTDLD 120

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                  ADGL ATC+QHE+DHLNG LFIDH+SRLKR ++ +K  K  +
Sbjct: 121 GHVHEEDADGLFATCIQHEIDHLNGTLFIDHISRLKRALVMRKFEKAAK 169


>gi|56698051|ref|YP_168422.1| peptide deformylase [Ruegeria pomeroyi DSS-3]
 gi|56679788|gb|AAV96454.1| peptide deformylase [Ruegeria pomeroyi DSS-3]
          Length = 172

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 118/169 (69%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L++V  P+  I+ ++  L D+MLE MY   GIGLAA QIGVL RL+V+
Sbjct: 1   MKRAILIHPDPRLKKVCAPVADISDELRALADDMLETMYDAPGIGLAAPQIGVLDRLIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++ +    P+V  NP+++  SD+ ++Y+EGCLSIP+  A+V R   + V ++D + +
Sbjct: 61  DCVKEESAPARPLVMFNPRVVAASDETNIYEEGCLSIPEQYAEVTRPKVVDVEWIDRDGK 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 121 LQSETFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKLKRER 169


>gi|254477024|ref|ZP_05090410.1| peptide deformylase [Ruegeria sp. R11]
 gi|214031267|gb|EEB72102.1| peptide deformylase [Ruegeria sp. R11]
          Length = 189

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 116/171 (67%), Gaps = 5/171 (2%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L++V   +  +   +  L D+MLE MY+  G+GLAA QIGVL RL+V+
Sbjct: 18  MKRPILIHPDPRLKKVCAEVPDLTDAMRTLADDMLETMYAAPGVGLAAPQIGVLDRLIVL 77

Query: 62  DL-QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM--DCN 118
           D  ++      P+V  NPKI++ SD+ +VY+EGCLSIPD  A+V R   + V +M  D N
Sbjct: 78  DCAKEDEESPRPLVMFNPKIVSASDETNVYEEGCLSIPDQYAEVTRPKVVEVEWMNRDGN 137

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           A  +    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 138 AARETF--DGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKLKRER 186


>gi|85705033|ref|ZP_01036133.1| peptide deformylase [Roseovarius sp. 217]
 gi|85670355|gb|EAQ25216.1| peptide deformylase [Roseovarius sp. 217]
          Length = 172

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP LR+V  P+  ++  +  L  +M E MY   GIGLAA Q+GV+ RL+V+
Sbjct: 1   MKRSILIHPDPRLRKVCTPVTDVSDALRKLSQDMFETMYDAPGIGLAAPQVGVMDRLIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D ++D      P+  +NP+I  FSD  SVY+EGCLSIPD  ADV R A + VR+MD +  
Sbjct: 61  DCVKDEGATPRPIAMLNPEITAFSDQTSVYEEGCLSIPDQFADVTRPAEVEVRWMDLDGV 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                  GL ATC+QHE+DHL+G LFID+LS +KR +IT++M KL
Sbjct: 121 EHKEGFGGLWATCVQHEIDHLDGKLFIDYLSAMKRQLITRRMQKL 165


>gi|114770091|ref|ZP_01447629.1| peptide deformylase [alpha proteobacterium HTCC2255]
 gi|114548928|gb|EAU51811.1| peptide deformylase [alpha proteobacterium HTCC2255]
          Length = 172

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 109/161 (67%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+++ PDP L+++  P++ ++++   L D+M+E MY   G+GLAA Q+    R+ V+D  
Sbjct: 5   PILLHPDPRLKKLCVPVQSVDAETRKLADSMIETMYDAPGVGLAAPQVASDARIFVMDCT 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D      P+V INP+II+ S++ + Y EGCLS+PD   DV+R   + + ++D + +    
Sbjct: 65  DSESDNQPLVLINPEIISVSEELNTYSEGCLSLPDLFEDVERPKQVRMSFLDIDGKQHNE 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
             DGL ATC QHELDHLNG+LFIDHLSR+KR M+TKKM KL
Sbjct: 125 LFDGLWATCAQHELDHLNGVLFIDHLSRMKRSMMTKKMVKL 165


>gi|262277954|ref|ZP_06055747.1| peptide deformylase [alpha proteobacterium HIMB114]
 gi|262225057|gb|EEY75516.1| peptide deformylase [alpha proteobacterium HIMB114]
          Length = 171

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 106/148 (71%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR 69
           PDPILR+ S  + K+++DI  L+DNMLE MY   GIGLAA Q+G+L +++VIDL      
Sbjct: 10  PDPILRKKSDEVSKVDNDIRALMDNMLETMYQAPGIGLAAPQVGILKKVIVIDLAKEDEP 69

Query: 70  KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGL 129
           K P+   NPKII  SD+ S  +EGCLSIP Y A+V R     ++Y+D + + Q I A+ L
Sbjct: 70  KKPLFIANPKIIWKSDELSSREEGCLSIPGYFAEVVRPTKCKLQYLDYDGKQQEIEAEDL 129

Query: 130 LATCLQHELDHLNGILFIDHLSRLKRDM 157
           L+TC+QHE+DH +G+LFID+LS+LK+DM
Sbjct: 130 LSTCIQHEVDHCDGVLFIDYLSKLKKDM 157


>gi|312115223|ref|YP_004012819.1| peptide deformylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220352|gb|ADP71720.1| peptide deformylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 176

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 114/170 (67%), Gaps = 1/170 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PD ILR  S+ +E ++ ++  L ++MLE MY+  GIGLAAVQIGVL RL+V
Sbjct: 1   MAIRSIITIPDAILRETSKTVETVDDEVRALANDMLETMYAAPGIGLAAVQIGVLRRLIV 60

Query: 61  IDLQDHAHR-KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D Q    + KNP+V INP+I+T  D   V++EGCLSIP   A+V+R A + VRY+D   
Sbjct: 61  MDAQKGDEKGKNPVVLINPEILTHGDTPRVHEEGCLSIPQMYAEVERPALVRVRYVDAEG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + Q      L AT +QHE+DHL G LFIDHLSRLKR ++ +K  KL + R
Sbjct: 121 KQQERDFSDLEATLVQHEIDHLEGRLFIDHLSRLKRTLLIRKYHKLQRER 170


>gi|86137254|ref|ZP_01055832.1| peptide deformylase [Roseobacter sp. MED193]
 gi|85826578|gb|EAQ46775.1| peptide deformylase [Roseobacter sp. MED193]
          Length = 172

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 116/169 (68%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K  ++I PDP L+++  P+  ++  +  L D+MLE MY+  GIGLAA QIGV+ RL+V+
Sbjct: 1   MKHSILIHPDPRLKKICAPVADLSDKLRLLADDMLETMYAAPGIGLAAPQIGVMERLIVL 60

Query: 62  DLQ-DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D + +      P+V  NP+II+ S++ +VY+EGCLSIPD  A+V R   + V+++D N  
Sbjct: 61  DCEKEEGVEPKPLVMFNPEIISSSEETNVYEEGCLSIPDQYAEVTRPRDVEVQWLDRNGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 121 QQRETFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKLKRER 169


>gi|126738021|ref|ZP_01753742.1| peptide deformylase [Roseobacter sp. SK209-2-6]
 gi|126720518|gb|EBA17223.1| peptide deformylase [Roseobacter sp. SK209-2-6]
          Length = 172

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 115/169 (68%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K P++I PDP L++   P+  ++  +  L D+MLE MY+  GIGLAA QIG++ RL+V+
Sbjct: 1   MKHPILIHPDPRLKKTCVPVADLSDKLRILADDMLETMYAAPGIGLAAPQIGIMQRLIVL 60

Query: 62  DLQ-DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D + +      P+V  NP+I+  S++ +VY+EGCLSIP+  A+V R   + VR++D +  
Sbjct: 61  DCEKEEGSSGKPLVMFNPEILASSEETNVYEEGCLSIPEQFAEVTRPKVVDVRWIDRDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 121 EQSETFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKLKRER 169


>gi|99082420|ref|YP_614574.1| peptide deformylase [Ruegeria sp. TM1040]
 gi|99038700|gb|ABF65312.1| peptide deformylase [Ruegeria sp. TM1040]
          Length = 174

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 117/169 (69%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L++++  +  ++ D+  L D+MLE MY+  GIGLAA QIGVL RL+V+
Sbjct: 1   MKRSILIHPDPRLKKIATDVPDLSDDLRALADDMLETMYAAPGIGLAAPQIGVLDRLIVM 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP++I  SD+ +VY+EGCLSIP+  A+V R   + V +MD +  
Sbjct: 61  DCVKEGEGDARPLVMFNPRVIASSDETNVYEEGCLSIPEQYAEVTRPKVVDVEWMDRDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 121 LQTETFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKLKRER 169


>gi|119943871|ref|YP_941551.1| peptide deformylase [Psychromonas ingrahamii 37]
 gi|119862475|gb|ABM01952.1| peptide deformylase [Psychromonas ingrahamii 37]
          Length = 167

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 108/157 (68%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+E+I  ++    +NM+E MY  +G+GLAA Q+    RLVVID+ +   
Sbjct: 9   FPDKRLRTIAKPVEQITVELKKTAENMIETMYEEEGVGLAATQVNFHRRLVVIDVSEQ-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   MV INP I+  S +  + +EGCLS+P+  A+VKR+ F+T+ Y+D   + Q++ ADG
Sbjct: 67  RNQAMVIINPVIVEHSGE-EISEEGCLSVPETNAEVKRAEFVTLEYLDIEGKQQVLKADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA CLQHE+DHLNG LFID+LS LK+  I  K+ KL
Sbjct: 126 LLAVCLQHEIDHLNGKLFIDYLSPLKQKRIKTKLEKL 162


>gi|114766694|ref|ZP_01445633.1| peptide deformylase [Pelagibaca bermudensis HTCC2601]
 gi|114541084|gb|EAU44139.1| peptide deformylase [Roseovarius sp. HTCC2601]
          Length = 173

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 2/170 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L++   P+  ++  +  L D+MLE MY   GIGLAA QIGVL RL+V+
Sbjct: 1   MKRPILIHPDPRLKKACAPVPDLSDKLRVLADDMLETMYDAPGIGLAAPQIGVLDRLIVL 60

Query: 62  DLQ--DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           D    D      P+V  NP+++  SD+ +VY+EGCLSIPD  A+V+R   + V ++D + 
Sbjct: 61  DCAKADDGEAPRPLVMFNPQVVASSDERNVYEEGCLSIPDQYAEVERPKVVDVEWLDRDG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 121 TLQRETFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMVKLKRDR 170


>gi|110678658|ref|YP_681665.1| peptide deformylase [Roseobacter denitrificans OCh 114]
 gi|109454774|gb|ABG30979.1| peptide deformylase [Roseobacter denitrificans OCh 114]
          Length = 175

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 114/165 (69%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ +++ PDP L++ + P+  I+ ++  L D+MLE MY   GIGLAA Q+G+L R+VV+
Sbjct: 4   MKRSIILHPDPRLKKTAEPVADISDELRRLGDDMLETMYDAPGIGLAAPQVGILQRVVVM 63

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P++  NP++I  SD+ SVY+EGCLSIP+  A+V R A + VR+MD +  
Sbjct: 64  DCIKEPGDTPRPVIMFNPEVIATSDETSVYEEGCLSIPEQFAEVTRPAEVEVRWMDRDGA 123

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q     GL ATC QHE+DHL+G LFID+L  L+R MIT+KM KL
Sbjct: 124 AQSEVFTGLWATCAQHEIDHLDGKLFIDYLRPLRRQMITRKMVKL 168


>gi|163733890|ref|ZP_02141332.1| peptide deformylase [Roseobacter litoralis Och 149]
 gi|161393001|gb|EDQ17328.1| peptide deformylase [Roseobacter litoralis Och 149]
          Length = 175

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 114/165 (69%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ +++ PDP L++++ P+  I+ ++  L D+MLE MY   GIGLAA Q+G+L R+ V+
Sbjct: 4   MKRSIILHPDPRLKKIAAPVADISDELRQLGDDMLETMYDAPGIGLAAPQVGILQRVFVM 63

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP++I  SD+ +VY+EGCLSIP+  ADV R A + +R+MD +  
Sbjct: 64  DCVKEPGETPRPIVMFNPEVIATSDETNVYEEGCLSIPEQFADVTRPADVELRWMDRDGA 123

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q     GL ATC QHE+DHL+G LFID+L  LKR MIT+KM KL
Sbjct: 124 EQTEVFTGLWATCAQHEIDHLDGKLFIDYLRPLKRQMITRKMVKL 168


>gi|110832992|ref|YP_691851.1| peptide deformylase [Alcanivorax borkumensis SK2]
 gi|122959726|sp|Q0VTE1|DEF_ALCBS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|110646103|emb|CAL15579.1| peptide deformylase [Alcanivorax borkumensis SK2]
          Length = 168

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/166 (47%), Positives = 116/166 (69%), Gaps = 4/166 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ FPDP LR V++P+EK++ ++  LID+M E MY+  GIGLAA Q+ V  +L+V
Sbjct: 1   MAKLEILEFPDPRLRTVAKPVEKVDDELRKLIDDMFETMYAAPGIGLAATQVDVHIQLIV 60

Query: 61  IDL-QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +DL +DH     PMVFINP+I   +++ + Y+EGCLS+P +   V R A + +  +D + 
Sbjct: 61  MDLSEDH---NKPMVFINPQITPLTEEQAPYEEGCLSVPGFYEKVTRPARVRINALDRDG 117

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
               + AD LLATC+QHE+DHL+G LF+D++SRLKRD I KK+ K+
Sbjct: 118 NAFEVEADELLATCIQHEMDHLDGKLFVDYVSRLKRDRIKKKLEKI 163


>gi|83859278|ref|ZP_00952799.1| polypeptide deformylase [Oceanicaulis alexandrii HTCC2633]
 gi|83852725|gb|EAP90578.1| polypeptide deformylase [Oceanicaulis alexandrii HTCC2633]
          Length = 175

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 115/169 (68%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDP L+ VS+P++ ++  +  L+D+M+E MY+ DGIGLAA+Q+GV  R++V
Sbjct: 1   MAIREILTVPDPRLKLVSKPVDAVDDALRALMDDMVETMYAADGIGLAAIQVGVDKRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL D   R +P  ++NP I   ++D   YQEGCLS+PD    V+R   + V Y+D + +
Sbjct: 61  MDLSDE--RNDPRYYVNPVITPLTEDLKPYQEGCLSVPDVFDSVERPKKVKVEYLDYDGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            +   A+ L A C+QHE+DHL G++FID+LSRLKRD   KK+ KLV+ R
Sbjct: 119 KREEIAEDLFAVCIQHEMDHLEGVVFIDYLSRLKRDRAVKKVQKLVKQR 167


>gi|326388512|ref|ZP_08210106.1| peptide deformylase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206977|gb|EGD57800.1| peptide deformylase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 189

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 113/185 (61%), Gaps = 20/185 (10%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDP L++VS+P+E  + ++  L+ +M E MY   GIGLAA+Q+GV  R++V
Sbjct: 1   MAIREILEVPDPRLKQVSKPVEVFDDELKTLVADMFETMYDAPGIGLAAIQVGVPLRVLV 60

Query: 61  IDLQD--------------------HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDY 100
           IDLQ                        +K P+VFINP + + S+D +VY EGCLS+P+ 
Sbjct: 61  IDLQPDDPDAEPEVCTAHGGHHHTHQPTKKEPLVFINPVLSSLSEDLAVYNEGCLSVPEI 120

Query: 101 RADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITK 160
            A+V R + I  R+ D +        D LLATCLQHE+DHL GILFIDHLSRLKR M  K
Sbjct: 121 YAEVTRPSRIHARWQDLDGNVHEAEIDDLLATCLQHEMDHLEGILFIDHLSRLKRQMALK 180

Query: 161 KMSKL 165
           K+ KL
Sbjct: 181 KLEKL 185


>gi|296535343|ref|ZP_06897545.1| peptide deformylase [Roseomonas cervicalis ATCC 49957]
 gi|296264327|gb|EFH10750.1| peptide deformylase [Roseomonas cervicalis ATCC 49957]
          Length = 177

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 114/169 (67%), Gaps = 4/169 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSD-IMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P+++ PD  LR  +RP+   +++ +  L   ML  MY   GIGLAA QIG L RLVV+DL
Sbjct: 8   PILLVPDARLRAKARPVGPGDTETVRALAPRMLATMYKAPGIGLAAPQIGELLRLVVVDL 67

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
           Q    +  P V INP+I+  S + S  +EGCLS+P+  A+V R A I VR++D     + 
Sbjct: 68  QPD-EKPEPYVMINPEIVAASTELSSREEGCLSLPNQYAEVTRPAEIKVRWLDLEGAKRE 126

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV--QLRD 170
           + ADGLLATC+QHE+DHLNG+LF+DHLS LKR+M+ +K++K +  Q RD
Sbjct: 127 MQADGLLATCIQHEIDHLNGVLFVDHLSALKRNMLLRKLAKELKAQARD 175


>gi|254460256|ref|ZP_05073672.1| peptide deformylase [Rhodobacterales bacterium HTCC2083]
 gi|206676845|gb|EDZ41332.1| peptide deformylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 172

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 110/161 (68%), Gaps = 1/161 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-LQ 64
           ++I PDP L++V   +  I+  I +  D+MLE MY+  GIGLAA Q+GVL R++V+D ++
Sbjct: 5   ILIHPDPRLKKVCAAVPDISDKIRSFADDMLETMYTAPGIGLAAPQVGVLERMIVLDCVK 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  P+V +NP++I  SD+ +VY EGCLSIPD  ADV R   + V ++D +   Q  
Sbjct: 65  EDGAKPEPLVMVNPRVIAASDETNVYDEGCLSIPDQYADVTRPKEVRVEWLDLDGNLQKR 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
             DGL ATC+QHE+DHL G LFID+L  LKR MIT+KM KL
Sbjct: 125 DMDGLWATCVQHEIDHLEGKLFIDYLKPLKRQMITRKMQKL 165


>gi|16124527|ref|NP_419091.1| polypeptide deformylase [Caulobacter crescentus CB15]
 gi|221233212|ref|YP_002515648.1| peptide deformylase [Caulobacter crescentus NA1000]
 gi|23396553|sp|Q9ABF5|DEF_CAUCR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767574|sp|B8GYE3|DEF_CAUCN RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|13421407|gb|AAK22259.1| polypeptide deformylase [Caulobacter crescentus CB15]
 gi|220962384|gb|ACL93740.1| peptide deformylase [Caulobacter crescentus NA1000]
          Length = 173

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 105/151 (69%)

Query: 14  LRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPM 73
           L+++S P+E +  ++  L+D+MLE MY   GIGLAAVQ+G   R++V+DL      K P 
Sbjct: 18  LKKISTPVEAVTDELRALMDDMLETMYDAPGIGLAAVQVGEPVRVIVMDLAREGEDKAPR 77

Query: 74  VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATC 133
            F+NP+I+  S+D   Y+EGCLS+P+Y  +V+R + +T+RYM+   +  +  A+GL A C
Sbjct: 78  YFVNPEILASSEDLQGYEEGCLSVPEYYDEVERPSKVTLRYMNYQGETVVEEAEGLFAVC 137

Query: 134 LQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           +QHE+DHL G+LFIDHLSRL+RD    K+ K
Sbjct: 138 IQHEMDHLEGVLFIDHLSRLRRDRAMAKVKK 168


>gi|209965583|ref|YP_002298498.1| peptide deformylase, Def, putative [Rhodospirillum centenum SW]
 gi|209959049|gb|ACI99685.1| peptide deformylase, Def, putative [Rhodospirillum centenum SW]
          Length = 173

 Score =  164 bits (414), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 112/161 (69%), Gaps = 1/161 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I PD  LR+ + P+  ++  +  L+D+MLE MY   GIGLAA Q+GVL R++V+D+ +
Sbjct: 6   ILIVPDARLRQTAEPVANVDGRVARLMDDMLETMYKAPGIGLAAPQVGVLERVIVMDIAE 65

Query: 66  H-AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                  P++  NP+II  SD+ +  QEGCLSIPD  ADV R   + VRY+D + + + +
Sbjct: 66  RKTEAPTPILMANPEIIARSDELATAQEGCLSIPDIYADVTRPRQVRVRYVDRDGEVREL 125

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            ADGL ATC+QHE+DHLNG+LF+D+LS LKR M+ +++ K+
Sbjct: 126 DADGLTATCVQHEIDHLNGVLFVDYLSALKRSMLLRRLQKM 166


>gi|83951626|ref|ZP_00960358.1| peptide deformylase [Roseovarius nubinhibens ISM]
 gi|83836632|gb|EAP75929.1| peptide deformylase [Roseovarius nubinhibens ISM]
          Length = 172

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+P++I PDP L++V  P++ I+  +  L D+MLE MY   GIGLA  QIGV+ R++V+
Sbjct: 1   MKRPILIHPDPRLKKVCAPLDDISDAVRALADDMLETMYDAPGIGLAGPQIGVMDRIIVM 60

Query: 62  DLQ-DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D + D      P+V +NP++I  SD  + Y+EGCLSIPD  A+V R   + VR++  + +
Sbjct: 61  DCEKDEGVDPAPLVMVNPEVIASSDTLNTYEEGCLSIPDQFAEVTRPKEVEVRWLGLDGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                 DGL ATC+QHE+DHL+G LFID+L  +KR +IT+KM KL
Sbjct: 121 EHSRGFDGLWATCVQHEIDHLDGKLFIDYLGTMKRQLITRKMVKL 165


>gi|294085060|ref|YP_003551820.1| peptide deformylase protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664635|gb|ADE39736.1| peptide deformylase protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 177

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (68%), Gaps = 5/161 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PDP+LR  +  + ++   I NL+D+M   MY   GIGLAA QI +  RL+V+D   
Sbjct: 11  IIKLPDPVLREKAVAVPEVTDGIRNLLDDMAVTMYDAPGIGLAAPQINISERLIVMDC-- 68

Query: 66  HAHRKNPMVF--INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
               + P ++  INP+II  S+D S+ +EGCLSIPD  A+V R A +TVRY D +   Q+
Sbjct: 69  -GKDETPELYKMINPEIIETSEDKSILEEGCLSIPDQTAEVTRPATVTVRYTDIDGDTQM 127

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + A+GLLA C+QHE+DHLNG+LFIDH+SRLKRDMI +++ K
Sbjct: 128 LTAEGLLAACVQHEIDHLNGVLFIDHISRLKRDMIIRRVMK 168


>gi|259417507|ref|ZP_05741426.1| peptide deformylase [Silicibacter sp. TrichCH4B]
 gi|259346413|gb|EEW58227.1| peptide deformylase [Silicibacter sp. TrichCH4B]
          Length = 174

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 117/169 (69%), Gaps = 1/169 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L++++  +  ++ ++  L D+MLE MY+  GIGLAA QIG+L RL+V+
Sbjct: 1   MKRSILIHPDPRLKKIAADVPDLSDELRALADDMLETMYAAPGIGLAAPQIGILDRLIVL 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D +++      P+V  NP++I  SD+ +VY+EGCLSIP+  A+V R   + V ++D +  
Sbjct: 61  DCVKEGEGEARPLVMFNPRVIAASDETNVYEEGCLSIPEQYAEVTRPKVVDVEWLDRDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            Q    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL + R
Sbjct: 121 LQTETFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKLKRER 169


>gi|126733797|ref|ZP_01749544.1| Peptide deformylase [Roseobacter sp. CCS2]
 gi|126716663|gb|EBA13527.1| Peptide deformylase [Roseobacter sp. CCS2]
          Length = 173

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 114/166 (68%), Gaps = 1/166 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++I PDP L++V+ P+  +N D+  L D+MLE MY   GIGLAA QI V+ R++V
Sbjct: 1   MALRNILIHPDPRLKKVATPVPSVNDDLRRLADDMLETMYDAPGIGLAAPQIAVMNRMLV 60

Query: 61  IDL-QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D  ++      PMV INP+++  S++ +VY+EGCLSIP+  A+V+R   + V + + + 
Sbjct: 61  MDCAKEDDATPEPMVLINPEVVWTSEEQNVYEEGCLSIPEQYAEVERPTEVEVTWTNLDG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           Q +    DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL
Sbjct: 121 QAKRERFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKL 166


>gi|254419890|ref|ZP_05033614.1| peptide deformylase [Brevundimonas sp. BAL3]
 gi|196186067|gb|EDX81043.1| peptide deformylase [Brevundimonas sp. BAL3]
          Length = 192

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 16/173 (9%)

Query: 13  ILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH------ 66
           IL++VS+P+  ++  +  L+D+MLE MY+  GIGLAAVQ+G L R++V+DL D       
Sbjct: 17  ILKQVSKPVAAVDDAVRALMDDMLETMYAAPGIGLAAVQVGALDRVIVMDLGDRDGTICE 76

Query: 67  ----------AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                       RKNP  F NP+I+  SD+   Y+EGCLSIP+Y   V+R A + +RY++
Sbjct: 77  TEEEDTPEAAEARKNPRFFANPEILWTSDELYTYEEGCLSIPEYFDKVERPARVRIRYLN 136

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            + Q     A+GL A C+QHE+DHLNG+LFIDHLSRLKRD    K+ K  + R
Sbjct: 137 RDGQSVEEEAEGLYAVCIQHEMDHLNGVLFIDHLSRLKRDRAVTKVKKAARDR 189


>gi|149185875|ref|ZP_01864190.1| Peptide deformylase [Erythrobacter sp. SD-21]
 gi|148830436|gb|EDL48872.1| Peptide deformylase [Erythrobacter sp. SD-21]
          Length = 188

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 116/184 (63%), Gaps = 19/184 (10%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDP L+ VS P+ + + ++  L+ +M E MY   GIGLAA+Q+GV  R++V
Sbjct: 1   MAIREILEVPDPRLKVVSEPVTEFDDELRELVSDMFETMYDAPGIGLAAIQVGVPKRVLV 60

Query: 61  IDLQ----------------DHAH---RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYR 101
           IDLQ                +H H   +K P VF+NP+I+  ++D + YQEGCLS+PD  
Sbjct: 61  IDLQPEDEDAEGEVCNHGGHEHVHYPTKKEPRVFVNPEILDPAEDLATYQEGCLSVPDIF 120

Query: 102 ADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK 161
           ADV R A   VRY D   +      +GL+ATCLQHE+DHL GILFIDHLSRLKR+M  KK
Sbjct: 121 ADVDRPATCRVRYQDLEGETHEEELEGLMATCLQHEMDHLEGILFIDHLSRLKRNMALKK 180

Query: 162 MSKL 165
           + KL
Sbjct: 181 LKKL 184


>gi|295691230|ref|YP_003594923.1| peptide deformylase [Caulobacter segnis ATCC 21756]
 gi|295433133|gb|ADG12305.1| peptide deformylase [Caulobacter segnis ATCC 21756]
          Length = 173

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 105/152 (69%)

Query: 13  ILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNP 72
           +L+++S P+E +  ++  L+D+MLE MY   GIGLAAVQ+G   R++ +DL        P
Sbjct: 17  VLKKISTPVEVVTDELRALMDDMLETMYDAPGIGLAAVQVGEPVRVITMDLAREGEEPAP 76

Query: 73  MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLAT 132
             F+NP+I+  S++  VY+EGCLS+P+Y  +V+R A +T+RYM+   +  +  A+GL A 
Sbjct: 77  RYFVNPEILASSEEMFVYEEGCLSVPEYFDEVERPAKVTLRYMNYQGETVVEEAEGLFAV 136

Query: 133 CLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           C+QHE+DHL G+LFIDHLSRL+RD    K+ K
Sbjct: 137 CIQHEMDHLEGVLFIDHLSRLRRDRAIAKVKK 168


>gi|170742368|ref|YP_001771023.1| peptide deformylase [Methylobacterium sp. 4-46]
 gi|168196642|gb|ACA18589.1| peptide deformylase [Methylobacterium sp. 4-46]
          Length = 173

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 109/167 (65%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PD  LR  S P+  I  ++  L  +MLE MY   G+GLAA+Q+G   R+V 
Sbjct: 1   MTIRPLVILPDARLRVTSSPVGTITGEVRKLAADMLETMYDAPGVGLAAIQVGEPTRIVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID       + P+V I+P+I+  S++   Y+EGCLSIP+Y A+V R   + VR+   + +
Sbjct: 61  IDTSKDKEARTPLVLIDPEIVWSSEETRAYEEGCLSIPEYYAEVVRPDRVRVRFRTLDGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLATCLQHELDHLNG+LFIDH+S+LKRD + KK +K  +
Sbjct: 121 TVEQEADGLLATCLQHELDHLNGVLFIDHISKLKRDRVMKKFAKAAK 167


>gi|159042735|ref|YP_001531529.1| peptide deformylase [Dinoroseobacter shibae DFL 12]
 gi|157910495|gb|ABV91928.1| peptide deformylase [Dinoroseobacter shibae DFL 12]
          Length = 187

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 106/169 (62%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++I PDP L++   P+ +I  +I  L D+ML  MY   GIGLA  Q+  + R++ 
Sbjct: 14  MTIRPILIHPDPRLKKTVDPVAEITDEIRQLADDMLATMYDAPGIGLAGPQVAAMTRIIT 73

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D        +PMV INP+I+  S++ + Y+EGCLSIP+  ADV+R A + VR+      
Sbjct: 74  MDCAPKDGEPDPMVLINPEIVWSSEEMNTYEEGCLSIPEMYADVERPAEVEVRWTTLEGG 133

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                  GL ATC+QHE+DHLNG LFID+L  LKR MIT+KM KL + R
Sbjct: 134 DASARWGGLHATCVQHEIDHLNGKLFIDYLKPLKRQMITRKMVKLKRER 182


>gi|220924615|ref|YP_002499917.1| peptide deformylase [Methylobacterium nodulans ORS 2060]
 gi|219949222|gb|ACL59614.1| peptide deformylase [Methylobacterium nodulans ORS 2060]
          Length = 173

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 110/167 (65%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +PLVI PD  LR  S P+  I  ++  L  +MLE MY   G+GLAA+QIG   R+V 
Sbjct: 1   MTIRPLVILPDARLRVTSEPVGTITGEVRKLASDMLETMYDAPGVGLAAIQIGEPTRIVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D       +NP+V ++P+I+  S++   Y+EGCLSIP+Y A+V R   + VR+   + +
Sbjct: 61  VDTSKDKEARNPLVLLDPEIVWASEETRSYEEGCLSIPEYYAEVVRPDRVRVRFRTLDGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLATCLQHE+DHLNG+LFIDH+S+LKRD + KK +K  +
Sbjct: 121 VVEQEADGLLATCLQHEIDHLNGVLFIDHISKLKRDRVLKKFAKAAK 167


>gi|254436643|ref|ZP_05050137.1| peptide deformylase [Octadecabacter antarcticus 307]
 gi|198252089|gb|EDY76403.1| peptide deformylase [Octadecabacter antarcticus 307]
          Length = 178

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 1/166 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +++ PDP L+ V+ P+  ++  +  L D+MLE MY+  GIGLAA Q+G++ R++V
Sbjct: 4   MTLRSILLHPDPRLKSVADPVATVDKTLHALADDMLETMYNAPGIGLAAPQLGIMQRMLV 63

Query: 61  ID-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D ++D      PMV INP++I  S D ++Y EGCLSIPD  A+V+R A + V +M+ + 
Sbjct: 64  MDCIKDDMETPQPMVLINPRVIFASSDTNIYDEGCLSIPDQYAEVERPAVVKVEWMNLDG 123

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q      L ATC+QHE+DHLNG LFID+L  L+R MIT+KM KL
Sbjct: 124 KTQQEEFSDLWATCVQHEIDHLNGKLFIDYLKPLRRQMITRKMQKL 169


>gi|330806738|ref|YP_004351200.1| peptide deformylase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374846|gb|AEA66196.1| Peptide deformylase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 168

 Score =  161 bits (408), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+  ++ ++  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+  T +D+   YQEGCLS+P +  +V R   + ++ +D + Q   + A+G
Sbjct: 67  RSEPRVFINPEFETLTDEMDQYQEGCLSVPGFYENVDRPQKVKIKALDRDGQPYELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ KL
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKL 163


>gi|119383399|ref|YP_914455.1| peptide deformylase [Paracoccus denitrificans PD1222]
 gi|119373166|gb|ABL68759.1| peptide deformylase [Paracoccus denitrificans PD1222]
          Length = 173

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 111/170 (65%), Gaps = 1/170 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +++ PDP L+++  P+ +I  +I  L  +ML  MY   G+GLAA Q+GVL RL V
Sbjct: 1   MTLRSIILHPDPRLKKICEPVARITPEIETLAADMLATMYDAPGVGLAAPQVGVLSRLYV 60

Query: 61  IDLQ-DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D + D    +NP+V +NP++   S+  + Y+EGCLSIP+  ADV R A + VR++  + 
Sbjct: 61  MDCEKDPEAPRNPIVMVNPEVTWTSEALNTYEEGCLSIPEQYADVTRPAEVRVRWLGLDG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           +      +GL ATC QHE+DHL+G LFIDHL  +KR MIT+KM KL + R
Sbjct: 121 KTHEREFEGLWATCAQHEIDHLDGRLFIDHLGPIKRQMITRKMVKLKRER 170


>gi|84514541|ref|ZP_01001905.1| peptide deformylase [Loktanella vestfoldensis SKA53]
 gi|84511592|gb|EAQ08045.1| peptide deformylase [Loktanella vestfoldensis SKA53]
          Length = 173

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/166 (50%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++I PDP L++V+ P+  I+ D+  L D+MLE MY   GIGLAA Q+ V+ R++V
Sbjct: 1   MTIRPILIHPDPRLKKVTAPVASIDDDLRRLADDMLETMYEAPGIGLAAPQVAVMRRVIV 60

Query: 61  IDLQ-DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D Q D      PMV INP+II  S+  SVY EGCLSIP+  A+V R A + V ++  + 
Sbjct: 61  MDCQKDAEATPEPMVLINPEIIWSSEATSVYDEGCLSIPEQYAEVTRPAEVEVAWLGLDG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q    DGL ATC+QHE+DHL+G LFID L  LKR MIT+KM KL
Sbjct: 121 KPQRARFDGLWATCVQHEIDHLDGKLFIDCLGPLKRQMITRKMQKL 166


>gi|77464452|ref|YP_353956.1| peptide deformylase [Rhodobacter sphaeroides 2.4.1]
 gi|126463292|ref|YP_001044406.1| peptide deformylase [Rhodobacter sphaeroides ATCC 17029]
 gi|221640344|ref|YP_002526606.1| peptide deformylase [Rhodobacter sphaeroides KD131]
 gi|332559341|ref|ZP_08413663.1| Peptide deformylase [Rhodobacter sphaeroides WS8N]
 gi|77388870|gb|ABA80055.1| peptide deformylase [Rhodobacter sphaeroides 2.4.1]
 gi|126104956|gb|ABN77634.1| peptide deformylase [Rhodobacter sphaeroides ATCC 17029]
 gi|221161125|gb|ACM02105.1| Peptide deformylase [Rhodobacter sphaeroides KD131]
 gi|332277053|gb|EGJ22368.1| Peptide deformylase [Rhodobacter sphaeroides WS8N]
          Length = 177

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           +P++I PDP L+++  P+ +I  D+  L D+ML  MY   GIGLAA Q+GV+ RL+V+D 
Sbjct: 3   RPILIHPDPRLKKICDPVGQITDDLRRLADDMLATMYDAPGIGLAAPQVGVVRRLIVLDC 62

Query: 64  QDHA-HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
              +   + P+  +NP+++  S+D S Y+EGCLS+P+  ADV+R A + VR+   + + +
Sbjct: 63  NKESDGARRPVAMVNPEVVWRSEDVSTYEEGCLSLPNVFADVERPAEVKVRWTGLDGREE 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                GL ATC+QHE+DHL+G LFID+L  LKR MIT+KM K 
Sbjct: 123 EEQFAGLWATCVQHEIDHLDGKLFIDYLRPLKRQMITRKMEKF 165


>gi|226942187|ref|YP_002797260.1| peptide deformylase [Azotobacter vinelandii DJ]
 gi|259645177|sp|C1DFV8|DEF_AZOVD RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|226717114|gb|ACO76285.1| Formylmethionine deformylase protein [Azotobacter vinelandii DJ]
          Length = 168

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 105/156 (67%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++PIE ++  I  LID+M E MY+  GIGLAA Q+ V  RLVV+DL +   
Sbjct: 9   FPDPRLRTIAKPIETVDDGIRRLIDDMFETMYAAPGIGLAATQVNVHKRLVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    +++   YQEGCLS+P +  +V R   + +R +D + Q   + A+G
Sbjct: 67  KNEPRVFINPEFEALTEELEPYQEGCLSVPGFYENVDRPQKVRIRALDRDGQPFELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 162


>gi|144898454|emb|CAM75318.1| peptide deformylase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 170

 Score =  161 bits (407), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 109/159 (68%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PDP L++ +  +  +++ I  L+D+MLE MY+  GIGLAA Q+ V  R++V D+  
Sbjct: 6   ILTAPDPRLKQKAAVVADVDASIRTLMDDMLETMYAAPGIGLAAPQVAVGKRVIVADIGR 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
               + P+  +NP+I+  SDD + Y+EGCLS+P++ A V R   I VRY D    HQ I 
Sbjct: 66  SEDDRQPVRMVNPEIVWVSDDDNTYEEGCLSVPEHYAAVVRPRAIRVRYRDETGTHQEID 125

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLAT LQHE+DHL+GILFIDHLS LKR+MI +K+ K
Sbjct: 126 ADGLLATVLQHEMDHLDGILFIDHLSSLKRNMILRKLLK 164


>gi|115372443|ref|ZP_01459752.1| peptide deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|310819504|ref|YP_003951862.1| peptide deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|115370656|gb|EAU69582.1| peptide deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|309392576|gb|ADO70035.1| Peptide deformylase [Stigmatella aurantiaca DW4/3-1]
          Length = 173

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 112/167 (67%), Gaps = 1/167 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++I+P P+L++ +RP+ K++  +  L+ +M E MY+ DG+GLAA Q+G+L R++V+D 
Sbjct: 3   REILIWPHPVLKQKARPVAKVDDAVRALVKDMFETMYAADGVGLAAPQVGILQRIIVLDT 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                   P+  INP+I+   +  + Y EGCLSIP    DV R+A +TV+++D + Q Q 
Sbjct: 63  TPRQPDSKPLAMINPEIVGM-EGATTYTEGCLSIPGEAEDVDRAAIVTVKFLDVDGQEQT 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           +  D LLA  +QHE DHL+G +F+DH+S LKR++I K+M +L   R+
Sbjct: 122 LTCDDLLAIAVQHETDHLDGTVFVDHVSSLKREIIRKRMKRLKTERE 168


>gi|294678913|ref|YP_003579528.1| peptide deformylase [Rhodobacter capsulatus SB 1003]
 gi|294477733|gb|ADE87121.1| peptide deformylase-2 [Rhodobacter capsulatus SB 1003]
          Length = 178

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++I PDP L+++  P+  ++  I  L D+MLE MY   G+GLAA QIGV+ R+ V
Sbjct: 3   MTTRPILIHPDPRLKKLCDPVAALDDTIRQLADDMLETMYDAPGVGLAAPQIGVMSRIFV 62

Query: 61  IDL-QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D  ++       MV INP+I   S++ +V++EGCLS+P+  ADV R   + +R++  + 
Sbjct: 63  MDCAKEKTGFPEAMVMINPEITWVSEEKNVHEEGCLSLPEQYADVTRPKEVRMRWLGLDG 122

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           Q      DGL ATC QHELDHLNG LFIDHL  LKR M+T+K+ KL
Sbjct: 123 QMHEEQFDGLWATCAQHELDHLNGKLFIDHLGPLKRQMVTRKLEKL 168


>gi|146276205|ref|YP_001166364.1| peptide deformylase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554446|gb|ABP69059.1| peptide deformylase [Rhodobacter sphaeroides ATCC 17025]
          Length = 177

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 111/164 (67%), Gaps = 3/164 (1%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++I PDP L+++  P+ +I  D+  L D+ML  MY   GIGLAA Q+GV+ RLVV+D 
Sbjct: 3   RSILIHPDPRLKKICDPVAEITDDLRRLADDMLATMYDAPGIGLAAPQVGVMRRLVVMDC 62

Query: 64  --QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
             Q  A R+ P+  INP+++  S+D S Y+EGCLS+P+  A+V+R A + VR+   + + 
Sbjct: 63  NKQPEAPRR-PIAMINPQVVWASEDLSTYEEGCLSLPNVFAEVERPAEVKVRWTGIDGRE 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +     GL ATC+QHE+DHL+G LFID+L  LKR MIT+KM K 
Sbjct: 122 EEEQFSGLWATCVQHEIDHLDGKLFIDYLRPLKRQMITRKMEKF 165


>gi|163795436|ref|ZP_02189403.1| N-formylmethionyl-tRNA deformylase [alpha proteobacterium BAL199]
 gi|159179422|gb|EDP63953.1| N-formylmethionyl-tRNA deformylase [alpha proteobacterium BAL199]
          Length = 175

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 108/153 (70%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP+L+   R ++ ++ ++  LID+M + MY   G+GLAA Q+GV  R++V+D+ 
Sbjct: 5   PIIWAPDPVLKTKCRSVDVVDDEVRRLIDDMFQTMYFAPGVGLAAPQVGVTKRVIVVDVA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
               +  P+  +NP+I+  SD   +Y+EGCLS+P+  ADV+R++ + VRY+D +   Q I
Sbjct: 65  GKDEKPQPIALVNPEIVWRSDATQIYEEGCLSLPELYADVERASHVKVRYLDRDGAEQKI 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
             +GLLA CLQHE+DH++G+LF+DH+S LKR++
Sbjct: 125 EGEGLLAVCLQHEIDHIDGVLFVDHISALKRNI 157


>gi|226327658|ref|ZP_03803176.1| hypothetical protein PROPEN_01530 [Proteus penneri ATCC 35198]
 gi|225204184|gb|EEG86538.1| hypothetical protein PROPEN_01530 [Proteus penneri ATCC 35198]
          Length = 172

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 84/166 (50%), Positives = 110/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           PL+ FPD  LRRV+ P+EK++ +I  LID+M+E MY+  GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PLLRFPDERLRRVAVPVEKVDDEIRTLIDDMIETMYAERGIGLAAPQVNVSKRIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  R  P+  INP+II+  D+     +GCLSIPD  A  +R  F+ VR +D N     +
Sbjct: 65  EN--RDQPIALINPEIISTEDEVMDMMDGCLSIPDSFAPTERYRFLKVRALDRNGDEIEL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            A  L A C+QHELDHL+G LFIDHLS LKR  I KK  KL +L D
Sbjct: 123 EASDLFAGCIQHELDHLDGKLFIDHLSPLKRQRIEKKQKKLSKLID 168


>gi|21233177|ref|NP_639094.1| peptide deformylase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66770117|ref|YP_244879.1| peptide deformylase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188993325|ref|YP_001905335.1| peptide deformylase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|39931165|sp|Q8P4F9|DEF2_XANCP RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|21115026|gb|AAM43006.1| polypeptide deformylase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66575449|gb|AAY50859.1| polypeptide deformylase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167735085|emb|CAP53297.1| Peptide deformylase [Xanthomonas campestris pv. campestris]
          Length = 170

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (67%), Gaps = 6/164 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E ++     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAEVVSPAFQTLLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  P VFINP+I+T   +  VYQEGCLS+P   ADV R+  ITVRY+D   Q 
Sbjct: 65  DVSEE--KDAPQVFINPEIVTRQGE-QVYQEGCLSVPGIFADVSRADAITVRYLDRQGQP 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           Q +  DGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++KL
Sbjct: 122 QELSTDGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAKL 165


>gi|294625234|ref|ZP_06703874.1| peptide deformylase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|294666267|ref|ZP_06731518.1| peptide deformylase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292600462|gb|EFF44559.1| peptide deformylase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292603976|gb|EFF47376.1| peptide deformylase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 170

 Score =  160 bits (405), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 111/163 (68%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAEVTSQAFQTLLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ D   R  P VF+NP+I++   +  +YQEGCLS+P   ADV R+  ITVRY+D   Q 
Sbjct: 65  DISDE--RNLPQVFVNPEIVSKQGE-QLYQEGCLSVPGIYADVSRADAITVRYLDRQGQP 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q ++ADGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 122 QELHADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|126728524|ref|ZP_01744340.1| peptide deformylase [Sagittula stellata E-37]
 gi|126711489|gb|EBA10539.1| peptide deformylase [Sagittula stellata E-37]
          Length = 175

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 115/170 (67%), Gaps = 2/170 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L++V   +  ++ ++  L D+MLE MY   GIGLAA QIGVL RL+V+
Sbjct: 1   MKRSIIIHPDPRLKKVCDAVPDLSDELHVLADDMLETMYDAPGIGLAAPQIGVLSRLIVL 60

Query: 62  DL--QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           D    D+     P+V  NP++I  SD+ +VY+EGCLSIP+  A+V+R   + V ++D + 
Sbjct: 61  DCAKSDNGEDARPLVMFNPRVIASSDEQNVYEEGCLSIPEQYAEVERPRVVDVEWLDRDG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             +    DGL ATC+QHE+DHL+G LFID+L  L+R MIT+KM KL + R
Sbjct: 121 MLRTETFDGLWATCVQHEIDHLDGKLFIDYLKPLRRQMITRKMVKLKKER 170


>gi|315497920|ref|YP_004086724.1| peptide deformylase [Asticcacaulis excentricus CB 48]
 gi|315415932|gb|ADU12573.1| peptide deformylase [Asticcacaulis excentricus CB 48]
          Length = 178

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 111/165 (67%), Gaps = 9/165 (5%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEK-INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLV 59
           M  + ++  P P+L++VS+P+E  +  ++  L+D+MLE MY   GIGLAA+QIG   R++
Sbjct: 1   MAIRDIITVPHPLLKQVSKPVEGGVTDELRALMDDMLETMYDAPGIGLAAIQIGEPIRVI 60

Query: 60  VIDLQ--------DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFIT 111
           V+DLQ        D    K P  F+NP+II  S++ S Y EGCLS+P+   +VKR A + 
Sbjct: 61  VMDLQERPDDLPEDAPAPKQPRYFVNPEIIWASEELSTYDEGCLSVPEVYDEVKRPARVR 120

Query: 112 VRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRD 156
           ++Y++   +  I   DGL ATC+QHE+DHLNG+LFIDHLS+LKRD
Sbjct: 121 LKYLNYQGEEVIEECDGLYATCIQHEMDHLNGVLFIDHLSKLKRD 165


>gi|237806929|ref|YP_002891369.1| peptide deformylase [Tolumonas auensis DSM 9187]
 gi|259645187|sp|C4L7Y4|DEF_TOLAT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|237499190|gb|ACQ91783.1| peptide deformylase [Tolumonas auensis DSM 9187]
          Length = 167

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+++ PIEKI SD+ ++I++M E MY  +GIGLAA Q+ +  RLVV+D  ++  
Sbjct: 9   FPDERLRKIATPIEKITSDLEHIIEDMFETMYLEEGIGLAATQVNIHKRLVVVDTSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP++I    +  + +EGCLS+P+ RA V R+ +I VR +D + +   I ADG
Sbjct: 67  RDQPMVFINPELIEKRGETGI-EEGCLSVPECRAFVPRAEWIKVRALDRHGEPFEIEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA CLQHE+DHL G LF+D+LS LKR  I +K+ KL +
Sbjct: 126 LLAICLQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKLAR 164


>gi|293611136|ref|ZP_06693434.1| peptide deformylase [Acinetobacter sp. SH024]
 gi|292826387|gb|EFF84754.1| peptide deformylase [Acinetobacter sp. SH024]
 gi|325124152|gb|ADY83675.1| peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA deformylase,
           binds Zn(II)) [Acinetobacter calcoaceticus PHEA-2]
          Length = 176

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 112/166 (67%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +MLE MY+  GIGLAA Q+    +L+VIDL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMLETMYAAPGIGLAASQVDRHIQLIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   + +PMVFINPKI   ++D   Y+EGCLS+P     V+R + + +  ++   Q   +
Sbjct: 65  ES--KDDPMVFINPKITPLTEDKQQYEEGCLSVPQIYDKVERPSRVKIEAINLEGQAFEL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKVVRQRE 168


>gi|302186428|ref|ZP_07263101.1| peptide deformylase [Pseudomonas syringae pv. syringae 642]
          Length = 168

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 105/156 (67%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAMVDDGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLATC+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLATCIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|40062663|gb|AAR37584.1| polypeptide deformylase [uncultured marine bacterium 313]
          Length = 185

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 118/175 (67%), Gaps = 11/175 (6%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  P+ +LR  S  +++++ D+  L+++MLE MY+  GIGLAA+Q+GV  R++V
Sbjct: 1   MALRKILTEPNKLLREKSLTVKEVDEDLQKLMNDMLETMYAAPGIGLAAIQVGVPKRVIV 60

Query: 61  IDL-----------QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAF 109
           +D+           +    RKNP+ F+NP+IIT S + S Y+EGCLS+P   A++ R   
Sbjct: 61  LDIGWRDKPESTNDEKQDERKNPIYFVNPEIITKSTNNSTYEEGCLSVPGQFAEIDRPDK 120

Query: 110 ITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             ++Y+D   Q + + A+G+ ATC+QHE+DHL GILFID+LS+LK+ MI KK++K
Sbjct: 121 CHIKYLDYYGQPKELMAEGMFATCIQHEIDHLEGILFIDYLSKLKKSMIVKKLAK 175


>gi|153003639|ref|YP_001377964.1| peptide deformylase [Anaeromyxobacter sp. Fw109-5]
 gi|152027212|gb|ABS24980.1| peptide deformylase [Anaeromyxobacter sp. Fw109-5]
          Length = 185

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + +VI+PDPIL+ V+ P+E+++  I  L+D+M E MY+ DG+GLAA QI VL R++VID 
Sbjct: 3   REIVIWPDPILKEVANPVERVDDSIRRLLDDMAETMYAADGVGLAAPQIAVLKRVIVIDT 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 +  +  +NP+I+  ++  + + EGCLSIP    DV R+A + VR +D + +   
Sbjct: 63  SPRQEGQKLIHLVNPEIVR-AEGETTWTEGCLSIPGEAEDVARAAKVWVRALDYHGKPFE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + AD LLA  +QHE DHLNG LF+DHLS LKR++I K+M KL   R
Sbjct: 122 LEADELLAIAVQHETDHLNGTLFVDHLSSLKRELIRKRMKKLKTQR 167


>gi|71737781|ref|YP_272335.1| peptide deformylase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71558334|gb|AAZ37545.1| peptide deformylase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320326682|gb|EFW82727.1| peptide deformylase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331344|gb|EFW87287.1| peptide deformylase [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 168

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAMVDEGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D N +   + A+G
Sbjct: 67  RSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRNGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|114568993|ref|YP_755673.1| peptide deformylase [Maricaulis maris MCS10]
 gi|122316781|sp|Q0ASK2|DEF_MARMM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|114339455|gb|ABI64735.1| peptide deformylase [Maricaulis maris MCS10]
          Length = 174

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 113/170 (66%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PDPIL+ VS+P+++++ D+  L+D+ML+ MY+ DGIGLAA+Q+GV  R++V
Sbjct: 1   MAIREILTVPDPILKEVSQPVDQVDDDLRELMDDMLQTMYAADGIGLAAIQVGVPKRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL        P  F+NP +   SD    Y+EGCLS+P    +++R   I ++Y+D +  
Sbjct: 61  MDLAGSDEEAKPRYFVNPVLSDPSDTLKPYEEGCLSVPTVYDEIERPDRIHIQYLDYDGN 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
                A+G+ A C+QHE+DHL G+LFID+LSRLKR    +K+ K+ + +D
Sbjct: 121 ECEEIAEGMFAVCIQHEMDHLEGVLFIDYLSRLKRQRAVQKVKKVEKSKD 170


>gi|260574964|ref|ZP_05842966.1| peptide deformylase [Rhodobacter sp. SW2]
 gi|259022969|gb|EEW26263.1| peptide deformylase [Rhodobacter sp. SW2]
          Length = 181

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K+ ++I PDP L+++  P+ KI  +I  L ++MLE MY   GIGLAA Q+GV  +L+V+
Sbjct: 1   MKRTILIHPDPRLKKICEPVPKITVEIGRLAEDMLETMYDAPGIGLAAPQLGVTKQLIVM 60

Query: 62  D-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D ++D A    PM   NP +   S+D S Y+EGCLS+P+  A+++R + + VR+   +  
Sbjct: 61  DCVKDPALTARPMAMFNPVVTWASEDLSTYEEGCLSLPNQYAEIERPSEVRVRWTGLDGV 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q  +  GL ATC+QHE+DHL+G LFID+L  L+R MIT+KM KL
Sbjct: 121 EQEEHFTGLWATCVQHEIDHLSGKLFIDYLRPLRRQMITRKMEKL 165


>gi|254487738|ref|ZP_05100943.1| peptide deformylase [Roseobacter sp. GAI101]
 gi|214044607|gb|EEB85245.1| peptide deformylase [Roseobacter sp. GAI101]
          Length = 174

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           ++K+ +++ PDP L+++  P+  +  ++  L D+ML  MY   GIGLAA QIGVL RL+V
Sbjct: 2   VMKRNIILHPDPRLKKLCAPVTDMTDELRALADDMLATMYDAPGIGLAAPQIGVLNRLIV 61

Query: 61  ID-LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           +D +++   +  P++  NP++I  SD  S Y+EGCLSIPD  ADV R A + VR++D + 
Sbjct: 62  MDCVKEEGEKPRPLIMFNPEVIASSDIESTYEEGCLSIPDQFADVTRPAEVDVRWIDRDG 121

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                    L ATC+QHE+DHL+G LFID+L  L+R MIT+KM+KL
Sbjct: 122 NEHTETFSKLWATCVQHEIDHLDGKLFIDYLKPLRRQMITRKMTKL 167


>gi|71276449|ref|ZP_00652725.1| Formylmethionine deformylase [Xylella fastidiosa Dixon]
 gi|71901278|ref|ZP_00683377.1| Formylmethionine deformylase [Xylella fastidiosa Ann-1]
 gi|170731000|ref|YP_001776433.1| peptide deformylase [Xylella fastidiosa M12]
 gi|238687947|sp|B0U4M4|DEF_XYLFM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|71162765|gb|EAO12491.1| Formylmethionine deformylase [Xylella fastidiosa Dixon]
 gi|71728969|gb|EAO31101.1| Formylmethionine deformylase [Xylella fastidiosa Ann-1]
 gi|167965793|gb|ACA12803.1| Peptide deformylase [Xylella fastidiosa M12]
          Length = 170

 Score =  159 bits (401), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 111/163 (68%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +  +   E ++S    L+D+M E MY+  GIGLAA Q+ V  R +V+
Sbjct: 5   PILEFPDPRLRTKAVRVGVAEVVSSSFQTLLDDMFETMYAAPGIGLAATQVNVHQRFMVV 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  PMVFINP+I+T   D  V+QEGCLS+P   ADV R+  I VR++D +   
Sbjct: 65  DVSEE--KNAPMVFINPEIVTREGD-QVFQEGCLSVPGIHADVTRALSIVVRFLDRHGDE 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + A+GLLA C+QHE+DHL+G LFID+LS LKRDM+ +K+ K
Sbjct: 122 QQLTAEGLLAVCIQHEMDHLDGKLFIDYLSPLKRDMVRRKLEK 164


>gi|86157152|ref|YP_463937.1| peptide deformylase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773663|gb|ABC80500.1| peptide deformylase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 185

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + +VI+PDPIL+ V++P+++++  I  L+D+M E MY+ DG+GLAA QI V  R++VID 
Sbjct: 3   REIVIWPDPILKEVAQPVDRVDDGIRRLLDDMAETMYAADGVGLAAPQIAVKKRVIVIDT 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 +  +  +NP+I+    + + Y EGCLSIP    DV R A + VR +D   +   
Sbjct: 63  SPRQEGQTLLHLVNPEIVRGEGELT-YTEGCLSIPGEAEDVDRFARVWVRALDRQGKPFE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + ADGLLA  LQHE DHLNG +F+DHLS LKR++I K+M KL   R
Sbjct: 122 LEADGLLAVALQHETDHLNGTMFVDHLSSLKRELIRKRMKKLKAQR 167


>gi|127514664|ref|YP_001095861.1| peptide deformylase [Shewanella loihica PV-4]
 gi|126639959|gb|ABO25602.1| peptide deformylase [Shewanella loihica PV-4]
          Length = 170

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 106/161 (65%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++PI + N+++   IDNM E MY   GIGLAA Q+   ++L+V+DLQD   
Sbjct: 9   FPDERLRTIAKPITEFNAELQTQIDNMFETMYEEKGIGLAATQVDYHHQLIVMDLQDDVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +II  S DF   +EGCLS+P   A V R+ F+T++ +D +     + ADG
Sbjct: 69  R--PKVFINLEIIEKSGDF-CNEEGCLSVPGIYAKVDRAEFVTIKALDRDGNEFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHELDHLNG LF+D+LS LKR  I +K+ K  +L 
Sbjct: 126 LFAICLQHELDHLNGKLFVDYLSPLKRQRIKQKLEKAARLE 166


>gi|299771931|ref|YP_003733957.1| peptide deformylase [Acinetobacter sp. DR1]
 gi|298702019|gb|ADI92584.1| peptide deformylase [Acinetobacter sp. DR1]
          Length = 176

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +MLE MY+  GIGLAA Q+    +L+VIDL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMLETMYAAPGIGLAASQVDRHIQLIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  P+VFINPKI   ++D   Y+EGCLS+P     V+R + + +  ++   Q   I
Sbjct: 65  EA--KDEPLVFINPKITPLTEDKQQYEEGCLSVPQIYDKVERPSRVKIEAINLEGQAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKVVRQRE 168


>gi|258622990|ref|ZP_05718005.1| peptide deformylase [Vibrio mimicus VM573]
 gi|258584773|gb|EEW09507.1| peptide deformylase [Vibrio mimicus VM573]
          Length = 169

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  +ID+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQQIIDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 66  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYSFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 162


>gi|161501956|ref|YP_257174.2| peptide deformylase [Pseudomonas fluorescens Pf-5]
          Length = 168

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+  ++ ++  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+    +D+   YQEGCLS+P +  +V R   + ++ +D + Q   + A+G
Sbjct: 67  RSEPRVFINPEFEALTDEMDQYQEGCLSVPGFYENVDRPQRVKIKALDRDGQPYELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEK 162


>gi|15837528|ref|NP_298216.1| peptide deformylase [Xylella fastidiosa 9a5c]
 gi|28199634|ref|NP_779948.1| peptide deformylase [Xylella fastidiosa Temecula1]
 gi|182682379|ref|YP_001830539.1| peptide deformylase [Xylella fastidiosa M23]
 gi|54036955|sp|P63918|DEF_XYLFT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|54040743|sp|P63917|DEF_XYLFA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238691097|sp|B2I8S4|DEF_XYLF2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|9105847|gb|AAF83736.1|AE003931_13 polypeptide deformylase [Xylella fastidiosa 9a5c]
 gi|28057749|gb|AAO29597.1| polypeptide deformylase [Xylella fastidiosa Temecula1]
 gi|182632489|gb|ACB93265.1| peptide deformylase [Xylella fastidiosa M23]
 gi|307578661|gb|ADN62630.1| peptide deformylase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 170

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 111/163 (68%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +  +   E ++S    L+D+M E MY+  GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVRVGVAEVVSSSFQTLLDDMFETMYAAPGIGLAATQVNVHQRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  PMVFINP+I+T   D  V+QEGCLS+P   ADV R+  I VR++D +   
Sbjct: 65  DVSEE--KNVPMVFINPEIVTREGD-QVFQEGCLSVPGIHADVTRALSIVVRFLDRHGDE 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + A+GLLA C+QHE+DHL+G LFID+LS LKRDM+ +K+ K
Sbjct: 122 QQLTAEGLLAVCIQHEMDHLDGKLFIDYLSPLKRDMVRRKLEK 164


>gi|71898893|ref|ZP_00681060.1| Formylmethionine deformylase [Xylella fastidiosa Ann-1]
 gi|71731305|gb|EAO33369.1| Formylmethionine deformylase [Xylella fastidiosa Ann-1]
          Length = 170

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 111/163 (68%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +  +   E ++S    L+D+M E MY+  GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVRVGVAEVVSSSFQTLLDDMFETMYAAPGIGLAATQVNVHQRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  PMVFINP+I+T   D  V+QEGCLS+P   ADV R+  I VR++D +   
Sbjct: 65  DVSEE--KNVPMVFINPEIVTKEGD-QVFQEGCLSVPGIHADVTRALSIVVRFLDRHGDE 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + A+GLLA C+QHE+DHL+G LFID+LS LKRDM+ +K+ K
Sbjct: 122 QQLTAEGLLAVCIQHEMDHLDGKLFIDYLSPLKRDMVRRKLEK 164


>gi|78049482|ref|YP_365657.1| peptide deformylase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325926150|ref|ZP_08187511.1| peptide deformylase [Xanthomonas perforans 91-118]
 gi|78037912|emb|CAJ25657.1| peptide deformylase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325543495|gb|EGD14917.1| peptide deformylase [Xanthomonas perforans 91-118]
          Length = 170

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (67%), Gaps = 8/164 (4%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAEVTSQAFQTLLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D+ D    KN P VF+NP+I++   +  +YQEGCLS+P   ADV R+  ITVRY+D   Q
Sbjct: 65  DISDE---KNLPQVFVNPEIVSKQGE-QLYQEGCLSVPGIYADVSRADAITVRYLDRQGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q + ADGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 121 AQELQADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|258626114|ref|ZP_05720965.1| peptide deformylase [Vibrio mimicus VM603]
 gi|262166814|ref|ZP_06034551.1| peptide deformylase [Vibrio mimicus VM223]
 gi|262172812|ref|ZP_06040490.1| peptide deformylase [Vibrio mimicus MB-451]
 gi|258581640|gb|EEW06538.1| peptide deformylase [Vibrio mimicus VM603]
 gi|261893888|gb|EEY39874.1| peptide deformylase [Vibrio mimicus MB-451]
 gi|262026530|gb|EEY45198.1| peptide deformylase [Vibrio mimicus VM223]
          Length = 169

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 66  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYSFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 162


>gi|68347834|gb|AAY95440.1| polypeptide deformylase [Pseudomonas fluorescens Pf-5]
          Length = 213

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+  ++ ++  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 54  FPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 111

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+    +D+   YQEGCLS+P +  +V R   + ++ +D + Q   + A+G
Sbjct: 112 RSEPRVFINPEFEALTDEMDQYQEGCLSVPGFYENVDRPQRVKIKALDRDGQPYELIAEG 171

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 172 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEK 207


>gi|262281295|ref|ZP_06059076.1| peptide deformylase 1 [Acinetobacter calcoaceticus RUH2202]
 gi|262257121|gb|EEY75858.1| peptide deformylase 1 [Acinetobacter calcoaceticus RUH2202]
          Length = 176

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +MLE MY+  GIGLAA Q+    +L+VIDL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMLETMYAAPGIGLAASQVDHHIQLIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  P+VFINPKI   ++D   Y+EGCLS+P     V+R + + +  ++   Q   I
Sbjct: 65  EA--KDEPLVFINPKITPLTEDKQQYEEGCLSVPQIYDKVERPSRVKIEAINLEGQAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKVVRQRE 168


>gi|114321775|ref|YP_743458.1| peptide deformylase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122310781|sp|Q0A5B9|DEF_ALHEH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|114228169|gb|ABI57968.1| peptide deformylase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 178

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/162 (46%), Positives = 111/162 (68%), Gaps = 2/162 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++++PDP LR V+ P+ +++ DI  L D+MLE MY   GIGLAA Q+GV  R+VV+DL +
Sbjct: 6   ILVYPDPRLREVAAPVAQVDDDIRRLADDMLETMYDAQGIGLAATQVGVNQRVVVMDLAE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R+ P+V INP+I+   +  +  QEGCLSIP +  DV+R+  I  R +D   +     
Sbjct: 66  EGARQ-PLVLINPEILD-REGAATGQEGCLSIPGFYEDVERAERIRFRALDREGRPWEQE 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           A+GL+A C+QHE+DHL+G LF+D+LS LKR  I +K+ KLV+
Sbjct: 124 AEGLMAVCVQHEIDHLDGKLFVDYLSELKRKRIRRKLEKLVR 165


>gi|120552986|ref|YP_957337.1| peptide deformylase [Marinobacter aquaeolei VT8]
 gi|120322835|gb|ABM17150.1| peptide deformylase [Marinobacter aquaeolei VT8]
          Length = 167

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 108/162 (66%), Gaps = 2/162 (1%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++ +PDP LR +++P+E++  DI  LID+M E MY   GIGLAA Q+ V  +++V+DL
Sbjct: 3   REILEYPDPRLRTIAKPVEEVTDDIRTLIDDMFETMYDARGIGLAATQVDVHKQIIVMDL 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            +   +  P VFINPK+     +    QEGCLS+P +  DVKR     +   D + +  +
Sbjct: 63  SED--KTEPRVFINPKVEVLDGELEAMQEGCLSVPGFYEDVKRIEHCRITAKDRDGKEFV 120

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + A+GLLA C+QHE+DHLNG LF+D+LS+LKR+ I KK+ KL
Sbjct: 121 LEAEGLLAVCIQHEMDHLNGKLFVDYLSQLKRNRIRKKLEKL 162


>gi|261213229|ref|ZP_05927511.1| peptide deformylase [Vibrio sp. RC341]
 gi|260837503|gb|EEX64206.1| peptide deformylase [Vibrio sp. RC341]
          Length = 190

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 27  VLTFPDDRLRTVAKPVEKVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 86

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 87  T--RDEPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVSRAAEVTVKALDRNGQEYRFE 143

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 144 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 183


>gi|262402048|ref|ZP_06078612.1| peptide deformylase [Vibrio sp. RC586]
 gi|262351694|gb|EEZ00826.1| peptide deformylase [Vibrio sp. RC586]
          Length = 169

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 110/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  +ID+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQQIIDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+  D N Q     
Sbjct: 66  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKAQDRNGQEYSFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKV 162


>gi|21244525|ref|NP_644107.1| peptide deformylase [Xanthomonas axonopodis pv. citri str. 306]
 gi|39931168|sp|Q8PG20|DEF2_XANAC RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|21110197|gb|AAM38643.1| polypeptide deformylase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 170

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (67%), Gaps = 8/164 (4%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M   MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAEVTSQAFQTLLDDMFHTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D+ D    KN P VF+NP+I++   +  +YQEGCLS+P   ADV R+  ITVRY+D   Q
Sbjct: 65  DISD---EKNLPQVFVNPEIVSKQGE-QLYQEGCLSVPGIYADVSRADAITVRYLDRQGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q ++ADGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 121 PQELHADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|330500987|ref|YP_004377856.1| peptide deformylase [Pseudomonas mendocina NK-01]
 gi|328915273|gb|AEB56104.1| peptide deformylase [Pseudomonas mendocina NK-01]
          Length = 168

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 105/156 (67%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P++ ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVDVVDDSIRQLVDDMFETMYDAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+  + +D+   YQEGCLS+P +  +V R   + ++ +D + Q   + A+G
Sbjct: 67  KSEPRVFINPEFESLTDEMDQYQEGCLSVPGFYENVDRPQKVKIKALDRDGQPYELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|77456245|ref|YP_345750.1| peptide deformylase [Pseudomonas fluorescens Pf0-1]
 gi|77380248|gb|ABA71761.1| peptide deformylase [Pseudomonas fluorescens Pf0-1]
          Length = 168

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+  ++ ++  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+  + +D+   YQEGCLS+P +  +V R   + ++ +D + +   + A+G
Sbjct: 67  RTEPRVFINPEFESLTDEMEQYQEGCLSVPGFYENVDRPQKVKIKALDRDGKPYELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEK 162


>gi|257485584|ref|ZP_05639625.1| peptide deformylase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289627009|ref|ZP_06459963.1| peptide deformylase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647926|ref|ZP_06479269.1| peptide deformylase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330867901|gb|EGH02610.1| peptide deformylase [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330890232|gb|EGH22893.1| peptide deformylase [Pseudomonas syringae pv. mori str. 301020]
 gi|330985723|gb|EGH83826.1| peptide deformylase [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011873|gb|EGH91929.1| peptide deformylase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 168

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAMVDEGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|169123281|gb|ACA47112.1| peptide deformylase [Pseudomonas putida]
          Length = 168

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (66%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+  ++ ++  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP++   +DD   YQEGCLS+P +  +V R   + V+ +D + +   + A+ 
Sbjct: 67  RTEPRVFINPELEPLTDDMGQYQEGCLSVPGFYENVDRPQRVKVKALDRDGKPYELIAED 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ KL
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKL 163


>gi|297581920|ref|ZP_06943840.1| peptide deformylase [Vibrio cholerae RC385]
 gi|297533787|gb|EFH72628.1| peptide deformylase [Vibrio cholerae RC385]
          Length = 190

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++DNMLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 27  VLTFPDDRLRTVAKPVEQVTPEIQQIVDNMLETMYAEEGIGLAATQVDIHQRIVVIDISE 86

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 87  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 143

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 144 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 183


>gi|114800420|ref|YP_759242.1| peptide deformylase [Hyphomonas neptunium ATCC 15444]
 gi|123028362|sp|Q0C4V1|DEF_HYPNA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|114740594|gb|ABI78719.1| peptide deformylase [Hyphomonas neptunium ATCC 15444]
          Length = 176

 Score =  157 bits (397), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEK-INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLV 59
           M  + ++  PDP L++VS+P+E  +  DI  L+D+MLE MY   GIGLAA+QIGV  R++
Sbjct: 1   MAIREILTVPDPRLKQVSKPVEGGVTDDIRALMDDMLETMYDAPGIGLAAIQIGVPLRVI 60

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           V+DL        P  F+NP+I+   ++   Y+EGCLS+PD    V+RSA   +RY+D + 
Sbjct: 61  VMDLAREGEEPAPRYFVNPEILETIEEKKPYEEGCLSVPDIFDQVERSARCRIRYLDYDG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           +    +A+ L A C+QHE+DHL G LFID+LSRLKRD    K+ K
Sbjct: 121 KQVDEWAEDLYAVCIQHEMDHLEGTLFIDYLSRLKRDRAIDKVKK 165


>gi|255319595|ref|ZP_05360807.1| peptide deformylase [Acinetobacter radioresistens SK82]
 gi|262380781|ref|ZP_06073934.1| peptide deformylase [Acinetobacter radioresistens SH164]
 gi|255303350|gb|EET82555.1| peptide deformylase [Acinetobacter radioresistens SK82]
 gi|262297729|gb|EEY85645.1| peptide deformylase [Acinetobacter radioresistens SH164]
          Length = 176

 Score =  157 bits (396), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 74/165 (44%), Positives = 107/165 (64%), Gaps = 2/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +M E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTLAKPVEEVTDEIRQLAADMFETMYEAPGIGLAATQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPKI   ++D   Y+EGCLS+P     V+R + + +  ++       I
Sbjct: 65  EE--KNQPMVFINPKITPLTEDTQPYEEGCLSVPQIYDKVERPSRVKIEALNLEGNAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ KLV+ R
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKLVRSR 167


>gi|330876380|gb|EGH10529.1| peptide deformylase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330965122|gb|EGH65382.1| peptide deformylase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 168

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTLAKPVAMVDEGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|146305096|ref|YP_001185561.1| peptide deformylase [Pseudomonas mendocina ymp]
 gi|166198520|sp|A4XNB3|DEF_PSEMY RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|145573297|gb|ABP82829.1| peptide deformylase [Pseudomonas mendocina ymp]
          Length = 168

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 105/156 (67%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P++ ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVDVVDDSIRQLVDDMFETMYDAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+  + +D+   YQEGCLS+P +  +V R   + ++ +D + Q   + A+G
Sbjct: 67  KSEPRVFINPEFESLTDEMDQYQEGCLSVPGFYENVDRPQKVKIKALDRDGQPFELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|66043290|ref|YP_233131.1| peptide deformylase [Pseudomonas syringae pv. syringae B728a]
 gi|63253997|gb|AAY35093.1| Formylmethionine deformylase [Pseudomonas syringae pv. syringae
           B728a]
 gi|330957385|gb|EGH57645.1| peptide deformylase [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330970343|gb|EGH70409.1| peptide deformylase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 168

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAMVDDGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|197121178|ref|YP_002133129.1| peptide deformylase [Anaeromyxobacter sp. K]
 gi|196171027|gb|ACG72000.1| peptide deformylase [Anaeromyxobacter sp. K]
          Length = 185

 Score =  157 bits (396), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + +VI+PDPIL+ V++P+++++  I  L+D+M E MY+ DG+GLAA QI V  R++VID 
Sbjct: 3   REIVIWPDPILKEVAQPVDRVDDGIRRLLDDMAETMYAADGVGLAAPQIAVKKRVIVIDT 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 +  +  +NP+I+    + + Y EGCLSIP    DV R A + VR +D   +   
Sbjct: 63  SPRQEGQTLIHLVNPEIVRGEGELT-YTEGCLSIPGEAEDVDRFARVWVRALDRQGKPFE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + A+GLLA  LQHE DHLNG +F+DHLS LKR++I K+M KL   R
Sbjct: 122 LEAEGLLAVALQHETDHLNGTVFVDHLSSLKRELIRKRMKKLKAQR 167


>gi|237801646|ref|ZP_04590107.1| peptide deformylase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331024505|gb|EGI04561.1| peptide deformylase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 168

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTLAKPVAMVDEGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYEMVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|169632177|ref|YP_001705913.1| peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA deformylase,
           binds Zn(II)) [Acinetobacter baumannii SDF]
 gi|238688145|sp|B0VNL8|DEF_ACIBS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|169150969|emb|CAO99588.1| peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA deformylase,
           binds Zn(II)) [Acinetobacter baumannii]
          Length = 176

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 110/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +M E MY+  GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPGIGLAASQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPK+   +++   Y+EGCLS+P     V R + + +  ++   Q   I
Sbjct: 65  ES--KDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKVDRPSRVKIEAINLEGQAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR  + +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRVREKVEKIVRQRE 168


>gi|289664808|ref|ZP_06486389.1| peptide deformylase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667878|ref|ZP_06488953.1| peptide deformylase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 170

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/164 (48%), Positives = 111/164 (67%), Gaps = 8/164 (4%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAELTSPAFQTLLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D+ D    KN P VF+NP+I++   +  +YQEGCLS+P   ADV R+  ITVRY+D   Q
Sbjct: 65  DVSDE---KNLPQVFVNPEIVSKQGE-QLYQEGCLSVPGIYADVSRADAITVRYLDRQGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q ++ DGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 121 PQELHTDGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|296115067|ref|ZP_06833709.1| peptide deformylase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978404|gb|EFG85140.1| peptide deformylase [Gluconacetobacter hansenii ATCC 23769]
          Length = 180

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 5   PLVIFPDPILRRVSRPIE-KINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P+++ P  ILR+ +R +  +  + +   I  M   MY   GIGLAA Q+G+  R  ++D+
Sbjct: 14  PILVAPQAILRQKTRLVRPEDTAQLREAIPRMFAAMYKAPGIGLAAPQVGLGLRFALVDV 73

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            D    +NPMV INP II  ++  SV +EGCLS+P+  A+V R   + VRY D   +   
Sbjct: 74  ADKDEARNPMVLINPDIIAETETMSVREEGCLSLPNQYAEVARPESVRVRYQDLEGKRHE 133

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           I  DGLLATC+QHE+DHL GILF+DHLS LKR+MI ++++K  +LR
Sbjct: 134 IEVDGLLATCIQHEIDHLEGILFVDHLSALKRNMIMRRLAKEQRLR 179


>gi|327482957|gb|AEA77364.1| Peptide deformylase [Vibrio cholerae LMA3894-4]
          Length = 169

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           +  R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 66  N--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 162


>gi|50083493|ref|YP_045003.1| peptide deformylase [Acinetobacter sp. ADP1]
 gi|49529469|emb|CAG67181.1| peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA deformylase,
           binds Zn(II)) [Acinetobacter sp. ADP1]
          Length = 174

 Score =  156 bits (395), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 110/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPD  LR +++P+EK+  +I  L  +MLE MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDARLRTIAKPVEKVTDEIRQLAADMLETMYEAPGIGLAATQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPKI   +++   Y+EGCLS+P     V R++ + +  ++ N +   I
Sbjct: 65  EE--KDQPMVFINPKITPLTEETQPYEEGCLSVPQIYDKVNRTSRVKIEAINLNDEAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKVVRQRE 168


>gi|254293235|ref|YP_003059258.1| peptide deformylase [Hirschia baltica ATCC 49814]
 gi|254041766|gb|ACT58561.1| peptide deformylase [Hirschia baltica ATCC 49814]
          Length = 181

 Score =  156 bits (394), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 105/155 (67%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++  P+P+L+ VS+P++ +  +I  L+D+MLE MY   GIGLAA+QIG   R++V
Sbjct: 1   MTIRPILTVPNPLLKEVSKPVDAVTDEIRALMDDMLETMYDAPGIGLAAIQIGEPVRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ D     NP  F+NP+I+   +    Y EGCLS+P+    ++R   + ++Y++   +
Sbjct: 61  MDIADKDEEPNPQYFVNPEILEKVEATVPYDEGCLSVPEIYETIERPERVQIKYLNYKGE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKR 155
             I +A+GL ATC+QHE+DHL G LFID+LSRLKR
Sbjct: 121 EVIEWAEGLYATCIQHEMDHLEGKLFIDYLSRLKR 155


>gi|319785850|ref|YP_004145325.1| peptide deformylase [Pseudoxanthomonas suwonensis 11-1]
 gi|317464362|gb|ADV26094.1| peptide deformylase [Pseudoxanthomonas suwonensis 11-1]
          Length = 170

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 105/163 (64%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVS---RPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +    P +        L+D+M E MY   GIGLAA Q+    R +VI
Sbjct: 5   PILEFPDPRLRTKAAQVEPAQVTTPGFQRLVDDMFETMYEAPGIGLAATQVDQHLRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D  +   +  PMVFINP+I+  S    VYQEGCLS+P   ADV R+  I VR++D   + 
Sbjct: 65  DTSED--KSAPMVFINPEIVQ-SQGGRVYQEGCLSVPGIYADVTRADTIVVRFLDREGRQ 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + ADGLLATC+QHE+DHL G LF+D+LS LKR+M+ KK++K
Sbjct: 122 QELAADGLLATCIQHEMDHLEGKLFVDYLSPLKREMVRKKLAK 164


>gi|225677067|ref|ZP_03788072.1| polypeptide deformylase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590889|gb|EEH12111.1| polypeptide deformylase [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 179

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 105/169 (62%), Gaps = 8/169 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+VI PD  L   +  +  IN  I  L+++M E MY  +G+GLAAVQ+GVL R+ V+D+Q
Sbjct: 5   PIVIAPDERLITRASEVTDINDKIKELVNDMFETMYDAEGLGLAAVQVGVLKRIFVVDVQ 64

Query: 65  DHAHRKNPMVF--------INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                  P  +        INP+I   SD+    +EGCLSIP+   ++KR  ++TV+Y D
Sbjct: 65  LETIENEPAGYESIGKFCMINPEITELSDEQVTLKEGCLSIPEQSYEIKRPKYLTVKYRD 124

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            N + Q + A G LA C+QHELDHLNGIL+I HLS+LK DM  KK  K+
Sbjct: 125 LNNEEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKYDMAMKKAQKV 173


>gi|229530168|ref|ZP_04419557.1| peptide deformylase [Vibrio cholerae 12129(1)]
 gi|229332301|gb|EEN97788.1| peptide deformylase [Vibrio cholerae 12129(1)]
          Length = 194

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 31  VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 90

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           +  R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 91  N--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 147

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 148 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 187


>gi|15640078|ref|NP_229705.1| peptide deformylase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587283|ref|ZP_01677056.1| polypeptide deformylase [Vibrio cholerae 2740-80]
 gi|121727904|ref|ZP_01680963.1| polypeptide deformylase [Vibrio cholerae V52]
 gi|147673376|ref|YP_001218366.1| peptide deformylase [Vibrio cholerae O395]
 gi|153212941|ref|ZP_01948535.1| polypeptide deformylase [Vibrio cholerae 1587]
 gi|153802782|ref|ZP_01957368.1| polypeptide deformylase [Vibrio cholerae MZO-3]
 gi|153817595|ref|ZP_01970262.1| polypeptide deformylase [Vibrio cholerae NCTC 8457]
 gi|153821925|ref|ZP_01974592.1| polypeptide deformylase [Vibrio cholerae B33]
 gi|153826444|ref|ZP_01979111.1| polypeptide deformylase [Vibrio cholerae MZO-2]
 gi|153830125|ref|ZP_01982792.1| polypeptide deformylase [Vibrio cholerae 623-39]
 gi|227080283|ref|YP_002808834.1| polypeptide deformylase [Vibrio cholerae M66-2]
 gi|254291093|ref|ZP_04961890.1| polypeptide deformylase [Vibrio cholerae AM-19226]
 gi|255746772|ref|ZP_05420718.1| peptide deformylase [Vibrio cholera CIRS 101]
 gi|262155853|ref|ZP_06028975.1| peptide deformylase [Vibrio cholerae INDRE 91/1]
 gi|262166896|ref|ZP_06034617.1| peptide deformylase [Vibrio cholerae RC27]
 gi|17432954|sp|Q9KVU3|DEF1_VIBCH RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|9654439|gb|AAF93224.1| polypeptide deformylase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121548529|gb|EAX58585.1| polypeptide deformylase [Vibrio cholerae 2740-80]
 gi|121629848|gb|EAX62263.1| polypeptide deformylase [Vibrio cholerae V52]
 gi|124116167|gb|EAY34987.1| polypeptide deformylase [Vibrio cholerae 1587]
 gi|124121695|gb|EAY40438.1| polypeptide deformylase [Vibrio cholerae MZO-3]
 gi|126511863|gb|EAZ74457.1| polypeptide deformylase [Vibrio cholerae NCTC 8457]
 gi|126520545|gb|EAZ77768.1| polypeptide deformylase [Vibrio cholerae B33]
 gi|146315259|gb|ABQ19798.1| polypeptide deformylase [Vibrio cholerae O395]
 gi|148874389|gb|EDL72524.1| polypeptide deformylase [Vibrio cholerae 623-39]
 gi|149739830|gb|EDM54025.1| polypeptide deformylase [Vibrio cholerae MZO-2]
 gi|150422938|gb|EDN14888.1| polypeptide deformylase [Vibrio cholerae AM-19226]
 gi|227008171|gb|ACP04383.1| polypeptide deformylase [Vibrio cholerae M66-2]
 gi|227011951|gb|ACP08161.1| polypeptide deformylase [Vibrio cholerae O395]
 gi|255735529|gb|EET90928.1| peptide deformylase [Vibrio cholera CIRS 101]
 gi|262024667|gb|EEY43347.1| peptide deformylase [Vibrio cholerae RC27]
 gi|262030305|gb|EEY48947.1| peptide deformylase [Vibrio cholerae INDRE 91/1]
          Length = 169

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 66  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 162


>gi|332702665|ref|ZP_08422753.1| Peptide deformylase [Desulfovibrio africanus str. Walvis Bay]
 gi|332552814|gb|EGJ49858.1| Peptide deformylase [Desulfovibrio africanus str. Walvis Bay]
          Length = 182

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 111/168 (66%), Gaps = 1/168 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +++ ++ +PD +L R S  I +I  ++  L  +M E MY+ +GIGLAA Q+G   RLVVI
Sbjct: 1   MRRTILKYPDAVLARKSLEIGEITDELRQLAKDMAETMYTNEGIGLAAPQVGECCRLVVI 60

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+     R++  V +NPKI T ++   V +EGCLS+  YR+DV RS  +TV   D + + 
Sbjct: 61  DITGPDKREDLRVLVNPKI-TAAEGKVVSEEGCLSVSGYRSDVARSEKVTVEATDLDGKP 119

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             I ADGLLA CLQHELDHL+G+LFID +SRLKR +  KK+ KL + R
Sbjct: 120 LSIEADGLLAVCLQHELDHLDGVLFIDRISRLKRSLYDKKVKKLQRER 167


>gi|292493779|ref|YP_003529218.1| peptide deformylase [Nitrosococcus halophilus Nc4]
 gi|291582374|gb|ADE16831.1| peptide deformylase [Nitrosococcus halophilus Nc4]
          Length = 167

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LRR ++P+  ++  I  L D+MLE MY   GIGLAA+Q+ V  R+VVID+ +   
Sbjct: 9   YPDPRLRRKAQPVATVDESIKKLADDMLETMYQAPGIGLAAIQVNVPKRIVVIDISED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +P+V INP+I+      +   EGCLS+P+    V R+A ITVRY+D   Q Q + A  
Sbjct: 67  KSSPLVLINPEIVARRGK-AESDEGCLSVPEIFEPVTRAAEITVRYLDREGQEQELEAQE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLATC+QHELDHL G LFID+LS LKR  I KK+ K  +L
Sbjct: 126 LLATCIQHELDHLEGKLFIDYLSTLKRQRIRKKVEKRQRL 165


>gi|220915878|ref|YP_002491182.1| peptide deformylase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953732|gb|ACL64116.1| peptide deformylase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 185

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + +VI+PDPIL+ V+ P+++++  I  L+D+M E MY+ DG+GLAA QI V  R++VID 
Sbjct: 3   REIVIWPDPILKEVAHPVDRVDDGIRRLLDDMAETMYAADGVGLAAPQIAVKKRVIVIDT 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                 +  +  +NP+I+    + + Y EGCLSIP    DV R A + VR +D + +   
Sbjct: 63  SPRQEGQTLIHLVNPEIVRGEGELT-YTEGCLSIPGEAEDVDRFARVWVRALDYHGKPFE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           + A+GLLA  LQHE DHLNG +F+DHLS LKR++I K+M KL   R
Sbjct: 122 LEAEGLLAVALQHETDHLNGTVFVDHLSSLKRELIRKRMKKLKAQR 167


>gi|255261213|ref|ZP_05340555.1| peptide deformylase [Thalassiobium sp. R2A62]
 gi|255103548|gb|EET46222.1| peptide deformylase [Thalassiobium sp. R2A62]
          Length = 173

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID- 62
           +P++I PDP L++ +  + + +  +  L D+ML+ MY   GIGLAA QIGV+ R+ V+D 
Sbjct: 4   RPILIHPDPRLKKRADEVTEFDDALCVLGDDMLDTMYDAPGIGLAAPQIGVMSRVFVMDC 63

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           +++      PMV +NP+I   SD+ + Y EGCLSIP+  A+V R A + V + D      
Sbjct: 64  VKEEGEEPKPMVLVNPEITWTSDEMNTYDEGCLSIPEQYAEVDRPAEVKVTWQDVEGTQY 123

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
               DGL ATC+QHE+DHL+G LFID+L  LKR MIT+KM KL
Sbjct: 124 EAQFDGLWATCVQHEIDHLDGKLFIDYLKPLKRQMITRKMQKL 166


>gi|28867417|ref|NP_790036.1| polypeptide deformylase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213968425|ref|ZP_03396568.1| polypeptide deformylase [Pseudomonas syringae pv. tomato T1]
 gi|301384287|ref|ZP_07232705.1| peptide deformylase [Pseudomonas syringae pv. tomato Max13]
 gi|302060151|ref|ZP_07251692.1| peptide deformylase [Pseudomonas syringae pv. tomato K40]
 gi|302130424|ref|ZP_07256414.1| peptide deformylase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|32363153|sp|Q88B43|DEF1_PSESM RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|28850651|gb|AAO53731.1| polypeptide deformylase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213926713|gb|EEB60265.1| polypeptide deformylase [Pseudomonas syringae pv. tomato T1]
 gi|331017687|gb|EGH97743.1| peptide deformylase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 168

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTLAKPVAMVDDGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSAPMVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|90019670|ref|YP_525497.1| peptide deformylase [Saccharophagus degradans 2-40]
 gi|123090994|sp|Q21PV5|DEF_SACD2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|89949270|gb|ABD79285.1| peptide deformylase [Saccharophagus degradans 2-40]
          Length = 172

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+ K++  I  LID+M E MY   GIGLAA Q+ V  +++VIDL 
Sbjct: 5   PILEFPDPRLRTIAKPVAKVDQRIRTLIDDMFETMYDAPGIGLAATQVNVHEQVLVIDLG 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +    K PMVFINP I     +   Y+EGCLS+P +   V R   I V  +D + +  +I
Sbjct: 65  EET--KEPMVFINPSIEILDQEHYEYEEGCLSVPGFYEQVSRPKHIRVTALDRDGKEFVI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             +GLLA C+QHE+DHLNG LF+D++S +KR  I KK+ K
Sbjct: 123 EPEGLLAVCVQHEMDHLNGKLFVDYVSNIKRQRIRKKLEK 162


>gi|84622203|ref|YP_449575.1| peptide deformylase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|161899019|ref|YP_199224.2| peptide deformylase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366143|dbj|BAE67301.1| polypeptide deformylase [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 170

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 113/168 (67%), Gaps = 8/168 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYR 57
           MV  P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R
Sbjct: 1   MVLLPILEFPDPRLRTKALPVDSAELASQAFQALLDDMFQTMYEAPGIGLAASQVDVHKR 60

Query: 58  LVVIDLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
            +VID+ D    KN P VF+NP+I++   +  + QEGCLS+P   ADV R+  ITVRY+D
Sbjct: 61  FMVIDVSDE---KNLPQVFVNPEIVSKQGE-QLCQEGCLSVPGIYADVSRADAITVRYLD 116

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              Q Q ++ADGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 117 RQGQAQELHADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|169797633|ref|YP_001715426.1| peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA deformylase,
           binds Zn(II)) [Acinetobacter baumannii AYE]
 gi|184156510|ref|YP_001844849.1| peptide deformylase [Acinetobacter baumannii ACICU]
 gi|213155573|ref|YP_002317618.1| peptide deformylase [Acinetobacter baumannii AB0057]
 gi|215484987|ref|YP_002327228.1| peptide deformylase [Acinetobacter baumannii AB307-0294]
 gi|239503032|ref|ZP_04662342.1| peptide deformylase [Acinetobacter baumannii AB900]
 gi|260557576|ref|ZP_05829790.1| peptide deformylase [Acinetobacter baumannii ATCC 19606]
 gi|301346868|ref|ZP_07227609.1| peptide deformylase [Acinetobacter baumannii AB056]
 gi|301512296|ref|ZP_07237533.1| peptide deformylase [Acinetobacter baumannii AB058]
 gi|301594510|ref|ZP_07239518.1| peptide deformylase [Acinetobacter baumannii AB059]
 gi|332852665|ref|ZP_08434319.1| peptide deformylase [Acinetobacter baumannii 6013150]
 gi|332869381|ref|ZP_08438759.1| peptide deformylase [Acinetobacter baumannii 6013113]
 gi|332875644|ref|ZP_08443456.1| peptide deformylase [Acinetobacter baumannii 6014059]
 gi|169150560|emb|CAM88469.1| peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA deformylase,
           binds Zn(II)) [Acinetobacter baumannii AYE]
 gi|183208104|gb|ACC55502.1| N-formylmethionyl-tRNA deformylase [Acinetobacter baumannii ACICU]
 gi|193076056|gb|ABO10651.2| Zinc(II) binding peptide deformylase 1 [Acinetobacter baumannii
           ATCC 17978]
 gi|213054733|gb|ACJ39635.1| peptide deformylase [Acinetobacter baumannii AB0057]
 gi|213986809|gb|ACJ57108.1| peptide deformylase [Acinetobacter baumannii AB307-0294]
 gi|260408749|gb|EEX02053.1| peptide deformylase [Acinetobacter baumannii ATCC 19606]
 gi|322506378|gb|ADX01832.1| Peptide deformylase 1 [Acinetobacter baumannii 1656-2]
 gi|323516246|gb|ADX90627.1| peptide deformylase [Acinetobacter baumannii TCDC-AB0715]
 gi|332729133|gb|EGJ60480.1| peptide deformylase [Acinetobacter baumannii 6013150]
 gi|332732799|gb|EGJ64015.1| peptide deformylase [Acinetobacter baumannii 6013113]
 gi|332736217|gb|EGJ67232.1| peptide deformylase [Acinetobacter baumannii 6014059]
          Length = 176

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 109/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +M E MY+  GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPGIGLAASQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPK+   +++   Y+EGCLS+P     V R + + +  ++   Q   I
Sbjct: 65  ES--KDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKVDRPSRVKIEAINLEGQAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKIVRQRE 168


>gi|58424802|gb|AAW73839.1| polypeptide deformylase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 183

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 113/168 (67%), Gaps = 8/168 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYR 57
           MV  P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R
Sbjct: 14  MVLLPILEFPDPRLRTKALPVDSAELASQAFQALLDDMFQTMYEAPGIGLAASQVDVHKR 73

Query: 58  LVVIDLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
            +VID+ D    KN P VF+NP+I++   +  + QEGCLS+P   ADV R+  ITVRY+D
Sbjct: 74  FMVIDVSDE---KNLPQVFVNPEIVSKQGE-QLCQEGCLSVPGIYADVSRADAITVRYLD 129

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              Q Q ++ADGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 130 RQGQAQELHADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 177


>gi|146280418|ref|YP_001170571.1| peptide deformylase [Pseudomonas stutzeri A1501]
 gi|158514117|sp|A4VFH8|DEF_PSEU5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|145568623|gb|ABP77729.1| polypeptide deformylase [Pseudomonas stutzeri A1501]
 gi|327478634|gb|AEA81944.1| peptide deformylase [Pseudomonas stutzeri DSM 4166]
          Length = 168

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P++ ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVDVVDDGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+    +D    YQEGCLS+P +  +V R   + ++ +D + +   + A+G
Sbjct: 67  RSEPRVFINPEFEPLTDQMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGKPYELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K+
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSSLKRDRIKKKLEKI 163


>gi|254851611|ref|ZP_05240961.1| peptide deformylase 2 [Vibrio cholerae MO10]
 gi|254847316|gb|EET25730.1| peptide deformylase 2 [Vibrio cholerae MO10]
          Length = 190

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 27  VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 86

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 87  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 143

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 144 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 183


>gi|229508331|ref|ZP_04397835.1| peptide deformylase [Vibrio cholerae BX 330286]
 gi|229508830|ref|ZP_04398321.1| peptide deformylase [Vibrio cholerae B33]
 gi|229515915|ref|ZP_04405372.1| peptide deformylase [Vibrio cholerae TMA 21]
 gi|229517101|ref|ZP_04406547.1| peptide deformylase [Vibrio cholerae RC9]
 gi|229520217|ref|ZP_04409644.1| peptide deformylase [Vibrio cholerae TM 11079-80]
 gi|229606606|ref|YP_002877254.1| peptide deformylase [Vibrio cholerae MJ-1236]
 gi|229342811|gb|EEO07802.1| peptide deformylase [Vibrio cholerae TM 11079-80]
 gi|229346164|gb|EEO11136.1| peptide deformylase [Vibrio cholerae RC9]
 gi|229347015|gb|EEO11977.1| peptide deformylase [Vibrio cholerae TMA 21]
 gi|229354105|gb|EEO19037.1| peptide deformylase [Vibrio cholerae B33]
 gi|229354604|gb|EEO19526.1| peptide deformylase [Vibrio cholerae BX 330286]
 gi|229369261|gb|ACQ59684.1| peptide deformylase [Vibrio cholerae MJ-1236]
          Length = 194

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 31  VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 90

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 91  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 147

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 148 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 187


>gi|197286654|ref|YP_002152526.1| peptide deformylase [Proteus mirabilis HI4320]
 gi|227355155|ref|ZP_03839566.1| peptide deformylase [Proteus mirabilis ATCC 29906]
 gi|194684141|emb|CAR45570.1| peptide deformylase [Proteus mirabilis HI4320]
 gi|227164942|gb|EEI49789.1| peptide deformylase [Proteus mirabilis ATCC 29906]
          Length = 172

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 2/163 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           L+ FPD  LR+V+ P+EK++ +I  LID+M+E MY+  GIGLAA Q+ V  R+VVID+ +
Sbjct: 6   LLHFPDERLRKVATPVEKVDDEIRTLIDDMIETMYAERGIGLAAPQVNVSKRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           +  R  P+  INP+II+  D+     +GCLSIPD  A  +R  ++ V+ +D N     + 
Sbjct: 66  N--RDQPIALINPEIISTEDEIMDMMDGCLSIPDSFAPTQRFRYLKVKALDRNGDEIELE 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A  L A C+QHELDHLNG LFIDHLS LKR  I KK  KL +L
Sbjct: 124 AADLFAGCIQHELDHLNGKLFIDHLSPLKRQRIEKKQKKLSKL 166


>gi|330901114|gb|EGH32533.1| peptide deformylase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330937252|gb|EGH41267.1| peptide deformylase [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330976422|gb|EGH76478.1| peptide deformylase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 168

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAMVDEGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMV INP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPMVLINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|262191293|ref|ZP_06049487.1| peptide deformylase [Vibrio cholerae CT 5369-93]
 gi|262032831|gb|EEY51375.1| peptide deformylase [Vibrio cholerae CT 5369-93]
          Length = 190

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 27  VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRVVVIDISE 86

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 87  T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 143

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 144 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 183


>gi|298484627|ref|ZP_07002731.1| Peptide deformylase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298160851|gb|EFI01868.1| Peptide deformylase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 168

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  I  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAMVDEGIRQLVDDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+I   +D+   YQEGCLS+P +  +V R   + V+ +D + +   + A+G
Sbjct: 67  RSEPRVFINPEIEKLTDEMDQYQEGCLSVPGFYENVDRPQKVRVKALDRDGKPYELVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAICIQHECDHLNGKLFVDYLSNLKRDRIKKKLEK 162


>gi|89092291|ref|ZP_01165245.1| peptide deformylase [Oceanospirillum sp. MED92]
 gi|89083379|gb|EAR62597.1| peptide deformylase [Oceanospirillum sp. MED92]
          Length = 171

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 107/165 (64%), Gaps = 2/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PDP LR ++ P+ ++  +I   ID+M E MY+  GIGLAA Q+ +  R+V 
Sbjct: 1   MAKLTILEYPDPRLRTIAEPVSEVTDEIRAQIDDMFETMYAAPGIGLAATQVNIHKRIVT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ D   +  P+V INP+     ++   YQEGCLS+P +  DVKR   I ++ +D N +
Sbjct: 61  MDISDD--QNEPLVLINPEFEVIDEELHKYQEGCLSVPGFYEDVKRPQKIKLKALDYNGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              + A+GLLA C+QHELDHLNG LF+D+LS LKR+ I  K+ K+
Sbjct: 119 AYELEAEGLLAVCIQHELDHLNGKLFVDYLSMLKRNRIKGKLEKI 163


>gi|254523595|ref|ZP_05135650.1| peptide deformylase [Stenotrophomonas sp. SKA14]
 gi|219721186|gb|EED39711.1| peptide deformylase [Stenotrophomonas sp. SKA14]
          Length = 170

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPIEK---INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +  IE           LIDNM   MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAALIEAAEVTTPAFQELIDNMFLTMYDAPGIGLAATQVDVHKRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  P VFINP+I+   D   VYQEGCLS+P   ADV R+  ITV+Y+D N Q 
Sbjct: 65  DVSEE--KNEPHVFINPEIVA-KDGGRVYQEGCLSVPGIFADVTRADTITVKYLDRNGQE 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + A  +LATC+QHE+DHL+G LFID+LS LKR+M+ KK++K
Sbjct: 122 QQLEAGEVLATCIQHEMDHLDGKLFIDYLSPLKREMVRKKLAK 164


>gi|262374668|ref|ZP_06067941.1| peptide deformylase [Acinetobacter junii SH205]
 gi|262310458|gb|EEY91549.1| peptide deformylase [Acinetobacter junii SH205]
          Length = 176

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 109/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  DI  L  +MLE MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDDIRQLAADMLETMYEAPGIGLAATQVDHHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPK+   + +   Y+EGCLS+P     V+R + + +  ++ + Q   +
Sbjct: 65  EE--KNQPMVFINPKVTPLTQETQPYEEGCLSVPQIYDKVERPSRVKIEAINLDGQAFEL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            AD LLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADELLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKVVRQRE 168


>gi|58584374|ref|YP_197947.1| N-formylmethionyl-tRNA deformylase [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
 gi|75508016|sp|Q5GTG9|DEF_WOLTR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|58418690|gb|AAW70705.1| N-formylmethionyl-tRNA deformylase [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 179

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 109/173 (63%), Gaps = 8/173 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  +V+ PD  L   +  +  IN  I  L+++M E MY+ +G+GLAAVQIGVL R+ V
Sbjct: 1   MPKLSIVVAPDERLTTRASEVTGINDKIKELVNDMFETMYNAEGLGLAAVQIGVLKRIFV 60

Query: 61  IDLQDHAHRKNPMVF--------INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
           +D+Q    +  P+ +        INP+I   SD+  + +EGCLSIP+   +++R  ++TV
Sbjct: 61  MDIQLEDIKGEPVGYESTGKFCMINPEITELSDEQVILKEGCLSIPEQSHEIRRPKYLTV 120

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +Y D N + Q + A G LA C+QHELDHLNGIL+I HLS+LK DM  KK  K 
Sbjct: 121 KYKDLNNKEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKYDMAMKKAEKF 173


>gi|262376937|ref|ZP_06070164.1| peptide deformylase [Acinetobacter lwoffii SH145]
 gi|262308282|gb|EEY89418.1| peptide deformylase [Acinetobacter lwoffii SH145]
          Length = 176

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 109/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +M E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAQPVEEVTDEIRQLAADMFETMYEAPGIGLAATQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  +  PMVFINPKI   +++   Y+EGCLS+P     V R + + +  ++   Q   +
Sbjct: 65  EN--KDQPMVFINPKITPLTEETQPYEEGCLSVPQIYDKVDRPSRVKIEAINLEGQAFEL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHLNG LF+D+LS LKR    +K+ KLV+ R+
Sbjct: 123 DADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKLVRQRN 168


>gi|92114984|ref|YP_574912.1| peptide deformylase [Chromohalobacter salexigens DSM 3043]
 gi|123387341|sp|Q1QTJ5|DEF_CHRSD RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|91798074|gb|ABE60213.1| peptide deformylase [Chromohalobacter salexigens DSM 3043]
          Length = 170

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 106/164 (64%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ FPD  LR  + P+E ++ +   L+D+MLE MY   GIGLAA Q+ V  R++V
Sbjct: 1   MAKLTILEFPDERLRTKAAPVETVDDETRKLVDDMLETMYDAQGIGLAATQVDVHRRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ D   R  P V INP+     D+    QEGCLSIP+Y A+V R+  ++++ +D +  
Sbjct: 61  MDVSDD--RSQPRVLINPEYTPLGDEREPMQEGCLSIPEYYAEVPRALRVSLKALDRDGN 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              + ADGLLA C+QHE DHL G+LF+D+LS LKRD + KKM K
Sbjct: 119 PYELEADGLLAHCIQHEYDHLEGVLFVDYLSPLKRDRVLKKMQK 162


>gi|126726109|ref|ZP_01741951.1| peptide deformylase [Rhodobacterales bacterium HTCC2150]
 gi|126705313|gb|EBA04404.1| peptide deformylase [Rhodobacterales bacterium HTCC2150]
          Length = 159

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 107/154 (69%), Gaps = 3/154 (1%)

Query: 14  LRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-LQDHAHRKNP 72
           +++++ PI  ++ ++  L D+ML  MY   GIGLAA QIGVL RL+V+D +++      P
Sbjct: 1   MKKIATPIVDLSDELRVLADDMLATMYEAPGIGLAAPQIGVLERLIVLDCVKEEGADPRP 60

Query: 73  MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN-AQHQIIYADGLLA 131
           +   NP+I   SD+ SVY EGCLSIP+  A+V R A ++VR+M  + A+H   + DGL A
Sbjct: 61  VAMFNPEITASSDELSVYDEGCLSIPEIYAEVTRPAEVSVRWMGLDGAEHNETF-DGLWA 119

Query: 132 TCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           TC+QHE+DHLNG LFID+L  LKR MIT+KM KL
Sbjct: 120 TCVQHEIDHLNGKLFIDYLKPLKRQMITRKMQKL 153


>gi|146291135|ref|YP_001181559.1| peptide deformylase [Shewanella putrefaciens CN-32]
 gi|145562825|gb|ABP73760.1| peptide deformylase [Shewanella putrefaciens CN-32]
          Length = 170

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++PI + ++++   IDNM E MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRIQAKPITEFDAELQTQIDNMFETMYQEKGIGLAATQVDYHKQLIVMDLQDEVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+II+ S DF   +EGCLS+P   A V R+ F+TV+ +D N    I+ AD 
Sbjct: 69  R--PKVFINPEIISSSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRNGCEFIVEADE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           L A C+QHE+DHL G LF+D+LS LKR  I +K+ K  +L
Sbjct: 126 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAARL 165


>gi|166713738|ref|ZP_02244945.1| peptide deformylase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 170

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/164 (48%), Positives = 111/164 (67%), Gaps = 8/164 (4%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAELASQAFQALLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D+ D    KN P VF+NP+I++   +  + QEGCLS+P   ADV R+  ITVRY+D   Q
Sbjct: 65  DVSDE---KNLPQVFVNPEIVSKQGE-QLCQEGCLSVPGIYADVSRADAITVRYLDRQGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q ++ADGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 121 AQELHADGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|88705378|ref|ZP_01103089.1| Formylmethionine deformylase [Congregibacter litoralis KT71]
 gi|88700468|gb|EAQ97576.1| Formylmethionine deformylase [Congregibacter litoralis KT71]
          Length = 168

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 104/161 (64%), Gaps = 2/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR V++P+E ++ D+  LIDNM+E MY   GIGLAA Q+ V  RL+V+D+ ++  
Sbjct: 9   FPDPRLRTVAKPVESVDDDLRALIDNMIETMYEASGIGLAATQVNVHKRLLVLDISEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  PMVFINP++    D    Y EGCLS+P +  +V R   + V  +  + +      DG
Sbjct: 67  RDQPMVFINPEVTVLDDTLGSYDEGCLSVPGFYEEVNRPRKVRVEALGRDGESFSQELDG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHE+DHL+G LF+D++S LKR+ I  K+ K  +LR
Sbjct: 127 LAAICLQHEIDHLDGKLFVDYISPLKRNRIRSKLEKAHRLR 167


>gi|332304409|ref|YP_004432260.1| peptide deformylase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171738|gb|AEE20992.1| peptide deformylase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 169

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V+ P+EKI+  I  LI +MLE M   +GIGLAA QI V  R+VVID+ +   
Sbjct: 9   FPDERLRTVAAPVEKIDGTIKTLISDMLETMKDENGIGLAATQINVHKRVVVIDVSEK-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + NP VFINP+I T  D  ++ +EGCLS+P+  A V+R+  ITV  +D N     + ADG
Sbjct: 67  QDNPQVFINPEI-THMDGTTISEEGCLSVPNNYAKVERAETITVNALDENGDAFTLDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LF+D+LS LKR  I  K+ K  +L
Sbjct: 126 LLAICIQHELDHLKGKLFVDYLSPLKRQRIRTKLEKEARL 165


>gi|190576007|ref|YP_001973852.1| peptide deformylase [Stenotrophomonas maltophilia K279a]
 gi|229487565|sp|B2FIR4|DEF_STRMK RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|190013929|emb|CAQ47569.1| putative peptide deformylase [Stenotrophomonas maltophilia K279a]
          Length = 170

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPIEK---INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +  IE           LIDNM   MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAALIEAAEVTTPAFQELIDNMFLTMYDAPGIGLAATQVDVHKRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  P VFINP+I+   D   VYQEGCLS+P   ADV R+  ITV+Y+D N Q 
Sbjct: 65  DVSEE--KNEPHVFINPEIVA-KDGGRVYQEGCLSVPGIFADVTRADTITVKYLDRNGQE 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + A  +LATC+QHE+DHL+G LFID+LS LKR+M+ KK++K
Sbjct: 122 QQMEAGDVLATCIQHEMDHLDGKLFIDYLSPLKREMVRKKLAK 164


>gi|325924333|ref|ZP_08185877.1| peptide deformylase [Xanthomonas gardneri ATCC 19865]
 gi|325545198|gb|EGD16508.1| peptide deformylase [Xanthomonas gardneri ATCC 19865]
          Length = 170

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 80/164 (48%), Positives = 111/164 (67%), Gaps = 8/164 (4%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDAAEVTSPAFQRLLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D+ D    KN P VFINP+I++   +  +YQEGCLS+P   ADV R+  ITVRY+D + Q
Sbjct: 65  DVSDE---KNLPQVFINPQIVSKQGE-QLYQEGCLSVPGIYADVSRADAITVRYVDRHGQ 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q +  +GLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K
Sbjct: 121 AQELSTEGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAK 164


>gi|226952176|ref|ZP_03822640.1| zinc peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA
           deformylase) [Acinetobacter sp. ATCC 27244]
 gi|294648885|ref|ZP_06726341.1| peptide deformylase [Acinetobacter haemolyticus ATCC 19194]
 gi|226837014|gb|EEH69397.1| zinc peptide deformylase 1 (N-formylmethionylaminoacyl-tRNA
           deformylase) [Acinetobacter sp. ATCC 27244]
 gi|292825276|gb|EFF84023.1| peptide deformylase [Acinetobacter haemolyticus ATCC 19194]
          Length = 176

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 109/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +MLE MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMLETMYEAPGIGLAATQVDHHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPK+   +++   Y+EGCLS+P     V+R + + +  ++   Q   +
Sbjct: 65  EE--KNQPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKVERPSRVKIEAINLEGQAFEL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            AD LLA C+QHE+DHLNG LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADELLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKVVRQRE 168


>gi|260774554|ref|ZP_05883467.1| peptide deformylase [Vibrio metschnikovii CIP 69.14]
 gi|260610460|gb|EEX35666.1| peptide deformylase [Vibrio metschnikovii CIP 69.14]
          Length = 170

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+MLE MY  +GIGLAA Q+ +  R+VVID+ D
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQKIVDDMLETMYDEEGIGLAATQVDIHQRIVVIDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ ++ + +     
Sbjct: 66  S--RDQPMVLINPQIIEKRGEDGI-EEGCLSVPGSRALVPRAAEVTVKALNRDGEEYTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIKEKLEKI 162


>gi|42520067|ref|NP_965982.1| polypeptide deformylase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|81700107|sp|Q73IJ6|DEF_WOLPM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|42409804|gb|AAS13916.1| polypeptide deformylase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 179

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 106/169 (62%), Gaps = 8/169 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+VI PD  L   +  +  IN  I  L+++M E MY  +G+GLAAVQ+GVL R+ V+D+Q
Sbjct: 5   PIVIAPDERLITRASEVTDINDKIKELVNDMFETMYDAEGLGLAAVQVGVLKRIFVMDIQ 64

Query: 65  DHAHRKNPMVF--------INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                  P  +        INP+I   SD+  + +EGCLSIP+   ++KR  ++TV+Y D
Sbjct: 65  LETIENEPAGYGSTGKFYMINPEITELSDEQVILKEGCLSIPEQSHEIKRPKYLTVKYKD 124

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            + + Q + A G LA C+QHELDHLNGIL+I HLS+LK DM  KK  K+
Sbjct: 125 LDNEEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKYDMAMKKAQKV 173


>gi|298501230|ref|ZP_07011029.1| peptide deformylase [Vibrio cholerae MAK 757]
 gi|297540102|gb|EFH76164.1| peptide deformylase [Vibrio cholerae MAK 757]
          Length = 206

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 43  VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 102

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 103 T--RDQPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 159

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 160 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 199


>gi|104779338|ref|YP_605836.1| peptide deformylase [Pseudomonas entomophila L48]
 gi|95108325|emb|CAK13019.1| peptide deformylase 1 [Pseudomonas entomophila L48]
          Length = 168

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+ + +  +  LID+M E MY   GIGLAA Q+ V  ++VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVTEFDDALRQLIDDMFETMYEAPGIGLAATQVNVHKQVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +   + D   YQEGCLS+P +  +V R   + V+  D + +   + A+G
Sbjct: 67  RSEPRVFINPTVEELTHDMGQYQEGCLSVPGFYENVDRPLRVRVKAQDRDGKPYELEAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS+LKRD I KK+ K
Sbjct: 127 LLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEK 162


>gi|254453655|ref|ZP_05067092.1| peptide deformylase [Octadecabacter antarcticus 238]
 gi|198268061|gb|EDY92331.1| peptide deformylase [Octadecabacter antarcticus 238]
          Length = 159

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 103/150 (68%), Gaps = 1/150 (0%)

Query: 17  VSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-LQDHAHRKNPMVF 75
           ++ P+  ++  +  L D+MLE MY   GIGLAA Q+G++ R++V+D ++D      PMV 
Sbjct: 1   MADPVATVDKTLHALADDMLETMYDAPGIGLAAPQLGIMQRMLVMDCIKDDMETPQPMVL 60

Query: 76  INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQ 135
           INP++I  S + ++Y EGCLSIP+  A+V+RSA + V +MD N + Q      L ATC+Q
Sbjct: 61  INPRVIAASSETNIYDEGCLSIPEQYAEVERSAVVKVEWMDLNGKTQQDEFSDLWATCVQ 120

Query: 136 HELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           HE+DHLNG LFID+L  LKR MIT+KM KL
Sbjct: 121 HEIDHLNGKLFIDYLKPLKRQMITRKMQKL 150


>gi|120596857|ref|YP_961431.1| peptide deformylase [Shewanella sp. W3-18-1]
 gi|120556950|gb|ABM22877.1| peptide deformylase [Shewanella sp. W3-18-1]
          Length = 170

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/160 (48%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++PI + ++++   IDNM E MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRIQAKPITEFDAELQTQIDNMFETMYQEKGIGLAATQVDYHKQLIVMDLQDEIE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+II+ S DF   +EGCLS+P   A V R+ F+TV+ +D N    I+ AD 
Sbjct: 69  R--PKVFINPEIISSSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRNGCEFIVEADE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           L A C+QHE+DHL G LF+D+LS LKR  I +K+ K  +L
Sbjct: 126 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAARL 165


>gi|325913842|ref|ZP_08176201.1| peptide deformylase [Xanthomonas vesicatoria ATCC 35937]
 gi|325539917|gb|EGD11554.1| peptide deformylase [Xanthomonas vesicatoria ATCC 35937]
          Length = 170

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/164 (46%), Positives = 108/164 (65%), Gaps = 6/164 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  + P+   E  +     L+D+M + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAVPVDATEVTSPAFQTLLDDMFQTMYEAPGIGLAASQVDVHKRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  P VFINP+I+T   +  VYQEGCLS+P   ADV R+  I VRY+D   Q 
Sbjct: 65  DVSEE--KNAPQVFINPEIVTRQGE-QVYQEGCLSVPGIFADVSRADAIAVRYLDRQGQA 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
             +  +GLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK++K+
Sbjct: 122 HELSTEGLLAVCIQHEMDHLDGKLFVDYLSPLKREMVRKKLAKM 165


>gi|167855659|ref|ZP_02478417.1| peptide deformylase [Haemophilus parasuis 29755]
 gi|219871701|ref|YP_002476076.1| peptide deformylase [Haemophilus parasuis SH0165]
 gi|254767590|sp|B8F726|DEF_HAEPS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|167853231|gb|EDS24487.1| peptide deformylase [Haemophilus parasuis 29755]
 gi|219691905|gb|ACL33128.1| N-formylmethionyl-tRNA deformylase [Haemophilus parasuis SH0165]
          Length = 170

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L +V +P+E +++++   IDNM + MY  +GIGLAA Q+ VL R++ ID++ 
Sbjct: 6   VLIYPDENLAKVCQPVETVDAELNTFIDNMFDTMYEHEGIGLAAPQVNVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+  S +  + +EGCLSIP  RA V R   +TV+ ++   Q   + 
Sbjct: 65  -GDKTNQIVLINPEILESSGETGI-EEGCLSIPGCRALVPRKEKLTVKALNREGQTFTLE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHE+DHLNG+LF+DH+S+LKR  I +KM KL
Sbjct: 123 ADGLLAICIQHEIDHLNGVLFVDHISQLKRQRIKEKMLKL 162


>gi|260554281|ref|ZP_05826531.1| peptide deformylase 1 [Acinetobacter sp. RUH2624]
 gi|260404590|gb|EEW98110.1| peptide deformylase 1 [Acinetobacter sp. RUH2624]
          Length = 176

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 108/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR +++P+E++  +I  L  +M E MY+  GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPGIGLAASQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  PMVFINPKI   +++   Y+EGCLS+P     V R + + +  ++   Q   I
Sbjct: 65  ES--KDEPMVFINPKITPLTEETQPYEEGCLSVPQIYDKVDRPSRVKIEAINLEGQAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            ADGLLA C+QHE+DHL G LF+D+LS LKR    +K+ K+V+ R+
Sbjct: 123 EADGLLAVCIQHEMDHLKGKLFVDYLSPLKRQRAREKVEKIVRQRE 168


>gi|192358847|ref|YP_001984035.1| peptide deformylase [Cellvibrio japonicus Ueda107]
 gi|238692437|sp|B3PGY7|DEF_CELJU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|190685012|gb|ACE82690.1| peptide deformylase [Cellvibrio japonicus Ueda107]
          Length = 169

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 102/160 (63%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR V++P+ +++  I  L+D+M E MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILEFPDPRLRTVAKPVTQVDDSIRQLVDDMFETMYDAPGIGLAATQVNVHKRVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  P+VFINP+I    ++ S Y EGCLS+P +   V+R   I V+ +D       +
Sbjct: 65  ED--KSQPLVFINPEIEVLDEELSQYDEGCLSVPGFYETVERPGHIRVKALDRAGNAFEL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              GLLA C+QHELDHLNG LF+DH+S  KR  I  K+ K
Sbjct: 123 QPQGLLAVCIQHELDHLNGKLFVDHISPFKRSRIRSKLEK 162


>gi|89074760|ref|ZP_01161218.1| peptide deformylase [Photobacterium sp. SKA34]
 gi|89049524|gb|EAR55085.1| peptide deformylase [Photobacterium sp. SKA34]
          Length = 169

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E I  +I  +ID+MLE MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDERLRTVAKPVEAITPEIQTIIDDMLETMYDEEGIGLAATQVDIHQRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV +NPKI     +  + +EGCLS+P  R  V R+A ++V  +D N +     
Sbjct: 66  E--RNQPMVLVNPKITEEHGEDGI-EEGCLSVPTARGFVPRAAGVSVTALDRNGKEYSFK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHELDHL G LF+D+LS LKR  I +K+ K+
Sbjct: 123 ADGLLAICVQHELDHLAGKLFVDYLSPLKRQRIKQKLEKI 162


>gi|126172288|ref|YP_001048437.1| peptide deformylase [Shewanella baltica OS155]
 gi|152998582|ref|YP_001364263.1| peptide deformylase [Shewanella baltica OS185]
 gi|160873157|ref|YP_001552473.1| peptide deformylase [Shewanella baltica OS195]
 gi|217971247|ref|YP_002355998.1| peptide deformylase [Shewanella baltica OS223]
 gi|125995493|gb|ABN59568.1| peptide deformylase [Shewanella baltica OS155]
 gi|151363200|gb|ABS06200.1| peptide deformylase [Shewanella baltica OS185]
 gi|160858679|gb|ABX47213.1| peptide deformylase [Shewanella baltica OS195]
 gi|217496382|gb|ACK44575.1| peptide deformylase [Shewanella baltica OS223]
 gi|315265382|gb|ADT92235.1| peptide deformylase [Shewanella baltica OS678]
          Length = 170

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 107/168 (63%), Gaps = 3/168 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ FPD  LR  + PI + N+++   ID+M E MY   GIGLAA Q+    +L+V
Sbjct: 1   MAQLKVLQFPDERLRTQATPITEFNAELQTQIDDMFETMYQEKGIGLAATQVDYHKQLIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DLQD   R  P VFINP+II  S DF   +EGCLS+P   A V R+ F+TV+ +D +  
Sbjct: 61  MDLQDEVER--PKVFINPEIIASSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRHGN 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
             I+ AD L A C+QHE+DHL G LF+D+LS LKR  I +K+ K  +L
Sbjct: 118 EFIVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAARL 165


>gi|194367357|ref|YP_002029967.1| peptide deformylase [Stenotrophomonas maltophilia R551-3]
 gi|238693439|sp|B4SKH7|DEF_STRM5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|194350161|gb|ACF53284.1| peptide deformylase [Stenotrophomonas maltophilia R551-3]
          Length = 170

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 107/163 (65%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           P++ FPDP LR  +  I   E        L+DNM + MY   GIGLAA Q+ V  R +VI
Sbjct: 5   PILEFPDPRLRTKAALIDAAEVTTPAFQELVDNMFQTMYDAPGIGLAATQVDVHKRFMVI 64

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   +  P VFINP+I+   D   VYQEGCLS+P   ADV R+  ITV+Y+D + Q 
Sbjct: 65  DVSEE--KNEPHVFINPEIVA-KDGGRVYQEGCLSVPGIFADVTRADTITVKYLDRDGQQ 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Q + A  +LATC+QHE+DHL+G LFID+LS LKR+M+ KK++K
Sbjct: 122 QELEAGEVLATCIQHEMDHLDGKLFIDYLSPLKREMVRKKLAK 164


>gi|170719274|ref|YP_001746962.1| peptide deformylase [Pseudomonas putida W619]
 gi|169757277|gb|ACA70593.1| peptide deformylase [Pseudomonas putida W619]
          Length = 168

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+ + +  +  LID+M E MY   GIGLAA Q+ V  ++VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVTEFDDALRQLIDDMFETMYEAPGIGLAATQVNVHKQIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +   + D   YQEGCLS+P +  +V R   + V+  D + +   + A+G
Sbjct: 67  RSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENVDRPLRVRVKAQDRDGKPFELEAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS+LKRD I KK+ K
Sbjct: 127 LLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEK 162


>gi|119773185|ref|YP_925925.1| peptide deformylase [Shewanella amazonensis SB2B]
 gi|119765685|gb|ABL98255.1| peptide deformylase [Shewanella amazonensis SB2B]
          Length = 167

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P+ +    + + ID+M E MY  +GIGLAA Q+    RL+V+DLQD   
Sbjct: 9   FPDERLRTVAKPVTEFTPALQSQIDDMFETMYEENGIGLAATQVDFHQRLIVMDLQDEVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+I+  S DF   +EGCLS+P   A V R+  ITV+ +D N     + ADG
Sbjct: 69  R--PKVFINPEIVAKSGDF-CNEEGCLSVPGVYAKVDRAELITVKALDRNGNEFTVEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           L A CLQHE+DHL G LF+D+LS LKR  I +K+ K
Sbjct: 126 LFAICLQHEMDHLVGKLFVDYLSPLKRQRIRQKLEK 161


>gi|22219294|pdb|1LRY|A Chain A, Crystal Structure Of P. Aeruginosa Peptide Deformylase
           Complexed With Antibiotic Actinonin
          Length = 167

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 8   FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    ++D   YQEGCLS+P +  +V R   + ++ +D +       A+G
Sbjct: 66  KSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 126 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 161


>gi|15595217|ref|NP_248709.1| peptide deformylase [Pseudomonas aeruginosa PAO1]
 gi|107099012|ref|ZP_01362930.1| hypothetical protein PaerPA_01000019 [Pseudomonas aeruginosa PACS2]
 gi|218888765|ref|YP_002437629.1| peptide deformylase [Pseudomonas aeruginosa LESB58]
 gi|254237739|ref|ZP_04931062.1| polypeptide deformylase [Pseudomonas aeruginosa C3719]
 gi|254243131|ref|ZP_04936453.1| polypeptide deformylase [Pseudomonas aeruginosa 2192]
 gi|296386491|ref|ZP_06875990.1| peptide deformylase [Pseudomonas aeruginosa PAb1]
 gi|17432949|sp|Q9I7A8|DEF_PSEAE RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|9945838|gb|AAG03409.1|AE004441_10 polypeptide deformylase [Pseudomonas aeruginosa PAO1]
 gi|126169670|gb|EAZ55181.1| polypeptide deformylase [Pseudomonas aeruginosa C3719]
 gi|126196509|gb|EAZ60572.1| polypeptide deformylase [Pseudomonas aeruginosa 2192]
 gi|218768988|emb|CAW24746.1| polypeptide deformylase [Pseudomonas aeruginosa LESB58]
          Length = 168

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    ++D   YQEGCLS+P +  +V R   + ++ +D +       A+G
Sbjct: 67  KSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 162


>gi|258404153|ref|YP_003196895.1| peptide deformylase [Desulfohalobium retbaense DSM 5692]
 gi|257796380|gb|ACV67317.1| peptide deformylase [Desulfohalobium retbaense DSM 5692]
          Length = 167

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 106/160 (66%), Gaps = 1/160 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +  +PDP+L R + P+ +I+ ++  L  +M+E MY+  GIGLAA Q+G  +RL+ +D+  
Sbjct: 5   ICTYPDPVLARRAEPVAEISEEVRQLASDMVETMYANQGIGLAAPQVGKSWRLITVDISG 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             ++   +  +NP+I  + D  +  +EGCLS+P++R+ V+R+A + V   D +     + 
Sbjct: 65  PENQTELVTLVNPEI-QWRDGETETEEGCLSVPEFRSKVQRAAKVRVTGQDLDGNAVDME 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA CLQHE+DHL G + +DH+SRLKR M TKK+SK 
Sbjct: 124 ADGLLAVCLQHEIDHLEGTIILDHVSRLKRSMYTKKVSKW 163


>gi|229524948|ref|ZP_04414353.1| peptide deformylase [Vibrio cholerae bv. albensis VL426]
 gi|229338529|gb|EEO03546.1| peptide deformylase [Vibrio cholerae bv. albensis VL426]
          Length = 194

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+MLE MY+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 31  VLTFPDDRLRTVAKPVEQVTPEIQQIVDDMLETMYAEEGIGLAATQVDIHQRIVVIDISE 90

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 91  T--RDLPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 147

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 148 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 187


>gi|49081366|gb|AAT50122.1| PA0019 [synthetic construct]
          Length = 169

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    ++D   YQEGCLS+P +  +V R   + ++ +D +       A+G
Sbjct: 67  KSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 162


>gi|262371336|ref|ZP_06064654.1| peptide deformylase 1 [Acinetobacter johnsonii SH046]
 gi|262313673|gb|EEY94722.1| peptide deformylase 1 [Acinetobacter johnsonii SH046]
          Length = 177

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 106/165 (64%), Gaps = 2/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR ++ P+E++  +I  L  +M E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSFPDPRLRTIAEPVEEVTDEIRQLAADMFETMYEAPGIGLAATQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +H  +  P+VFINPK+   +++   Y+EGCLS+P     V+R + + +  ++   Q   I
Sbjct: 65  EH--KDQPLVFINPKVTPLTEETQPYEEGCLSVPQIYDKVERPSRVKIEAINLEGQAFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            AD LLA C+QHE+DHLNG LF+D+LS LKR    +K+ KL + R
Sbjct: 123 EADELLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKLTRQR 167


>gi|99034823|ref|ZP_01314739.1| hypothetical protein Wendoof_01000437 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 179

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 105/169 (62%), Gaps = 8/169 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+VI PD  L   +  +  IN  I  L+++M E MY  +G+GLAAVQ+GVL R+ V+D+Q
Sbjct: 5   PIVIAPDERLITRASEVTDINDKIKELVNDMFETMYDAEGLGLAAVQVGVLKRIFVMDIQ 64

Query: 65  DHAHRKNPMVF--------INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                  P  +        INP+I   SD+  + +EGCLSIP+    +KR  ++TV+Y D
Sbjct: 65  LETIENEPAGYGSTGKFYMINPEITELSDEQVILKEGCLSIPEQSHKIKRPKYLTVKYKD 124

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            + + Q + A G LA C+QHELDHLNGIL+I HLS+LK DM  KK  K+
Sbjct: 125 LDNEEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKYDMAMKKAQKV 173


>gi|254515964|ref|ZP_05128024.1| peptide deformylase [gamma proteobacterium NOR5-3]
 gi|219675686|gb|EED32052.1| peptide deformylase [gamma proteobacterium NOR5-3]
          Length = 168

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 105/161 (65%), Gaps = 2/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR V++P+E ++  +  LIDNMLE MY+  GIGLAA Q+ V  RL+V+D  ++  
Sbjct: 9   FPDPRLRTVAKPVEVVDDALRTLIDNMLETMYAASGIGLAATQVNVHQRLLVLDTSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R +PM+FINP++    D    Y EGCLS+P +  +V R   I V  +  + +   +  DG
Sbjct: 67  RDSPMIFINPQVTILDDTLGSYDEGCLSVPGFYEEVNRPRTIRVEALGRDGKAFSLELDG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHE+DHL+G LF+D++S LKR+ I  K+ K  +LR
Sbjct: 127 LTAICLQHEIDHLDGKLFVDYISPLKRNRIRSKLEKAHRLR 167


>gi|294138834|ref|YP_003554812.1| polypeptide deformylase [Shewanella violacea DSS12]
 gi|293325303|dbj|BAJ00034.1| polypeptide deformylase [Shewanella violacea DSS12]
          Length = 170

 Score =  153 bits (387), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 104/161 (64%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P+ + N+ +   IDNM E MY   GIGLAA Q+    +L+++DLQD   
Sbjct: 9   FPDERLRTFAKPVTEFNTGLQTQIDNMFETMYEEKGIGLAATQVDYHRQLIIMDLQDEEE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +I+  S  FS  +EGCLS+P   AD++R+  +T++ +D +     + ADG
Sbjct: 69  R--PKVFINLEIVASSGHFS-NEEGCLSVPGIYADIERAEHVTIKALDRDGNEFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA CLQHELDHL G LF+D+LS LKR  I +K+ K  +L 
Sbjct: 126 LLAICLQHELDHLKGKLFVDYLSPLKRQRIKQKLEKAARLE 166


>gi|319424441|gb|ADV52515.1| peptide deformylase [Shewanella putrefaciens 200]
          Length = 170

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++PI + ++++   IDNM E MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRIQAKPITEFDAELQTQIDNMFETMYQEKGIGLAATQVDYHKQLIVMDLQDEVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+II+ S DF   +EGCLS+P   A V R+ F+TV+ +D N    I+ A+ 
Sbjct: 69  R--PKVFINPEIISSSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRNGCEFIVEANE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           L A C+QHE+DHL G LF+D+LS LKR  I +K+ K  +L
Sbjct: 126 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAARL 165


>gi|83642943|ref|YP_431378.1| peptide deformylase [Hahella chejuensis KCTC 2396]
 gi|123767556|sp|Q2SQX1|DEF_HAHCH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|83630986|gb|ABC26953.1| peptide deformylase [Hahella chejuensis KCTC 2396]
          Length = 168

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 106/169 (62%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ FPDP LR V++P++  ++ +  LID+M E MY   GIGLAA Q+ V  R+VV
Sbjct: 1   MSKLQILEFPDPRLRTVAKPVQTFDAALGQLIDDMFETMYEAPGIGLAATQVDVHKRIVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   +  PMVFINP I     D    QEGCLS+P +   V R   + +R  D N +
Sbjct: 61  IDVSED--KSEPMVFINPDIEVLDGDPEEMQEGCLSVPGFYESVTRIPHVKIRAQDRNGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              + A GLLA CLQHE+DHLNG L++D+LS +KR  I KK+ K  ++R
Sbjct: 119 SYEMEARGLLAVCLQHEVDHLNGKLYVDYLSNVKRTRIRKKLEKQHKMR 167


>gi|34809567|pdb|1IX1|A Chain A, Crystal Structure Of P.Aeruginosa Peptide Deformylase
           Complexed With Antibiotic Actinonin
 gi|34809568|pdb|1IX1|B Chain B, Crystal Structure Of P.Aeruginosa Peptide Deformylase
           Complexed With Antibiotic Actinonin
          Length = 171

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    ++D   YQEGCLS+P +  +V R   + ++ +D +       A+G
Sbjct: 67  KSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 162


>gi|58697042|ref|ZP_00372504.1| peptide deformylase [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698050|ref|ZP_00372974.1| peptide deformylase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225629944|ref|YP_002726735.1| polypeptide deformylase [Wolbachia sp. wRi]
 gi|254767611|sp|C0R5A2|DEF_WOLWR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|58535407|gb|EAL59482.1| peptide deformylase [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536692|gb|EAL59978.1| peptide deformylase [Wolbachia endosymbiont of Drosophila simulans]
 gi|225591925|gb|ACN94944.1| polypeptide deformylase [Wolbachia sp. wRi]
          Length = 179

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 105/169 (62%), Gaps = 8/169 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+VI PD  L   +  +  IN  I  L+++M E MY  +G+GLAAVQ+GVL R+ V+D+Q
Sbjct: 5   PIVIAPDERLITRASEVTDINDKIKELVNDMFETMYDAEGLGLAAVQVGVLKRIFVVDVQ 64

Query: 65  DHAHRKNPMVF--------INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                  P  +        INP+I   SD+  + +EGCLSIP+   ++KR  ++TV+Y D
Sbjct: 65  LETIENEPAGYGSTGKFYMINPEITELSDEQVILKEGCLSIPEQSHEIKRPKYLTVKYKD 124

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            + + Q + A G LA C+QHELDHLNGIL+I HLS+LK DM   K  K+
Sbjct: 125 LDNEEQTLKASGWLARCIQHELDHLNGILYIRHLSKLKYDMAITKAQKI 173


>gi|157959861|ref|YP_001499895.1| peptide deformylase [Shewanella pealeana ATCC 700345]
 gi|157844861|gb|ABV85360.1| peptide deformylase [Shewanella pealeana ATCC 700345]
          Length = 199

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 104/161 (64%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++PI + N  +   ID+M E MY   GIGLAA Q+   ++L+V+DLQD   
Sbjct: 38  FPDERLRTVAQPITEFNPALQTQIDDMFETMYEEKGIGLAATQVDYHHQLIVMDLQDEVE 97

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +I   S DF   +EGCLS+P   A V R+ F+T++ +D + +   + ADG
Sbjct: 98  R--PKVFINLEITAKSGDF-CNEEGCLSVPGVYAKVDRAEFVTIKALDRDGKEFTLEADG 154

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHELDHL+G LF+D+LS LKR  I +K+ K  +L 
Sbjct: 155 LFAICLQHELDHLSGKLFVDYLSPLKRQRIKQKLEKAARLE 195


>gi|167621968|ref|YP_001672262.1| peptide deformylase [Shewanella halifaxensis HAW-EB4]
 gi|167351990|gb|ABZ74603.1| peptide deformylase [Shewanella halifaxensis HAW-EB4]
          Length = 199

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++PI + N+ +   ID+M E MY   GIGLA+ Q+   ++L+V+DLQD   
Sbjct: 38  FPDERLRTVAKPIAEFNAALQTQIDDMFETMYEEKGIGLASTQVNYHHQLIVMDLQDDVE 97

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +I+  S DF   +EGCLS+P   A V R+ F+T++ +D +     + ADG
Sbjct: 98  R--PKVFINLEIVAKSGDF-CNEEGCLSVPGVYAKVDRAEFVTIKALDRDGNEFSLEADG 154

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHELDHL+G LF+D+LS LKR  I +K+ K  +L 
Sbjct: 155 LFAICLQHELDHLSGKLFVDYLSPLKRQRIKQKLEKAARLE 195


>gi|152988653|ref|YP_001345416.1| peptide deformylase [Pseudomonas aeruginosa PA7]
 gi|150963811|gb|ABR85836.1| peptide deformylase [Pseudomonas aeruginosa PA7]
          Length = 168

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 103/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    +++   YQEGCLS+P +  +V R   + ++ +D + +     A+G
Sbjct: 67  KSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGKPFEEVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGRLFVDYLSTLKRDRIRKKLEK 162


>gi|109896355|ref|YP_659610.1| peptide deformylase [Pseudoalteromonas atlantica T6c]
 gi|109698636|gb|ABG38556.1| peptide deformylase [Pseudoalteromonas atlantica T6c]
          Length = 169

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V+ P++KI+S I  L+ +MLE M   +GIGLAA QI V  R+VVID+ +   
Sbjct: 9   FPDERLRTVATPVDKIDSSIKTLVSDMLETMKDENGIGLAATQINVHKRVVVIDVSEEQD 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+I T  D  ++ +EGCLS+P+  A V+R+  +TV+ +D N     + ADG
Sbjct: 69  K--PQVFINPEI-THMDGTTISEEGCLSVPNNYAKVERAEKVTVKALDENGDAFTLDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LF+D+LS LKR  I  K+ K  +L
Sbjct: 126 LLAICIQHELDHLKGKLFVDYLSPLKRQRIRTKLEKEARL 165


>gi|326319402|ref|YP_004237074.1| peptide deformylase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323376238|gb|ADX48507.1| peptide deformylase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 169

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 109/160 (68%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P++ ++  +  L+D+MLE MY   GIGLAA Q+ V  R++ ID+ 
Sbjct: 5   PILCYPDPRLHKVAQPVQAVDDRVRALLDDMLETMYDAQGIGLAATQVDVHERIITIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I+  S+D  V +EGCLS+P     V+RS+ + V+ +D   Q ++I
Sbjct: 65  ED--RDTPLVLINPEILWASEDKQVGEEGCLSVPGIYDGVERSSAVRVQALDAQGQSRVI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F+++LS LKR  I  KM K
Sbjct: 123 EAEGLLAICIQHEMDHLLGKVFVEYLSPLKRTRIKTKMLK 162


>gi|304313372|ref|YP_003812970.1| N-formylmethionyl-tRNA deformylase 1 [gamma proteobacterium HdN1]
 gi|301799105|emb|CBL47348.1| N-formylmethionyl-tRNA deformylase 1 [gamma proteobacterium HdN1]
          Length = 170

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 105/156 (67%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR  ++P+ + ++ +  L ++MLE MY   GIGLAA QI V  +++V+D+ +   
Sbjct: 9   FPDPRLRTQAKPVTQFDAALRKLTEDMLETMYDAPGIGLAATQINVHQQVIVMDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  PMVFINP+I     +   Y+EGCLS+P +  +V R   I V+ ++   +   + ADG
Sbjct: 67  KSQPMVFINPQITVVGGE-KEYEEGCLSVPGFHENVVRPDVIHVKALNAQGEAFELQADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LL+ CLQHE+DHLNG+LF+DH+SRLKRD I +K+ K
Sbjct: 126 LLSVCLQHEMDHLNGVLFVDHISRLKRDRIRRKLEK 161


>gi|116053739|ref|YP_788174.1| peptide deformylase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313111460|ref|ZP_07797261.1| polypeptide deformylase [Pseudomonas aeruginosa 39016]
 gi|115588960|gb|ABJ14975.1| polypeptide deformylase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310883763|gb|EFQ42357.1| polypeptide deformylase [Pseudomonas aeruginosa 39016]
          Length = 168

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    +++   YQEGCLS+P +  +V R   + ++ +D +       A+G
Sbjct: 67  KSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 162


>gi|330993401|ref|ZP_08317336.1| Peptide deformylase [Gluconacetobacter sp. SXCC-1]
 gi|329759431|gb|EGG75940.1| Peptide deformylase [Gluconacetobacter sp. SXCC-1]
          Length = 180

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 106/161 (65%), Gaps = 1/161 (0%)

Query: 5   PLVIFPDPILRRVSRPIEKINSD-IMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P+++ P  +LR+ +R +   + D +  +I  M   MY   GIGLAA Q+G+  R  ++D+
Sbjct: 14  PILVAPQAVLRQKTRLVRPEDMDGLRTIIPRMFAAMYQAPGIGLAAPQVGLGMRFAIVDV 73

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            D    +NP+V INP++I  +D  +  +EGCLS+P+  A+V R   + VRY D   + Q 
Sbjct: 74  SDKDGPRNPIVLINPEVIAETDSMAAREEGCLSLPNQYAEVVRPEAVRVRYQDMEGKVQE 133

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + AD LLATCLQHE+DHL GILF+DHLS LKR+MI ++++K
Sbjct: 134 LEADDLLATCLQHEIDHLEGILFVDHLSTLKRNMIMRRLAK 174


>gi|33357406|pdb|1N5N|A Chain A, Crystal Structure Of Peptide Deformylase From Pseudomonas
           Aeruginosa
 gi|33357407|pdb|1N5N|B Chain B, Crystal Structure Of Peptide Deformylase From Pseudomonas
           Aeruginosa
 gi|47168958|pdb|1S17|A Chain A, Identification Of Novel Potent Bicyclic Peptide
           Deformylase Inhibitors
 gi|47168959|pdb|1S17|B Chain B, Identification Of Novel Potent Bicyclic Peptide
           Deformylase Inhibitors
          Length = 180

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 21  FPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSED-- 78

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+    +++   YQEGCLS+P +  +V R   + ++ +D +       A+G
Sbjct: 79  KSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEG 138

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 139 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEK 174


>gi|229587596|ref|YP_002869715.1| peptide deformylase [Pseudomonas fluorescens SBW25]
 gi|229359462|emb|CAY46303.1| peptide deformylase [Pseudomonas fluorescens SBW25]
          Length = 168

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  +  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   FPDSRLRTIAKPVAVVDDKVRQLVDDMFETMYEAPGIGLAATQVNVHLRVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P V+INP+    +D+   YQEGCLS+P++  +V+R   + ++ +D + +   + A+G
Sbjct: 67  RSEPRVYINPEFEPLTDEMGEYQEGCLSVPEFYENVERPLRVKIKALDRDGKPFELIAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 127 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEK 162


>gi|90406714|ref|ZP_01214907.1| peptide deformylase [Psychromonas sp. CNPT3]
 gi|90312167|gb|EAS40259.1| peptide deformylase [Psychromonas sp. CNPT3]
          Length = 170

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 105/157 (66%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR V++ +     +++++  +M++ MY  +G+GLAA Q+ +  R+VVID+ D   
Sbjct: 9   FPDPRLRTVAKKVSNFTPELIDIAQDMIDTMYEENGVGLAATQVDIHQRIVVIDVSDE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R +P+V INP+II+ S +    QEGCLS+PD  AD+ R+ F+TV++ D     Q I AD 
Sbjct: 67  RDDPIVLINPEIISQSGE-ECSQEGCLSVPDINADITRAEFVTVKFQDVQGNAQQIEADS 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHELDHL G LFID+LS  K+  I  K+ KL
Sbjct: 126 LLAVCIQHELDHLIGKLFIDYLSPFKQKRIKTKLEKL 162


>gi|170724408|ref|YP_001758434.1| peptide deformylase [Shewanella woodyi ATCC 51908]
 gi|169809755|gb|ACA84339.1| peptide deformylase [Shewanella woodyi ATCC 51908]
          Length = 169

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 101/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ + N+D+   IDNM E MY   GIGLAA Q+   ++L+V+DLQD   
Sbjct: 9   FPDEKLRTIAKPVTEFNADLQTQIDNMFETMYEEKGIGLAATQVDYHHQLIVMDLQDEVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +I+  S  F   +EGCLS+P   A+V+R+  +T++ +D       + ADG
Sbjct: 69  R--PKVFINLEIVASSGHFE-NEEGCLSVPGIFANVERAEHVTIKALDREGNEFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           L   CLQHELDHL G LF+D+LS LKR  I +K+ K
Sbjct: 126 LFGICLQHELDHLKGKLFVDYLSPLKRQRIKQKLEK 161


>gi|54310617|ref|YP_131637.1| peptide deformylase [Photobacterium profundum SS9]
 gi|46915060|emb|CAG21835.1| Putative polypeptide deformylase [Photobacterium profundum SS9]
          Length = 169

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 108/160 (67%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++IFPD  LR +++P+E I  DI N++D+MLE MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLIFPDERLRTIAKPVEAITPDIQNIVDDMLETMYDEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I     +  + +EGCLS+P  RA V R+A ++V+ +D +       
Sbjct: 66  E--RDQPMVLINPEITDKRGEDGI-EEGCLSVPGSRALVSRAAEVSVKALDRDGNPFSFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRQRIKQKLEKM 162


>gi|330720123|gb|EGG98527.1| Peptide deformylase [gamma proteobacterium IMCC2047]
          Length = 168

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 104/165 (63%), Gaps = 2/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR  + PI  ++  I  L D+MLE MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILEFPDPRLRNKALPINDVDDSIRKLADDMLETMYYAPGIGLAATQVNVQKRIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +  P+VFINP++    D F    EGCLS+P +   V+R   I VR  D N +   I
Sbjct: 65  ED--KSQPLVFINPEVEVIGDGFEEMDEGCLSVPGFYETVQRPDHIKVRAQDRNGETFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             DG+LA C+QHE+DHL+G LF+D+LS LKR  I KK+ K+ + R
Sbjct: 123 EDDGMLAVCIQHEIDHLDGKLFVDYLSPLKRQRIRKKLEKIHRQR 167


>gi|27364480|ref|NP_760008.1| peptide deformylase [Vibrio vulnificus CMCP6]
 gi|31076651|sp|Q8DDE3|DEF1_VIBVU RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|27360599|gb|AAO09535.1| peptide deformylase [Vibrio vulnificus CMCP6]
          Length = 170

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D +     + 
Sbjct: 66  S--RNEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGHEFTLE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICIQHELDHLQGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|332525408|ref|ZP_08401568.1| peptide deformylase [Rubrivivax benzoatilyticus JA2]
 gi|332108677|gb|EGJ09901.1| peptide deformylase [Rubrivivax benzoatilyticus JA2]
          Length = 172

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 108/164 (65%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M + P++ +PDP L +V++P+  +++ +  L+ +MLE MY ++G+GLAA Q+ V  RL V
Sbjct: 1   MAQLPILRYPDPRLHKVAKPVAAVDARVKQLVADMLETMYESEGVGLAATQVDVHERLFV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D         PMVF+NP+I+  S++  +++EGCLS+P     V R+A +TVR +D    
Sbjct: 61  MDTS--PEHDQPMVFVNPQIVARSEELVIWEEGCLSVPQVWDKVTRNARVTVRALDREGA 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              I  DGL A C QHE+DHL+G +F+++LS LKR+ I  KM+K
Sbjct: 119 EFEIALDGLAAVCAQHEIDHLDGKVFVEYLSLLKRERIKVKMAK 162


>gi|190571318|ref|YP_001975676.1| polypeptide deformylase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018714|ref|ZP_03334522.1| polypeptide deformylase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|238058217|sp|B3CMB1|DEF_WOLPP RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|190357590|emb|CAQ55031.1| polypeptide deformylase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995665|gb|EEB56305.1| polypeptide deformylase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 179

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 106/173 (61%), Gaps = 8/173 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K P+VI PD  L   +  +  I   I  L+++M E MY  +G+GLAAVQ+GVL R+ +
Sbjct: 1   MSKLPIVIAPDERLTTRASEVIDITDKIKELVNDMFETMYYAEGLGLAAVQVGVLKRIFI 60

Query: 61  IDLQDHAHRKNPMVF--------INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
           +D+Q       P  +        INP+I   S +  + +EGCLSIP+   ++KR  ++TV
Sbjct: 61  MDVQPEKAEDGPAGYESTGKFCMINPEITELSGEQVILKEGCLSIPEQSHEIKRPKYLTV 120

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +Y + N + Q + A G LA C+QHELDHLNGIL++ HLS+LK DM  KK  K+
Sbjct: 121 KYKNLNNEEQTLKASGWLARCIQHELDHLNGILYVRHLSKLKYDMAMKKAQKV 173


>gi|312958120|ref|ZP_07772643.1| peptide deformylase [Pseudomonas fluorescens WH6]
 gi|311287551|gb|EFQ66109.1| peptide deformylase [Pseudomonas fluorescens WH6]
          Length = 212

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 104/156 (66%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+  ++  +  L+D+M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 53  FPDSRLRTIAKPVAVVDDKVRQLVDDMFETMYEAPGIGLAATQVNVHLRVVVMDLSED-- 110

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P V+INP+    +D+   YQEGCLS+P++  +V+R   + ++ +D + +   + A+G
Sbjct: 111 RSEPRVYINPEFEPLTDEMGEYQEGCLSVPEFYENVERPLRVKIKALDRDGKPFEMIAEG 170

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS LKRD I KK+ K
Sbjct: 171 LLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEK 206


>gi|121610998|ref|YP_998805.1| peptide deformylase [Verminephrobacter eiseniae EF01-2]
 gi|121555638|gb|ABM59787.1| peptide deformylase [Verminephrobacter eiseniae EF01-2]
          Length = 170

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 103/160 (64%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L R++RP+  ++  I  L D+ML  MY   GIGLAA Q+ V  RL+V+D+ 
Sbjct: 6   PILRYPDPRLHRIARPVLAVDERIRALADDMLATMYQAQGIGLAATQVDVHERLLVVDVS 65

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D      P+V INP+II  S +   + EGCLS+P    DV+R   + VR +D   Q Q+I
Sbjct: 66  DE--HDQPLVLINPEIIWTSAEKQTHNEGCLSVPGIYDDVERFDAVHVRALDTRGQPQVI 123

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA CLQHE+DHL G +F+ +LS LKR+ I  +M K
Sbjct: 124 EADGLLAMCLQHEMDHLQGKVFVQYLSPLKRNRIKTRMIK 163


>gi|121999101|ref|YP_001003888.1| peptide deformylase [Halorhodospira halophila SL1]
 gi|121590506|gb|ABM63086.1| peptide deformylase [Halorhodospira halophila SL1]
          Length = 169

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 107/163 (65%), Gaps = 3/163 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++++PDP LR  + P+ +++  +  L+D+MLE MY   GIGLAA Q+G   R+ VID+ +
Sbjct: 6   ILVYPDPRLRERAEPVAEVDDAVRRLVDDMLETMYEARGIGLAATQVGDRRRVAVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  P+V INP+I+  + + S  +EGCLSIP Y  DV R+  +  R +D +AQ     
Sbjct: 66  E--RDEPLVLINPEILEATGEAS-GEEGCLSIPGYYDDVARATRVRYRALDRDAQPIEGE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A+G LA CLQHE+DHL+G LFID+LS LKR  + K+M K  +L
Sbjct: 123 AEGTLAVCLQHEIDHLDGRLFIDYLSELKRKRVRKRMEKRERL 165


>gi|302381971|ref|YP_003817794.1| peptide deformylase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192599|gb|ADL00171.1| peptide deformylase [Brevundimonas subvibrioides ATCC 15264]
          Length = 194

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 107/176 (60%), Gaps = 18/176 (10%)

Query: 13  ILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH------ 66
           IL++VS+P+  ++  +  L+D+ML+ MY   GIGLAAVQIG L R+VV+DL D       
Sbjct: 17  ILKQVSKPVAVVDDAVRALMDDMLDTMYDAPGIGLAAVQIGELQRVVVMDLGDGPAPEAA 76

Query: 67  ------------AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRY 114
                           NP  F+NP++I  SD+   Y+EGCLSIP+Y   V+R A + V Y
Sbjct: 77  EAAAEDEEGSEETRVPNPRFFVNPEVIWASDETFCYEEGCLSIPEYFDQVERPARVRVAY 136

Query: 115 MDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           +D          +GL A C QHELDHLNG+LFIDHLSRL+RD    K+ K ++LR+
Sbjct: 137 LDRTGARIEGEIEGLYAVCFQHELDHLNGVLFIDHLSRLRRDRAMSKVKKTMRLRE 192


>gi|320154884|ref|YP_004187263.1| peptide deformylase [Vibrio vulnificus MO6-24/O]
 gi|319930196|gb|ADV85060.1| peptide deformylase [Vibrio vulnificus MO6-24/O]
          Length = 170

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D +     + 
Sbjct: 66  S--RNEPMVLINPEILEKHGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGHEFTLE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICIQHELDHLQGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|167031105|ref|YP_001666336.1| peptide deformylase [Pseudomonas putida GB-1]
 gi|166857593|gb|ABY96000.1| peptide deformylase [Pseudomonas putida GB-1]
          Length = 168

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+ + +  +  LID+M E MY   GIGLAA Q+ V  ++VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVTEFDDALRQLIDDMFETMYEAPGIGLAATQVNVHLQVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +   + D   YQEGCLS+P +  +V R   + V+  D + +   +  +G
Sbjct: 67  RSEPRVFINPTVEELTHDMGQYQEGCLSVPGFYENVDRPLRVRVKAQDRDGKPFELECEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS+LKRD I KK+ K
Sbjct: 127 LLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEK 162


>gi|120613319|ref|YP_972997.1| peptide deformylase [Acidovorax citrulli AAC00-1]
 gi|120591783|gb|ABM35223.1| peptide deformylase [Acidovorax citrulli AAC00-1]
          Length = 169

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 108/160 (67%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P++ ++  +  L+D+MLE MY   GIGLAA Q+ V  R++ ID+ 
Sbjct: 5   PILCYPDPRLHKVAQPVQVVDDRVRALLDDMLETMYDAQGIGLAATQVDVHERIITIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I+  S+D  V +EGCLS+P     V+RS  + V+ +D   Q ++I
Sbjct: 65  ED--RDTPLVLINPEILWASEDKQVGEEGCLSVPGIYDGVERSTAVRVQALDAQGQSRVI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F+++LS LKR  I  KM K
Sbjct: 123 EAEGLLAICIQHEMDHLLGKVFVEYLSPLKRTRIKTKMLK 162


>gi|332531650|ref|ZP_08407547.1| peptide deformylase [Hylemonella gracilis ATCC 19624]
 gi|332039013|gb|EGI75442.1| peptide deformylase [Hylemonella gracilis ATCC 19624]
          Length = 174

 Score =  151 bits (381), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 107/161 (66%), Gaps = 2/161 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L  V++P++ +++ I  LI +M E MY  +GIGLAA QI V  RLVVID+ 
Sbjct: 5   PILTYPDPRLHTVAQPVQAVDARIKQLIADMFETMYDMNGIGLAATQINVHERLVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P VFINP+I+  S +  + +EGCLS+P     V+R   + VR +D   Q +++
Sbjct: 65  EG--RDQPQVFINPEIVWASPETKINEEGCLSVPGIYDGVERHERVHVRALDGEGQSRVV 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
             +GLL+ C+QHE+DHL G +F+++LS LKR+ I  KM KL
Sbjct: 123 ECEGLLSICIQHEMDHLMGKVFVEYLSPLKRNRIKTKMQKL 163


>gi|322513216|ref|ZP_08066342.1| peptide deformylase [Actinobacillus ureae ATCC 25976]
 gi|322120992|gb|EFX92833.1| peptide deformylase [Actinobacillus ureae ATCC 25976]
          Length = 170

 Score =  151 bits (381), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PD  L +V  P+ +++ ++   ID+M + MY  +GIGLAA Q+GVL R++ ID++ 
Sbjct: 6   VVLYPDEGLAKVCEPVAQVDDELNQFIDDMFDTMYENEGIGLAAPQVGVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+    +  + +EGCLSIP YRA V R   + V+ ++   +  I  
Sbjct: 65  -GDKTNQVVLINPEILESCGETGI-EEGCLSIPGYRALVPRKEKVKVKALNRKGEEVIYD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGL A C+QHE+DHLNG+LF+DH+S LKR  I +KM KL
Sbjct: 123 ADGLFAICIQHEIDHLNGVLFVDHISALKRQRIKEKMQKL 162


>gi|303245828|ref|ZP_07332110.1| peptide deformylase [Desulfovibrio fructosovorans JJ]
 gi|302492611|gb|EFL52479.1| peptide deformylase [Desulfovibrio fructosovorans JJ]
          Length = 177

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 104/161 (64%), Gaps = 1/161 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +P PIL   S P+  +  +I  L D+M E MY+  G+GLAA Q+G   RLVVIDL     
Sbjct: 8   YPHPILAAKSEPVPGVTPEIRQLADDMAETMYANQGVGLAAPQVGRSIRLVVIDLSGPDK 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +  +NP +IT ++      EGCLS+ DYRA+VKR+A +TV   D +     + ADG
Sbjct: 68  REERINLVNP-VITKAEGEQEDDEGCLSVRDYRANVKRAATVTVCATDLDGNPFCLEADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA CLQHE+DHL+G+LFIDH+SRLKR M  K++ +  + +
Sbjct: 127 LLAVCLQHEIDHLDGVLFIDHISRLKRAMYDKRVKRWAKQK 167


>gi|26986813|ref|NP_742238.1| peptide deformylase [Pseudomonas putida KT2440]
 gi|148545341|ref|YP_001265443.1| peptide deformylase [Pseudomonas putida F1]
 gi|32363155|sp|Q88RR1|DEF1_PSEPK RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|24981409|gb|AAN65702.1|AE016196_13 polypeptide deformylase [Pseudomonas putida KT2440]
 gi|148509399|gb|ABQ76259.1| peptide deformylase [Pseudomonas putida F1]
 gi|313496440|gb|ADR57806.1| Def [Pseudomonas putida BIRD-1]
          Length = 168

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+ + +  +  LID+M E MY   GIGLAA Q+ V  ++VV+DL +   
Sbjct: 9   FPDPRLRTLAKPVTEFDDALRQLIDDMFETMYEAPGIGLAATQVNVHKQVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +   + D   YQEGCLS+P +  +V R   + V+  D + +   +  +G
Sbjct: 67  RSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENVDRPLRVRVKAQDRDGKPFELECEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS+LKRD I KK+ K
Sbjct: 127 LLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEK 162


>gi|126668176|ref|ZP_01739137.1| peptide deformylase [Marinobacter sp. ELB17]
 gi|126627325|gb|EAZ97961.1| peptide deformylase [Marinobacter sp. ELB17]
          Length = 167

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (63%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LR +++P+  +  +I  LID+M E MY   GIGLAA Q+ V  ++VV+DL +   
Sbjct: 8   YPDPRLRTLAKPVTTVTDEIRTLIDDMFETMYDAAGIGLAASQVNVHQQIVVMDLSED-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
              P VFINPKI     D    QEGCLS+P +  +V+R     ++ +D N +   I A G
Sbjct: 66  NSEPKVFINPKIGILDGDLEAMQEGCLSVPGFYEEVERIEHCLIKALDRNGEAFEIEARG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHLNG LF+D+LS LKR  I KK+ KL
Sbjct: 126 LLAVCIQHEMDHLNGKLFVDYLSSLKRTRIRKKLEKL 162


>gi|331007625|ref|ZP_08330767.1| Peptide deformylase [gamma proteobacterium IMCC1989]
 gi|330418565|gb|EGG93089.1| Peptide deformylase [gamma proteobacterium IMCC1989]
          Length = 166

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 103/164 (62%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M + P++ FPD  LR V++P+ ++      +ID+M E MY+  GIGLAA Q+ +  +++V
Sbjct: 1   MAQLPILEFPDARLRTVAKPVAEVTDATRRIIDDMFETMYAAPGIGLAATQVNIHQQIIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL +   +  P VFINP I    ++   Y EGCLS+P +   V+R   I V  +D N  
Sbjct: 61  MDLSED--KSEPQVFINPSITVQGEELDSYDEGCLSVPGFYESVERPKSIKVEAIDRNGS 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             II  +GLLA C+QHE+DHLNG LF+D+LS +KR  I KK+ K
Sbjct: 119 PFIIEPEGLLAVCIQHEIDHLNGKLFVDYLSNMKRQRIRKKLEK 162


>gi|254361452|ref|ZP_04977592.1| peptide deformylase [Mannheimia haemolytica PHL213]
 gi|261491954|ref|ZP_05988531.1| peptide deformylase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496243|ref|ZP_05992648.1| peptide deformylase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153092962|gb|EDN73988.1| peptide deformylase [Mannheimia haemolytica PHL213]
 gi|261308074|gb|EEY09372.1| peptide deformylase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261312421|gb|EEY13547.1| peptide deformylase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 170

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PD  L  V  P+E+++  +   ID+M E MY  +GIGLAA Q+GVL R++ ID++ 
Sbjct: 6   VVLYPDEKLATVCEPVEQVDEALNRFIDDMFETMYEHEGIGLAAPQVGVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+  S +  + +EGCLSIP +RA V R   + V+ ++   +  II 
Sbjct: 65  -GDKTNQVVLINPEILESSGETGI-EEGCLSIPGHRALVPRKEKVKVKALNRQGEEIIID 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD L A C+QHE+DHLNG+LF+DH+S LKR  I +KM KL
Sbjct: 123 ADDLFAICIQHEIDHLNGVLFVDHISNLKRQRIKEKMQKL 162


>gi|212632966|ref|YP_002309491.1| peptide deformylase [Shewanella piezotolerans WP3]
 gi|212554450|gb|ACJ26904.1| Polypeptide deformylase [Shewanella piezotolerans WP3]
          Length = 170

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 103/161 (63%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++PI + N+ +   ID+M E MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRTVAKPITEFNAALQTQIDDMFETMYEEKGIGLAATQVDFHQQLIVMDLQDEID 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +II  S DF   +EGCLS+P   A V R+ F+T++ +D +     + A+G
Sbjct: 69  R--PKVFINLEIIAKSGDF-CNEEGCLSVPGIYAKVDRAEFVTIKALDRDGNEFTLEAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHELDHL G LF+D+LS LKR  I +K+ K  +L 
Sbjct: 126 LFAICLQHELDHLAGKLFVDYLSPLKRQRIKQKLEKAARLE 166


>gi|304412735|ref|ZP_07394338.1| peptide deformylase [Shewanella baltica OS183]
 gi|307305800|ref|ZP_07585546.1| peptide deformylase [Shewanella baltica BA175]
 gi|304348945|gb|EFM13360.1| peptide deformylase [Shewanella baltica OS183]
 gi|306911293|gb|EFN41719.1| peptide deformylase [Shewanella baltica BA175]
          Length = 170

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 106/168 (63%), Gaps = 3/168 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ FPD  LR  + PI + N+++   ID+M E MY   GIGLAA Q+    +L+V
Sbjct: 1   MAQLKVLQFPDERLRTQATPITEFNAELQTQIDDMFETMYQEKGIGLAATQVDYHKQLIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DLQD   R    VFINP+II  S DF   +EGCLS+P   A V R+ F+TV+ +D +  
Sbjct: 61  MDLQDEVERHK--VFINPEIIASSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRHGN 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
             I+ AD L A C+QHE+DHL G LF+D+LS LKR  I +K+ K  +L
Sbjct: 118 EFIVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAARL 165


>gi|260775015|ref|ZP_05883915.1| peptide deformylase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609105|gb|EEX35264.1| peptide deformylase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 173

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDERLRTVAKPVEKVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDQPMVLINPEILDKRGEDGI-EEGCLSVPGARALVSRAAEVTVKALDRDGKEYTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|90581176|ref|ZP_01236975.1| peptide deformylase [Vibrio angustum S14]
 gi|90437697|gb|EAS62889.1| peptide deformylase [Vibrio angustum S14]
          Length = 169

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E I  +I  +ID+MLE MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDERLRTVAKPVEAITPEIQTIIDDMLETMYDEEGIGLAATQVDIHQRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV +NP+I     +  + +EGCLS+P  R  V R+A ++V  +D + +     
Sbjct: 66  E--RNQPMVLVNPEITEERGEDGI-EEGCLSVPTARGFVPRAAGVSVTALDRDGKEYSFK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHELDHL G LF+D+LS LKR  I +K+ K+
Sbjct: 123 ADGLLAICVQHELDHLAGKLFVDYLSPLKRQRIKQKLEKI 162


>gi|162147911|ref|YP_001602372.1| peptide deformylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542528|ref|YP_002274757.1| peptide deformylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786488|emb|CAP56070.1| Peptide deformylase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530205|gb|ACI50142.1| peptide deformylase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 179

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 106/161 (65%), Gaps = 2/161 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINS-DIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P+++ P  ILR+ +RP+   ++  + + +  M   MY   GIGLAA Q+G+  R  ++DL
Sbjct: 14  PILVAPQAILRQKARPVRPEDAAGVRDALPRMFAAMYQAPGIGLAAPQVGMGLRFAIVDL 73

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            +   R+ P++ INP +I  SD  +  +EGCLS+P+  A+V R   + VRY   +   + 
Sbjct: 74  GEEGERQ-PLILINPDVIAESDSLASREEGCLSLPNQYAEVIRPDRVRVRYRTLDGTEEE 132

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + ADGLLATC+QHE+DHL GILF+DHLS LKR+MI ++++K
Sbjct: 133 LEADGLLATCIQHEIDHLEGILFVDHLSTLKRNMIMRRLAK 173


>gi|145300986|ref|YP_001143827.1| peptide deformylase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|158514058|sp|A4ST57|DEF_AERS4 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|142853758|gb|ABO92079.1| polypeptide deformylase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 170

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 111/159 (69%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V+ P+E    ++ +++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRTVAAPVETFTPELQHIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R++P+V INP+I+  +    + +EGCLS+PD+RA V R+ ++ VR +D N Q   + AD 
Sbjct: 67  REDPLVLINPEILEQAGSTGI-EEGCLSVPDHRALVPRAEWVKVRALDRNGQPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMAR 164


>gi|260771088|ref|ZP_05880016.1| peptide deformylase [Vibrio furnissii CIP 102972]
 gi|260613977|gb|EEX39168.1| peptide deformylase [Vibrio furnissii CIP 102972]
 gi|315178587|gb|ADT85501.1| peptide deformylase [Vibrio furnissii NCTC 11218]
          Length = 170

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 110/165 (66%), Gaps = 3/165 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+M+E MY  +GIGLAA Q+ V  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEKVTPEIQKIVDDMIETMYDEEGIGLAATQVDVHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP I+    +  + +EGCLS+P  RA V R+A +TV+ ++ + +     
Sbjct: 66  T--RDEPMVLINPVILEKRGEDGI-EEGCLSVPGARALVARAAEVTVKALNRDGEEYTFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K+ K+ +  D
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIKEKLEKIKRFND 167


>gi|37681409|ref|NP_936018.1| peptide deformylase [Vibrio vulnificus YJ016]
 gi|39930925|sp|Q7MGK6|DEF2_VIBVY RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|37200161|dbj|BAC95989.1| N-formylmethionyl-tRNA deformylase [Vibrio vulnificus YJ016]
          Length = 202

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+EK+  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 38  VLTFPDDRLRTVAKPVEKVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHQRIVVIDISE 97

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D +     + 
Sbjct: 98  S--RNEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGHEFTLE 154

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 155 ADDLLAICIQHELDHLQGKLFVDYLSPLKRKRIQDKLAKI 194


>gi|24371632|ref|NP_715674.1| polypeptide deformylase [Shewanella oneidensis MR-1]
 gi|32363158|sp|Q8EKQ8|DEF1_SHEON RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|24345388|gb|AAN53119.1|AE015454_13 polypeptide deformylase [Shewanella oneidensis MR-1]
          Length = 168

 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (63%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  + PI + N+++   ID+M E MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRTQATPITEFNAELQTQIDDMFETMYQEKGIGLAATQVDYHKQLIVMDLQDEVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+II  S DF   +EGCLS+P   A V R+ F+TV+ +D +     + AD 
Sbjct: 69  R--PKVFINPEIIASSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRHGNEFTVEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           L A C+QHE+DHL G LF+D+LS LKR  I +K+ K  +
Sbjct: 126 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAAK 164


>gi|317050727|ref|YP_004111843.1| peptide deformylase [Desulfurispirillum indicum S5]
 gi|316945811|gb|ADU65287.1| peptide deformylase [Desulfurispirillum indicum S5]
          Length = 171

 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 107/164 (65%), Gaps = 2/164 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-L 63
           P++ +PDP+L+++S+P+ + +S +  L+ +M + MY+ +G+GLAA QIG+L R+ V+D  
Sbjct: 4   PILTYPDPLLKKISQPVTQFDSALQQLVSDMFDTMYNANGVGLAAPQIGILRRICVLDPA 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                   P+V INP+I++  +  + ++EGCLS+P Y  ++KR   I V++ D   Q Q 
Sbjct: 64  SGKEEEAQPLVLINPQILS-GEGLTTFEEGCLSVPGYYGEIKRYERIQVQFNDLQGQEQT 122

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              DG  A   QHE+DHLNG LFI+HL   +RD+I +K+ K ++
Sbjct: 123 AILDGFTAIIAQHEMDHLNGKLFIEHLGSSERDLIRRKIRKAMK 166


>gi|260914694|ref|ZP_05921160.1| peptide deformylase [Pasteurella dagmatis ATCC 43325]
 gi|260631293|gb|EEX49478.1| peptide deformylase [Pasteurella dagmatis ATCC 43325]
          Length = 170

 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 111/165 (67%), Gaps = 3/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++++PD  L+ V++P+E++N  I  ++D+M E MY  +GIGLAA Q+ +  R++ 
Sbjct: 1   MAKLNVLVYPDDRLKIVAKPVEEVNDKIREIVDDMFETMYHEEGIGLAATQVDIHQRIIT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID++    ++N  V INP+II    +  + +EGCLS+P +R  V R   +TV+ +D N +
Sbjct: 61  IDVE--GTKENQYVLINPEIIESCGETGI-EEGCLSLPGFRGFVPRKEKVTVKALDRNGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              + ADGLLA C+QHE+DHLNGI+F D+LS LKR  + +K+ KL
Sbjct: 118 EYTLNADGLLAICIQHEIDHLNGIVFADYLSPLKRQRMKEKLVKL 162


>gi|153834309|ref|ZP_01986976.1| peptide deformylase [Vibrio harveyi HY01]
 gi|148869317|gb|EDL68331.1| peptide deformylase [Vibrio harveyi HY01]
          Length = 172

 Score =  150 bits (378), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 110/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEEVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHKRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEYTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K++K+
Sbjct: 123 ADDLLAICVQHELDHLMGKLFVDYLSPLKRKRIQEKLAKI 162


>gi|262273080|ref|ZP_06050897.1| peptide deformylase [Grimontia hollisae CIP 101886]
 gi|262222836|gb|EEY74144.1| peptide deformylase [Grimontia hollisae CIP 101886]
          Length = 170

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I  ++D+MLE MY  DGIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVESVTPEIQKIVDDMLETMYQEDGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R++ +TV+ +D +       
Sbjct: 66  T--RDEPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRASEVTVKALDRDGNEYQFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LK+  I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKQQRIKQKLEKI 162


>gi|307543965|ref|YP_003896444.1| peptide deformylase [Halomonas elongata DSM 2581]
 gi|307215989|emb|CBV41259.1| peptide deformylase [Halomonas elongata DSM 2581]
          Length = 170

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 107/164 (65%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K P++ FPD  LR  +  +E ++ ++  L+D+MLE MY   GIGLAA Q+ V  R++V
Sbjct: 1   MAKLPILEFPDERLRTEAAAVETVDDEVRQLVDDMLETMYDARGIGLAATQVDVHRRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ D   +  P+V INP+     D+    QEGCLSIP+Y A+V R+  + ++ ++   +
Sbjct: 61  MDVSDD--QSAPLVLINPEYTPIGDEREPMQEGCLSIPEYYAEVPRALKVHLKALNRQGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              + A+GLLA C+QHE DHL G+LF+D+LS LKRD + KKM K
Sbjct: 119 PYELEAEGLLAHCIQHECDHLRGVLFVDYLSPLKRDRVMKKMQK 162


>gi|90413779|ref|ZP_01221767.1| peptide deformylase [Photobacterium profundum 3TCK]
 gi|90325248|gb|EAS41745.1| peptide deformylase [Photobacterium profundum 3TCK]
          Length = 169

 Score =  149 bits (377), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 3/165 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR +++P+E I  +I N++D+MLE MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDERLRTIAKPVEAITPEIQNIVDDMLETMYDEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I     +  + +EGCLS+P  RA V R+A ++V+ +D +       
Sbjct: 66  E--RDQPMVLINPEITDKRGEDGI-EEGCLSVPGSRALVPRAAEVSVKALDRDGNPFSFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K+ K+ +  D
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRQRIKQKLEKMKRFND 167


>gi|253991650|ref|YP_003043006.1| peptide deformylase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253783100|emb|CAQ86265.1| peptide deformylase [Photorhabdus asymbiotica]
          Length = 170

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 110/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR ++ P+EK+++ I +++D+M E MY+ DGIGLAA Q+ +  R++VID+ D   
Sbjct: 9   YPDERLRTIATPVEKVDAKIQSIVDDMFETMYAEDGIGLAATQVDIHQRIIVIDVSDT-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  +    + +EGCLSIP+ RA V R+  + +R +D N Q   + ADG
Sbjct: 67  RNERLVLINPELLEKNGKTGI-EEGCLSIPEQRALVSRAEKVKIRALDYNGQSFELQADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL + R
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKVEKLYKQR 166


>gi|296125655|ref|YP_003632907.1| peptide deformylase [Brachyspira murdochii DSM 12563]
 gi|296017471|gb|ADG70708.1| peptide deformylase [Brachyspira murdochii DSM 12563]
          Length = 189

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/162 (46%), Positives = 103/162 (63%), Gaps = 8/162 (4%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + LVI+ D  L++VS  IEKI+ +I+ LID+M E MY   G+GLAAVQIG+L RL+VI +
Sbjct: 3   RELVIYGDERLQQVSEKIEKIDDEILTLIDDMFETMYKERGVGLAAVQIGILKRLIVISV 62

Query: 64  QDHAHRKNP---MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D      P   +  INP+II   ++  + +EGCLS P+ R DV R   I V+Y+D    
Sbjct: 63  PDFDDETKPDFKLALINPEIIWHGEEKEILEEGCLSFPEIRDDVARYKEIKVKYLDKEGN 122

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLS-----RLKRDM 157
            QI+ A+G +A  LQHE+DH NGI FID L      RLKR++
Sbjct: 123 EQILEAEGYIAKVLQHEIDHTNGISFIDRLESYQKRRLKREL 164


>gi|148651859|ref|YP_001278952.1| peptide deformylase [Psychrobacter sp. PRwf-1]
 gi|172048436|sp|A5WBG1|DEF_PSYWF RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|148570943|gb|ABQ93002.1| peptide deformylase [Psychrobacter sp. PRwf-1]
          Length = 176

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 108/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR ++ PI+ ++++I  LI +M+E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSYPDPRLRTIAEPIKTVDAEIKQLIKDMIETMYDAKGIGLAATQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++    +P VFINPK+    +D   Y+EGCLS+PD    V R   + +  +D +      
Sbjct: 65  EN--NDSPRVFINPKVTPLVEDKKPYEEGCLSVPDVYDSVDRPVKVKIEALDADGNAFEE 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            A+GLLA C+QHE+DHLNG+LF+D+LSRLK+     K+ K ++ R+
Sbjct: 123 IAEGLLAVCIQHEMDHLNGVLFVDYLSRLKQTRARDKVKKYLKTRE 168


>gi|77166461|ref|YP_344986.1| peptide deformylase [Nitrosococcus oceani ATCC 19707]
 gi|254435308|ref|ZP_05048815.1| peptide deformylase [Nitrosococcus oceani AFC27]
 gi|123593232|sp|Q3J6U0|DEF_NITOC RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|76884775|gb|ABA59456.1| peptide deformylase [Nitrosococcus oceani ATCC 19707]
 gi|207088419|gb|EDZ65691.1| peptide deformylase [Nitrosococcus oceani AFC27]
          Length = 167

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 101/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LRR ++P+  ++  I  L D+MLE MY   GIGLAAVQ+ V  ++VVID+ +   
Sbjct: 9   YPDPRLRRKAQPVAAVDKSIKKLADDMLETMYQAPGIGLAAVQVNVPKQVVVIDISED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +P+V INP+I+      +  +EGCLS+P+    V R+A ITV Y+D   Q Q +    
Sbjct: 67  KSSPLVLINPEIVARQGK-AESEEGCLSVPEIFEPVTRAAEITVHYLDREGQKQELQTQE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLATC+QHELDHL G LFID+ S LKR  I KK  K
Sbjct: 126 LLATCIQHELDHLEGKLFIDYFSTLKRQRIRKKAEK 161


>gi|221069823|ref|ZP_03545928.1| peptide deformylase [Comamonas testosteroni KF-1]
 gi|220714846|gb|EED70214.1| peptide deformylase [Comamonas testosteroni KF-1]
          Length = 170

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 107/160 (66%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+ +++  I  L+ +MLE MY   GIGLAA QI V  R++VID+ 
Sbjct: 5   PILCYPDPRLHKVAKPVAQVDERIQTLVKDMLETMYDAQGIGLAATQIDVHERVIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PM  INP+I+  SD+  + +EGCLS+P     V+RS  + V+ +D N   + I
Sbjct: 65  EE--RNEPMALINPEILWASDETQLGEEGCLSVPGIYDGVERSIAVKVKALDENGNSREI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+G+LA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 DAEGMLAICIQHEMDHLLGKVFVEYLSPLKRNRIKTKLVK 162


>gi|33152876|ref|NP_874229.1| peptide deformylase [Haemophilus ducreyi 35000HP]
 gi|39930849|sp|Q7VKK9|DEF_HAEDU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|33149101|gb|AAP96618.1| peptide deformylase [Haemophilus ducreyi 35000HP]
          Length = 171

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PD  L +V  P+ +++ ++   ID+M + MY   GIGLAA Q+GVL R++ ID++ 
Sbjct: 6   VVLYPDDRLTKVCEPVTQVDDELNQFIDDMFDTMYQEGGIGLAASQVGVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+    +  + +EGCLSIP YRA V R   ITV+ ++   +  I +
Sbjct: 65  -GDKTNQVVLINPEILESCGETGI-EEGCLSIPGYRALVPRKEKITVKALNRQGEEVIYH 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD L A C+QHE+DHLNGI+F+DH+S LKR  I  KM KL
Sbjct: 123 ADDLFAICIQHEIDHLNGIVFVDHISNLKRQRIKDKMQKL 162


>gi|284006131|emb|CBA71372.1| polypeptide deformylase [Arsenophonus nasoniae]
          Length = 171

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++K++++I  ++++M E MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRKIAEPVKKVDAEIQRIVNDMFETMYEEEGIGLAATQVNIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP I+  S +  + +EGCLS+P+ RA V R+ ++ ++ +D N +   +  D 
Sbjct: 67  RNERLVLINPVILETSGETGI-EEGCLSVPEQRAFVPRAKWVKIKALDVNGKEFELETDD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHLNG LFID+LS LKR  I +K+ KL +L+
Sbjct: 126 LLAICIQHEIDHLNGKLFIDYLSALKRQRIRQKIEKLERLK 166


>gi|85711005|ref|ZP_01042066.1| N-formylmethionyl-tRNA deformylase [Idiomarina baltica OS145]
 gi|85695409|gb|EAQ33346.1| N-formylmethionyl-tRNA deformylase [Idiomarina baltica OS145]
          Length = 173

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 114/170 (67%), Gaps = 3/170 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PD  LR V++PIE+++  +   ID+M E MY + G+GLAA Q+ V  RL V
Sbjct: 1   MTKLTVLKYPDERLRTVAQPIEQVDDALRATIDDMFETMYESQGVGLAATQVDVHQRLFV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D  ++  +  P+VFINP+I T S+     +EGCLS P+  A V+R+  ITV+ +D N +
Sbjct: 61  ADCSEN--QNEPLVFINPEI-TRSEGHFTNEEGCLSFPNVFAKVERAESITVQALDKNGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
              + A+GLLA C+QHE+DHL+G LF+D+LS LKR+ I KK+ K  +L++
Sbjct: 118 RFSMDAEGLLAICVQHEIDHLDGKLFVDYLSPLKRERIRKKLEKEQRLQE 167


>gi|163751680|ref|ZP_02158899.1| polypeptide deformylase [Shewanella benthica KT99]
 gi|161328419|gb|EDP99575.1| polypeptide deformylase [Shewanella benthica KT99]
          Length = 170

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 105/161 (65%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ + N+ +   I+NM E MY   G+GLAA Q+    +L+++DLQD   
Sbjct: 9   FPDERLRTLAKPVTEFNTGLQTQINNMFETMYEDKGVGLAATQVDYHRQLIIMDLQDEEE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +I+  S  FS  +EGCLS+P + AD++R+  +T++ +D +     + ADG
Sbjct: 69  R--PKVFINLEIVASSGHFS-NEEGCLSVPGFYADIERAEHVTIKALDRDGIEFTLDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHELDHL G LF+D+LS LKR  I +K+ K  +L 
Sbjct: 126 LFAICLQHELDHLKGKLFVDYLSPLKRQRIKQKLEKAARLE 166


>gi|225619787|ref|YP_002721044.1| N-formylmethionyl-tRNA deformylase [Brachyspira hyodysenteriae WA1]
 gi|254767571|sp|C0QZQ2|DEF_BRAHW RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|225214606|gb|ACN83340.1| N-formylmethionyl-tRNA deformylase [Brachyspira hyodysenteriae WA1]
          Length = 187

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 105/165 (63%), Gaps = 3/165 (1%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + LVI+ D  L++VS  IEKI+ +I+ LID+M E MY   G+GLAAVQIGVL RLVVI +
Sbjct: 3   RELVIYGDERLQKVSEKIEKIDDEILTLIDDMFETMYKERGVGLAAVQIGVLKRLVVISV 62

Query: 64  QDHAHRKNP---MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D    + P   +  INP+II  +D+    +EGCLS P+ R DV R   I V+Y+D    
Sbjct: 63  PDFDDEEKPDFKLALINPEIIWHNDETESLEEGCLSFPEIRDDVARYTQIKVKYLDREGN 122

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            QI+ A+  +A  LQHE+DH NGI FID L   ++  + +++ +L
Sbjct: 123 EQILDAENYIAKVLQHEIDHTNGISFIDRLESYQKRRLKRELKEL 167


>gi|156972726|ref|YP_001443633.1| peptide deformylase [Vibrio harveyi ATCC BAA-1116]
 gi|166198526|sp|A7N121|DEF_VIBHB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|156524320|gb|ABU69406.1| hypothetical protein VIBHAR_00391 [Vibrio harveyi ATCC BAA-1116]
          Length = 172

 Score =  149 bits (375), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEEVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHKRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEYTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLMGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|89902619|ref|YP_525090.1| peptide deformylase [Rhodoferax ferrireducens T118]
 gi|89347356|gb|ABD71559.1| peptide deformylase [Rhodoferax ferrireducens T118]
          Length = 169

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 106/160 (66%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L  V++P+  ++  +  LI +MLE MY   GIGLAA QI V  RL+V+D+ 
Sbjct: 5   PILCYPDPKLHTVAKPVSTVDVRVQTLIVDMLETMYEAKGIGLAATQINVHERLIVVDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+++  S +  + +EGCLS+P     V+R   +TV  +D   Q ++I
Sbjct: 65  EE--RDAPLVLINPQLVWSSAETHLNEEGCLSVPGIYDGVERFDAVTVTALDGQGQSRLI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F+++LS LKR+ I KKM K
Sbjct: 123 EAEGLLAVCIQHEMDHLQGKVFVEYLSPLKRNRIKKKMLK 162


>gi|58040267|ref|YP_192231.1| N-formylmethionylaminoacyl-tRNA deformylase [Gluconobacter oxydans
           621H]
 gi|58002681|gb|AAW61575.1| N-formylmethionylaminoacyl-tRNA deformylase [Gluconobacter oxydans
           621H]
          Length = 184

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 108/166 (65%), Gaps = 1/166 (0%)

Query: 5   PLVIFPDPILRRVSRPIEKIN-SDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P++I P P+LR V+R +   + + I   +  M   MY   GIGLAA Q+G+  R  ++D+
Sbjct: 17  PILIAPQPVLREVTRDVRPEDIAFIREQLPGMFSAMYKAPGIGLAAPQVGLGMRFALVDV 76

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            +    + PM+ INP+II+ SD  +  +EGCLS+P+  A+V R   I VRY +   +   
Sbjct: 77  AEEDAPREPMLLINPEIISDSDQLAAREEGCLSLPNQYAEVVRPESIRVRYRNLAGETIE 136

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             A GLLATC+QHE+DHL+GILF+DHLS LKR+MI ++++K  +LR
Sbjct: 137 RDASGLLATCIQHEMDHLDGILFVDHLSTLKRNMIMRRLAKEQKLR 182


>gi|46143358|ref|ZP_00204456.1| COG0242: N-formylmethionyl-tRNA deformylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|190151040|ref|YP_001969565.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|303249953|ref|ZP_07336155.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|303253125|ref|ZP_07339274.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|307246635|ref|ZP_07528706.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307248763|ref|ZP_07530776.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|307253382|ref|ZP_07535253.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|307255620|ref|ZP_07537425.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307257796|ref|ZP_07539553.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|307260071|ref|ZP_07541783.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|307262201|ref|ZP_07543851.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|307264402|ref|ZP_07545988.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
 gi|238692356|sp|B3GYT7|DEF_ACTP7 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189916171|gb|ACE62423.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|302647807|gb|EFL78014.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|302651016|gb|EFL81170.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306852507|gb|EFM84741.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306854690|gb|EFM86880.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|306859061|gb|EFM91103.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306861469|gb|EFM93458.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306863702|gb|EFM95628.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|306865907|gb|EFM97783.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|306868075|gb|EFM99901.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|306870218|gb|EFN01976.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
          Length = 170

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PD  L +V  P+ +++ ++   ID+M + MY  +GIGLAA Q+GVL R++ ID++ 
Sbjct: 6   VVLYPDEGLAKVCEPVAQVDDELNQFIDDMFDTMYEHEGIGLAAPQVGVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+    +  + +EGCLSIP +RA V R   + V+ ++   +  I  
Sbjct: 65  -GDKTNQVVLINPEILESCGETGI-EEGCLSIPGHRALVPRKEKVKVKALNRKGEEVIYE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGL A C+QHE+DHLNG+LF+DH+S LKR  I +KM KL
Sbjct: 123 ADGLFAICIQHEIDHLNGVLFVDHISALKRQRIKEKMQKL 162


>gi|262089743|gb|ACY24837.1| Def peptide deformylase [uncultured organism]
          Length = 169

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 97/150 (64%), Gaps = 2/150 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+ ++N  +  LID+M E MY   G+GLAA QI V  R+VVID+ +   
Sbjct: 9   FPDPRLRTIAKPVTEVNDRVRKLIDDMFETMYDAPGVGLAASQINVHERIVVIDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  PMVFINP++     D   Y EGCLS+P +   V+R   I+V  +D + +   I  +G
Sbjct: 67  KSQPMVFINPEVTVLDSDLHEYDEGCLSVPGFYETVERPEHISVTALDRDGKSFTIKPEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMI 158
           LLA C+QHELDHLNG LF+D++S  KR  I
Sbjct: 127 LLAVCIQHELDHLNGKLFVDYISSFKRTRI 156


>gi|332139430|ref|YP_004425168.1| peptide deformylase [Alteromonas macleodii str. 'Deep ecotype']
 gi|238693290|sp|B4S291|DEF_ALTMD RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|327549452|gb|AEA96170.1| peptide deformylase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 169

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P+E++N +I  L+ +M E M   +GIGLAA Q+    ++VV+D+ +   
Sbjct: 9   FPDERLRTVAKPVEEVNDEIKQLVSDMFETMKDENGIGLAATQVNRHVQVVVMDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+I T  D  ++ +EGCLS+P   A V+R+  ITV+ +D N +   + A+G
Sbjct: 67  QNEPRVFINPEI-TRKDGSTISEEGCLSVPGNYAKVERAEAITVKALDQNGEAFELDAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LFID+LS LKR  I KK+ K  +L
Sbjct: 126 LLAICIQHELDHLKGKLFIDYLSPLKRQRIRKKLEKEARL 165


>gi|237749120|ref|ZP_04579600.1| peptide deformylase [Oxalobacter formigenes OXCC13]
 gi|229380482|gb|EEO30573.1| peptide deformylase [Oxalobacter formigenes OXCC13]
          Length = 208

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 113/165 (68%), Gaps = 4/165 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M + P++ +PDP L + SRP+      + +LI +M + MY   G+GLAA QI V  +L+V
Sbjct: 30  MARLPILRYPDPRLLKPSRPVTDFGDSLKSLIADMAQTMYEAPGVGLAAPQINVHKQLIV 89

Query: 61  IDLQDHAHRKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           ID+ +   +KN + VFINP+I+  S++ ++++EGCLS+P    +++R A +TVR +D N 
Sbjct: 90  IDVSE---QKNELRVFINPQIVKASEEKAIFEEGCLSLPGIYDEIERPAKVTVRALDANG 146

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           +   + A+GLLA C+QHE+DHL G +F+D+LS +KR+ I KK+ K
Sbjct: 147 KEFELEAEGLLAVCVQHEIDHLKGSIFVDYLSPMKRNRIKKKLLK 191


>gi|91226303|ref|ZP_01261143.1| peptide deformylase [Vibrio alginolyticus 12G01]
 gi|262392831|ref|YP_003284685.1| peptide deformylase [Vibrio sp. Ex25]
 gi|91189314|gb|EAS75593.1| peptide deformylase [Vibrio alginolyticus 12G01]
 gi|262336425|gb|ACY50220.1| peptide deformylase [Vibrio sp. Ex25]
          Length = 172

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 108/160 (67%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEAVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHKRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEFTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLQGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|307251005|ref|ZP_07532930.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
 gi|306856945|gb|EFM89076.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 4 str.
           M62]
          Length = 170

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PD  L +V  P+ +++ ++   ID+M + MY  +GIGLAA Q+GVL R++ ID++ 
Sbjct: 6   VVLYPDEGLAKVCEPVAQVDDELNQFIDDMFDTMYEHEGIGLAAPQVGVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+    +  + +EGCLSIP +RA V R   + V+ ++   +  I  
Sbjct: 65  -GDKTNQVVLINPEILGSCGETGI-EEGCLSIPGHRALVPRKEKVKVKALNRKGEEVIYE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGL A C+QHE+DHLNG+LF+DH+S LKR  I +KM KL
Sbjct: 123 ADGLFAICIQHEIDHLNGVLFVDHISALKRQRIKEKMQKL 162


>gi|300718672|ref|YP_003743475.1| peptide deformylase [Erwinia billingiae Eb661]
 gi|299064508|emb|CAX61628.1| Peptide deformylase [Erwinia billingiae Eb661]
          Length = 174

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 110/157 (70%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P++++N+DI  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRIVAKPVKEVNADIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D       + ADG
Sbjct: 67  REERLVLINPEMLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDREGNSYELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LFID+LS +KR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPMKRQRIRQKLEKL 162


>gi|319796457|ref|YP_004158097.1| peptide deformylase [Variovorax paradoxus EPS]
 gi|315598920|gb|ADU39986.1| peptide deformylase [Variovorax paradoxus EPS]
          Length = 172

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 109/164 (66%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+ ++ +PD  L  V++P++ +++ I  L+ +MLE MY  +GIGLAA QI V  RLVV
Sbjct: 1   MAKRIILSYPDKRLHTVAKPVQGVDARIKALVADMLETMYDAEGIGLAATQIDVHERLVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R  P+V INP+I   SD+  + +EGCLS+P     V RS  + V+ +D N +
Sbjct: 61  IDVSEE--RNKPIVLINPEITWASDEKVLNEEGCLSVPGIYDGVMRSTSVKVQALDENGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            + I ADGLLA C+QHELDHL G +F+++LS LKR+ I  K+ K
Sbjct: 119 MRTIEADGLLAVCIQHELDHLLGKVFVEYLSPLKRNRIKSKLLK 162


>gi|225698067|pdb|3FWX|A Chain A, The Crystal Structure Of The Peptide Deformylase From
           Vibrio Cholerae O1 Biovar El Tor Str. N16961
 gi|225698068|pdb|3FWX|B Chain B, The Crystal Structure Of The Peptide Deformylase From
           Vibrio Cholerae O1 Biovar El Tor Str. N16961
          Length = 169

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 108/160 (67%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+ LE  Y+ +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEQVTPEIQQIVDDXLETXYAEEGIGLAATQVDIHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  P V INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D N Q     
Sbjct: 66  T--RDQPXVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRNGQEYQFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKI 162


>gi|332976314|gb|EGK13171.1| peptide deformylase [Psychrobacter sp. 1501(2011)]
          Length = 176

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 109/166 (65%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR ++ P++ +++DI  LI +M+E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSYPDPRLRTIAEPVKTVDADIKQLIKDMIETMYDAKGIGLAATQVDRHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++    +P VFINPKI    +D   Y+EGCLS+PD    V+R   + +  +D + +    
Sbjct: 65  EN--NDSPRVFINPKITPLVEDKKPYEEGCLSVPDVYDSVERPVKVKIEALDGDGKPFEE 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            A+GLLA C+QHE+DHLNG+LF+D+LS LK+     K+ K ++ R+
Sbjct: 123 IAEGLLAVCIQHEMDHLNGVLFVDYLSSLKQTRARDKVRKYLKTRE 168


>gi|239993910|ref|ZP_04714434.1| peptide deformylase [Alteromonas macleodii ATCC 27126]
          Length = 169

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P+E++N +I  L+ +M E M   +GIGLAA Q+    ++VV+D+ +   
Sbjct: 9   FPDERLRTVAKPVEEVNDEIKQLVSDMFETMKDENGIGLAATQVNRHVQVVVMDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+II   D  ++ +EGCLS+P   A V+R+  ITV+ +D N +   + A+G
Sbjct: 67  QNEPRVFINPEIIR-KDGSTISEEGCLSVPGNYAKVERAESITVKALDQNGESFELDAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LFID+LS LKR  I KK+ K  +L
Sbjct: 126 LLAICIQHELDHLKGKLFIDYLSPLKRQRIRKKLEKEARL 165


>gi|325577099|ref|ZP_08147583.1| peptide deformylase [Haemophilus parainfluenzae ATCC 33392]
 gi|325160681|gb|EGC72802.1| peptide deformylase [Haemophilus parainfluenzae ATCC 33392]
          Length = 175

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 110/159 (69%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N DI  ++D+M + MY  +GIGLAA Q+ +L R++ ID++ 
Sbjct: 12  VLIYPDDHLKIVCEPVAEVNDDIRKIVDDMFDTMYQEEGIGLAAPQVDILQRIITIDIE- 70

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INP+I+    +  + +EGCLSIP +RA V R   +TV+ +D + +   + 
Sbjct: 71  -GDKQNQLVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVKALDRHGKEFTLD 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 129 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLVK 167


>gi|329849466|ref|ZP_08264312.1| peptide deformylase [Asticcacaulis biprosthecum C19]
 gi|328841377|gb|EGF90947.1| peptide deformylase [Asticcacaulis biprosthecum C19]
          Length = 177

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 115/175 (65%), Gaps = 8/175 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  P P+L++VS+P++K++ D+  L+D+MLE MY   GIGLAAVQIG   R++V
Sbjct: 1   MAIREILTVPHPVLKQVSKPVDKVDDDLRRLMDDMLETMYDAPGIGLAAVQIGEPIRVIV 60

Query: 61  IDLQDHAHR--------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
           +DLQ+            K P  F+NP+II  S++ + Y+EGCLS+P+   +V R + + +
Sbjct: 61  MDLQEKPEGAEPDAEGVKKPRYFVNPEIIWRSEEVAPYEEGCLSVPEIYDEVLRPSKVKL 120

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           +Y+D N       ADGL A C+QHE+DHL G LFIDHLS+LKRD    K+ KL +
Sbjct: 121 KYLDYNGNAVEEDADGLFAVCIQHEMDHLEGTLFIDHLSKLKRDRAITKVKKLTR 175


>gi|188492250|ref|ZP_02999520.1| peptide deformylase [Escherichia coli 53638]
 gi|291284645|ref|YP_003501463.1| Peptide deformylase [Escherichia coli O55:H7 str. CB9615]
 gi|188487449|gb|EDU62552.1| peptide deformylase [Escherichia coli 53638]
 gi|209757364|gb|ACI76994.1| peptide deformylase [Escherichia coli]
 gi|290764518|gb|ADD58479.1| Peptide deformylase [Escherichia coli O55:H7 str. CB9615]
 gi|320661377|gb|EFX28792.1| peptide deformylase [Escherichia coli O55:H7 str. USDA 5905]
          Length = 169

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/162 (43%), Positives = 115/162 (70%), Gaps = 3/162 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+D
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKD 167


>gi|42524171|ref|NP_969551.1| polypeptide deformylase [Bdellovibrio bacteriovorus HD100]
 gi|39576379|emb|CAE80544.1| polypeptide deformylase [Bdellovibrio bacteriovorus HD100]
          Length = 201

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 106/175 (60%), Gaps = 17/175 (9%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL-- 63
           ++ FPDP LR VS+P++    +I  L ++M+E MY  +GIGLAA Q+G L R+VVID   
Sbjct: 5   ILTFPDPKLREVSQPVKTFGPEIAKLAEDMVETMYHANGIGLAAPQVGELVRMVVIDTRP 64

Query: 64  QDHAHR--------------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAF 109
           +D   R              K P++ INP+I+   +  + + EGCLSIP Y   V+R  +
Sbjct: 65  KDEKGRRYKYEEMTELEAAVKQPLILINPEIVK-GEGKTTFDEGCLSIPGYYETVERYNY 123

Query: 110 ITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           I ++  D N +  I+  DGLLA C+QHE+DHL G LFIDHLS +K + I  ++ K
Sbjct: 124 IEMKAFDVNGKEYIVKTDGLLAICMQHEMDHLEGTLFIDHLSFVKGNKIKNQIKK 178


>gi|269962644|ref|ZP_06176989.1| peptide deformylase [Vibrio harveyi 1DA3]
 gi|269832567|gb|EEZ86681.1| peptide deformylase [Vibrio harveyi 1DA3]
          Length = 193

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+M+E MY  +GIGLAA Q+ V  R+VVID+ +
Sbjct: 27  VLTFPDDRLRTVAKPVEEVTPEIQKIVDDMIETMYDEEGIGLAATQVDVHKRIVVIDISE 86

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 87  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEYTFD 143

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 144 ADDLLAICVQHELDHLMGKLFVDYLSPLKRKRIQDKLAKI 183


>gi|300115536|ref|YP_003762111.1| peptide deformylase [Nitrosococcus watsonii C-113]
 gi|299541473|gb|ADJ29790.1| peptide deformylase [Nitrosococcus watsonii C-113]
          Length = 167

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 103/160 (64%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LRR ++P+  ++  I  L D+MLE MY   GIGLAA+Q+ V  ++VVID+ +   
Sbjct: 9   YPDPRLRRKAQPVAVVDKSIRKLADDMLETMYQAPGIGLAAIQVNVPKQVVVIDISED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +P+V INP+II      +  +EGCLS+P+    V R+A ITV Y+D   Q Q +    
Sbjct: 67  KSSPLVLINPEIIARQGK-AESEEGCLSVPEIFEPVTRAAEITVHYLDREGQKQELQTQE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLATC+QHELDHL G LFID+ S LKR  I KK  K  +L
Sbjct: 126 LLATCIQHELDHLEGKLFIDYFSTLKRQRIRKKAEKRQRL 165


>gi|329295654|ref|ZP_08252990.1| peptide deformylase [Plautia stali symbiont]
          Length = 170

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 109/159 (68%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+++ P+  +N+D+  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDDRLRKIAAPVAAVNADVQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++  S +  + +EGCLSIP+ RA V R+  + VR +D +     +  DG
Sbjct: 67  REERLVLINPELLEKSGETGM-EEGCLSIPEQRAFVPRAERVKVRALDRDGNSFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHELDHL+G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHELDHLDGKLFIDYLSPLKRQRIKQKLEKLAR 164


>gi|326567834|gb|EGE17938.1| peptide deformylase [Moraxella catarrhalis 12P80B1]
 gi|326568164|gb|EGE18246.1| peptide deformylase [Moraxella catarrhalis BC8]
 gi|326573749|gb|EGE23707.1| peptide deformylase [Moraxella catarrhalis O35E]
          Length = 184

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 106/166 (63%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR +++P+   +  +  LI++M E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILTYPDPRLRTLAKPVTVFDDRLKQLIEDMFETMYDARGIGLAATQVDRHIQLIVMDLA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                 +P VFINPK+    D+ S YQEGCLS+P+    ++R + + +  +D + Q   I
Sbjct: 65  RKDEPPSPQVFINPKVTPLVDEHSSYQEGCLSVPEVFDTIERPSRVRIEALDKDGQPFEI 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            A+GLLA C+QHE+DHLNG LF+D+LS LK+     K+ K ++ R+
Sbjct: 125 EAEGLLAVCIQHEMDHLNGKLFVDYLSTLKQSRARDKVKKALKARE 170


>gi|296114064|ref|YP_003628002.1| peptide deformylase [Moraxella catarrhalis RH4]
 gi|295921758|gb|ADG62109.1| peptide deformylase [Moraxella catarrhalis RH4]
 gi|326559449|gb|EGE09872.1| peptide deformylase [Moraxella catarrhalis 7169]
 gi|326561289|gb|EGE11648.1| peptide deformylase [Moraxella catarrhalis 46P47B1]
 gi|326565177|gb|EGE15368.1| peptide deformylase [Moraxella catarrhalis 103P14B1]
 gi|326566131|gb|EGE16288.1| peptide deformylase [Moraxella catarrhalis BC1]
 gi|326572198|gb|EGE22194.1| peptide deformylase [Moraxella catarrhalis BC7]
 gi|326572807|gb|EGE22792.1| peptide deformylase [Moraxella catarrhalis CO72]
 gi|326574626|gb|EGE24562.1| peptide deformylase [Moraxella catarrhalis 101P30B1]
          Length = 184

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 106/166 (63%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR +++P+   +  +  LI++M E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILTYPDPRLRTLAKPVTVFDDRLKQLIEDMFETMYDARGIGLAATQVDRHIQLIVMDLA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                 +P VFINPK+    D+ S YQEGCLS+P+    ++R + + +  +D + Q   I
Sbjct: 65  RKDEPPSPQVFINPKVTPLVDEHSSYQEGCLSVPEVFDTIERPSRVRIEALDKDGQPFEI 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            A+GLLA C+QHE+DHLNG LF+D+LS LK+     K+ K ++ R+
Sbjct: 125 EAEGLLAVCIQHEMDHLNGKLFVDYLSTLKQSRARDKVKKALKARE 170


>gi|285019618|ref|YP_003377329.1| peptide deformylase [Xanthomonas albilineans GPE PC73]
 gi|283474836|emb|CBA17335.1| putative peptide deformylase protein [Xanthomonas albilineans]
          Length = 170

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 104/159 (65%), Gaps = 6/159 (3%)

Query: 9   FPDPILRRVSRPI---EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           FPD  LR  + P+   E  +     L+D+M + MY+  GIGLAA Q+ V  R +VID+ +
Sbjct: 9   FPDSRLRTKAEPVDPAEVASVAFQRLLDDMFDTMYAAPGIGLAASQVDVHKRFMVIDVSE 68

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +  P VF+NP+I+    +  V+QEGCLS+P   ADV RS  ITVRY+D   Q Q + 
Sbjct: 69  E--KNAPHVFVNPQIVQREGE-QVHQEGCLSVPGIYADVTRSESITVRYLDRQGQSQELT 125

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            DGLLA C+QHE+DHL+G LF+D+LS LKR+M+ KK+ K
Sbjct: 126 TDGLLAVCVQHEMDHLDGKLFVDYLSPLKREMVRKKLVK 164


>gi|114327357|ref|YP_744513.1| peptide deformylase [Granulibacter bethesdensis CGDNIH1]
 gi|114315531|gb|ABI61591.1| peptide deformylase [Granulibacter bethesdensis CGDNIH1]
          Length = 205

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 107/161 (66%), Gaps = 2/161 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSD-IMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P++I P   L+  +RP+   ++  I +L+  M   MY   GIGLAA QI  L RL V+D+
Sbjct: 38  PILIAPHKTLKTRARPVTAGDASLIRDLVPRMFATMYKAPGIGLAAPQIDSLLRLAVVDV 97

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                +K P+V INP II  S++ +  +EGCLS+P+  ADV R A I +RY D +   + 
Sbjct: 98  SPD-DQKAPLVLINPDIIARSEEMATREEGCLSLPNQYADVTRPARIKLRYEDLDGSRRE 156

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + AD LLATC+QHE+DHL+GILF+DHLS LKR+M+ ++++K
Sbjct: 157 MEADDLLATCIQHEIDHLDGILFVDHLSTLKRNMLMRRLAK 197


>gi|323493839|ref|ZP_08098957.1| peptide deformylase [Vibrio brasiliensis LMG 20546]
 gi|323311973|gb|EGA65119.1| peptide deformylase [Vibrio brasiliensis LMG 20546]
          Length = 172

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ D
Sbjct: 6   VLTFPDDRLRTVAKPVEAVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ ++ + +     
Sbjct: 66  T--RDEPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALNRDGEEFTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|16762876|ref|NP_458493.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29144363|ref|NP_807705.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213161458|ref|ZP_03347168.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213418738|ref|ZP_03351804.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E01-6750]
 gi|213584235|ref|ZP_03366061.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213650879|ref|ZP_03380932.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
 gi|289824191|ref|ZP_06543786.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|23396544|sp|Q8Z1W9|DEF_SALTI RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|25303718|pir||AB1010 formylmethionine deformylase (EC 3.5.1.31) - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16505183|emb|CAD09179.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29140001|gb|AAO71565.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 169

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D N     + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRNGNPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|239818071|ref|YP_002946981.1| peptide deformylase [Variovorax paradoxus S110]
 gi|239804648|gb|ACS21715.1| peptide deformylase [Variovorax paradoxus S110]
          Length = 173

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 109/164 (66%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+ ++ +PD  L  V++P++ +++ I  L+ +MLE MY   GIGLAA Q+ V  RLVV
Sbjct: 1   MAKRIILSYPDKRLHTVAKPVQGVDARIKALVADMLETMYDASGIGLAATQVDVHERLVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R  P+V INP+II  SD+  + +EGCLS+P     V RS  + V+ +D N +
Sbjct: 61  IDVSEE--RNEPLVLINPEIIWASDEKVLNEEGCLSVPGIYDGVMRSTSVKVQALDENGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            + I A+GLLA C+QHELDHL G +F+++LS LKR+ I  K+ K
Sbjct: 119 LRTIEAEGLLAVCIQHELDHLLGKVFVEYLSPLKRNRIKSKLLK 162


>gi|163803316|ref|ZP_02197194.1| peptide deformylase [Vibrio sp. AND4]
 gi|159172886|gb|EDP57725.1| peptide deformylase [Vibrio sp. AND4]
          Length = 172

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEEVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHKRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEYTFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLMGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|294789398|ref|ZP_06754635.1| peptide deformylase [Simonsiella muelleri ATCC 29453]
 gi|294482611|gb|EFG30301.1| peptide deformylase [Simonsiella muelleri ATCC 29453]
          Length = 171

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 104/160 (65%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L  V++P+ ++N  I  L+ +M E MY + GIGLAA Q+ V  R+VVIDL 
Sbjct: 5   PILKYPDPKLHTVAKPVSEVNDRIKKLVADMAETMYESRGIGLAATQVDVHERVVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R   +  INP IIT  D  + Y+EGCLS+P     V R+  +TV ++D +   Q +
Sbjct: 65  EE--RNQLITLINP-IITHKDGETTYEEGCLSVPGVYDTVTRAERVTVEFLDADGHAQKL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G +F+++LS LK++ I  KM K
Sbjct: 122 DADGLLAICIQHELDHLQGKVFVEYLSPLKQNRIKTKMKK 161


>gi|237746966|ref|ZP_04577446.1| polypeptide deformylase [Oxalobacter formigenes HOxBLS]
 gi|229378317|gb|EEO28408.1| polypeptide deformylase [Oxalobacter formigenes HOxBLS]
          Length = 183

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 111/164 (67%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M + P++ +PDP L + SRP+   +S++  L++NM + MY   G+GLAA Q+    ++VV
Sbjct: 1   MARLPILRYPDPRLLKPSRPVTSFDSELKTLVENMAQTMYEAPGVGLAAPQVNAHRQVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R    VFINP+II  S++ ++++EGCLS+P    +++R A +TVR  D + +
Sbjct: 61  IDVSEK--RNELHVFINPQIIKASEEKTLFEEGCLSLPGIYDEIERPARVTVRAQDVDGK 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              + A+GLLA C+QHE+DHL G +F+D+LS +KR+ I KK+ K
Sbjct: 119 AFEMEAEGLLAVCVQHEIDHLKGRVFVDYLSPMKRNRIKKKLLK 162


>gi|241766760|ref|ZP_04764590.1| peptide deformylase [Acidovorax delafieldii 2AN]
 gi|241362866|gb|EER58605.1| peptide deformylase [Acidovorax delafieldii 2AN]
          Length = 169

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 110/166 (66%), Gaps = 4/166 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P++ +++ I  L+ +ML  MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILCYPDPRLHKVAQPVQAVDARIEALVADMLATMYDAHGIGLAATQVDVHERVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I+  S +  V  EGCLS+P     V+R+A + VR +D   + + I
Sbjct: 65  EE--RNEPLVLINPEIVWASAERHVGDEGCLSVPGIYDGVERAAAVHVRALDAQGKSRTI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            A+GLLA C+QHE+DHL G +F+++LS LKR+ I  K+ K  Q RD
Sbjct: 123 EAEGLLAVCMQHEMDHLMGKVFVEYLSPLKRNRIKTKLLK--QQRD 166


>gi|301155307|emb|CBW14773.1| peptide deformylase [Haemophilus parainfluenzae T3T1]
          Length = 169

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 110/159 (69%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N DI  ++D+M + MY  +GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVVEVNDDIRKIVDDMFDTMYQEEGIGLAAPQVDILQRIITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INP+I+    +  + +EGCLSIP +RA V R   +TV+ +D + +   + 
Sbjct: 65  -GDKQNQLVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVKALDRHGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLVK 161


>gi|297180810|gb|ADI17016.1| N-formylmethionyl-tRNA deformylase [uncultured Vibrionales
           bacterium HF0010_22E23]
          Length = 170

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I  ++D+MLE MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDERLRTVAKPVESVTPEIQKIVDDMLETMYEENGIGLAATQVDIHQRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  +A V R+A +TV+ +D +       
Sbjct: 66  T--RDEPMVLINPEIIEKRGEDGI-EEGCLSVPGSQALVPRAAEVTVKALDRDGNEYQFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K+ K+
Sbjct: 123 ADDLLAICVQHELDHLMGKLFVDYLSPLKRQRIKQKLEKI 162


>gi|114561212|ref|YP_748725.1| peptide deformylase [Shewanella frigidimarina NCIMB 400]
 gi|114332505|gb|ABI69887.1| peptide deformylase [Shewanella frigidimarina NCIMB 400]
          Length = 188

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 102/160 (63%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+      +   IDNMLE MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 27  FPDERLRTIAQPVTDFGPQLQTQIDNMLETMYLEKGIGLAATQVDFHQQLIVMDLQDEVE 86

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P +FINP+I+  S D +  +EGCLS+P   A V R+ F+T++ +D + +  I+ AD 
Sbjct: 87  R--PTIFINPQIVASSGDLA-NEEGCLSVPGIYAKVDRAEFVTLKALDRHGKEFIVEADE 143

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           L A C+QHE+DHL G LF+D+LS LKR  I  K+ K  +L
Sbjct: 144 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKTKLEKEARL 183


>gi|311696635|gb|ADP99508.1| peptide deformylase [marine bacterium HP15]
          Length = 167

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 101/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LR +++P+E++      LID+M E MY   GIGLAA Q+ V  +++V+DL +   
Sbjct: 8   YPDPRLRTIAKPVEEVTDADRKLIDDMFETMYDAPGIGLAATQVNVHKQIIVMDLSED-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP++     +    QEGCLS+P +  DV+R     +R MD + +   + A G
Sbjct: 66  KSEPRVFINPEVEVLDGEREAMQEGCLSVPGFYEDVERIEHCMIRAMDRDGKPFELEAKG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHLNG LF+D+LS LKR+ I KK+ K
Sbjct: 126 LLAVCIQHEMDHLNGRLFVDYLSSLKRNRIRKKLEK 161


>gi|148259426|ref|YP_001233553.1| peptide deformylase [Acidiphilium cryptum JF-5]
 gi|146401107|gb|ABQ29634.1| peptide deformylase [Acidiphilium cryptum JF-5]
          Length = 188

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)

Query: 6   LVIFPDPILR-RVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           ++I PD  LR +  R +     D+  L+  M   MY   GIGLAA QIGV  RLVV+DL 
Sbjct: 18  ILIVPDKRLRMKARRVVGADRDDVAELVPRMFAAMYRAPGIGLAAPQIGVSLRLVVMDLA 77

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
               +K PMV INP+I   S++    +EGCLS+P   A+V R   I+V + D + + + I
Sbjct: 78  PD-DQKQPMVMINPEITARSEELVSREEGCLSLPGQYAEVIRPGQISVAFEDEDGKKRTI 136

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHE+DHL+G+LF+DHLS LKR+MI +K++K
Sbjct: 137 DADGLLAACIQHEIDHLDGVLFVDHLSALKRNMILRKLAK 176


>gi|308188323|ref|YP_003932454.1| peptide deformylase [Pantoea vagans C9-1]
 gi|308058833|gb|ADO11005.1| peptide deformylase [Pantoea vagans C9-1]
          Length = 170

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 109/159 (68%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+V+ P++++N+DI  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRKVAAPVKEVNADIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++  S +  + +EGCLSIP+ RA V R+  + VR +D + +   + A  
Sbjct: 67  REERLVLINPELLEKSGETGI-EEGCLSIPEQRAFVPRAERVKVRALDRDGKSFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I  K+ KL +
Sbjct: 126 LLAICIQHEIDHLEGKLFIDYLSPLKRQRIKTKLEKLAR 164


>gi|323496960|ref|ZP_08101988.1| peptide deformylase [Vibrio sinaloensis DSM 21326]
 gi|323318034|gb|EGA71017.1| peptide deformylase [Vibrio sinaloensis DSM 21326]
          Length = 173

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E++  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEEVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ ++ + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALNRDGEEYTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|257456003|ref|ZP_05621212.1| peptide deformylase [Enhydrobacter aerosaccus SK60]
 gi|257446592|gb|EEV21626.1| peptide deformylase [Enhydrobacter aerosaccus SK60]
          Length = 176

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 108/170 (63%), Gaps = 2/170 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++ +PDP LR +++P+   + ++  LID+M E MY+  GIGLAA Q+    +LVV
Sbjct: 1   MTLRTILNYPDPRLRTLAKPVTHFDDELKTLIDDMFETMYAAKGIGLAATQVDEHIQLVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL +   +  P VFINP +   +D+   Y+EGCLS+P+Y   V R   + +  +D    
Sbjct: 61  MDLSEDGSQ--PRVFINPIVTPLADELYSYEEGCLSVPEYYDKVDRPKHVKIEALDAQGN 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
             +  A GLLA C+QHE+DHLNG +F+D+LS+LK+D    K+ K+V+ R+
Sbjct: 119 PFVEEAQGLLAVCIQHEIDHLNGKIFVDYLSKLKQDRARDKVRKVVKQRE 168


>gi|254229999|ref|ZP_04923400.1| peptide deformylase [Vibrio sp. Ex25]
 gi|269966999|ref|ZP_06181069.1| peptide deformylase [Vibrio alginolyticus 40B]
 gi|151937501|gb|EDN56358.1| peptide deformylase [Vibrio sp. Ex25]
 gi|269828393|gb|EEZ82657.1| peptide deformylase [Vibrio alginolyticus 40B]
          Length = 203

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 108/160 (67%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 37  VLTFPDDRLRTVAKPVEAVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHKRIVVIDISE 96

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 97  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEFTFE 153

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 154 ADDLLAICVQHELDHLQGKLFVDYLSPLKRKRIQDKLAKI 193


>gi|254507283|ref|ZP_05119419.1| peptide deformylase [Vibrio parahaemolyticus 16]
 gi|219549743|gb|EED26732.1| peptide deformylase [Vibrio parahaemolyticus 16]
          Length = 172

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEAVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ ++ + +     
Sbjct: 66  T--RDEPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALNRDGEEYTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|157148861|ref|YP_001456180.1| peptide deformylase [Citrobacter koseri ATCC BAA-895]
 gi|166198515|sp|A8AQI1|DEF_CITK8 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|157086066|gb|ABV15744.1| hypothetical protein CKO_04699 [Citrobacter koseri ATCC BAA-895]
          Length = 169

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 113/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKSFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|326402652|ref|YP_004282733.1| peptide deformylase [Acidiphilium multivorum AIU301]
 gi|325049513|dbj|BAJ79851.1| peptide deformylase [Acidiphilium multivorum AIU301]
          Length = 185

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)

Query: 6   LVIFPDPILR-RVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           ++I PD  LR +  R +     D+  L+  M   MY   GIGLAA QIGV  RLVV+DL 
Sbjct: 15  ILIVPDKRLRMKARRVVGADRDDVAELVPRMFAAMYRAPGIGLAAPQIGVSLRLVVMDLA 74

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
               +K PMV INP+I   S++    +EGCLS+P   A+V R   I+V + D + + + I
Sbjct: 75  PD-DQKQPMVMINPEITARSEELVSREEGCLSLPGQYAEVIRPGQISVAFEDEDGKKRTI 133

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHE+DHL+G+LF+DHLS LKR+MI +K++K
Sbjct: 134 DADGLLAACIQHEIDHLDGVLFVDHLSALKRNMILRKLAK 173


>gi|332991529|gb|AEF01584.1| peptide deformylase [Alteromonas sp. SN2]
          Length = 169

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 107/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P+E++N DI  L+ +M E M   +GIGLAA Q+    ++VV+++ +   
Sbjct: 9   FPDERLRTVAKPVEEVNDDIKQLVSDMFETMKDENGIGLAATQVDRHVQVVVMNVAED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+I T  D  ++ +EGCLS+P   A V+R+  ITV+ ++ N +   + ADG
Sbjct: 67  QDEPRVFINPEI-TKKDGSTISEEGCLSVPGNYAKVERAEEITVKALNENGEAFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LFID+LS LKR  I KK+ K  +L
Sbjct: 126 LLAICIQHELDHLKGKLFIDYLSPLKRQRIRKKLEKEARL 165


>gi|146329347|ref|YP_001209086.1| formylmethionine deformylase [Dichelobacter nodosus VCS1703A]
 gi|158513298|sp|A5EWL8|DEF_DICNV RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|146232817|gb|ABQ13795.1| formylmethionine deformylase [Dichelobacter nodosus VCS1703A]
          Length = 181

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 106/168 (63%), Gaps = 9/168 (5%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I PDP LR  ++P+   +  +  ++ NM E MY   GIGLAA Q+ +  RL+V+D+  
Sbjct: 6   ILIHPDPRLRLPAQPVTHFDDALAEIVQNMYETMYHFHGIGLAAPQVNIQQRLIVMDVPQ 65

Query: 66  HAHRK---------NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
            +  +         + +V +NP+I+  S++   Y+EGCLS+P+  A V R A ITVRY D
Sbjct: 66  RSAEEGEKAEQIPSDKLVLVNPEIVQRSEECQDYEEGCLSLPNQYALVTRPANITVRYQD 125

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
                Q   A GLL+ C+QHE+DHLNG LFIDHLSRLKR+ + KK++K
Sbjct: 126 ITGATQERAAQGLLSVCIQHEIDHLNGGLFIDHLSRLKRERLEKKLAK 173


>gi|239904668|ref|YP_002951406.1| peptide deformylase [Desulfovibrio magneticus RS-1]
 gi|239794531|dbj|BAH73520.1| peptide deformylase [Desulfovibrio magneticus RS-1]
          Length = 174

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 101/165 (61%), Gaps = 3/165 (1%)

Query: 5   PLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I  +P P+L + + P+ +I   I  L   M E MY+  GIGLAA Q+G   RL+VID
Sbjct: 2   PLEILKYPHPVLAKKAEPVAEITDAIRELAAGMAEAMYANQGIGLAAPQVGASIRLIVID 61

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           L     R+  M  +NP +IT +      +EGCLS+  YR  V+R+A +TV  +D   Q  
Sbjct: 62  LSGPDKREALMTLVNP-VITAASGEQEDEEGCLSVRSYRTKVRRAANVTVTALDLAGQPL 120

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            I AD LLA CLQHE+DHL+G+LFID +SRLKR M  K++ +  Q
Sbjct: 121 TIEADELLAVCLQHEVDHLDGVLFIDRISRLKRAMYDKRVKRWAQ 165


>gi|83594679|ref|YP_428431.1| peptide deformylase [Rhodospirillum rubrum ATCC 11170]
 gi|83577593|gb|ABC24144.1| peptide deformylase [Rhodospirillum rubrum ATCC 11170]
          Length = 172

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 108/161 (67%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PDP L + + P+E ++  I  L+D+MLE MY   GIGLAA Q+GVL R++V+D  
Sbjct: 5   PILTAPDPRLTKKALPVETVDVSIRKLMDDMLETMYLAPGIGLAAPQVGVLKRVIVLDPA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                  PM   NP+II  S+D   Y+EGCLS+P+    V R   + VRY+D + + + I
Sbjct: 65  REDEAPRPMRLANPEIIWSSEDTKPYEEGCLSVPEQYDTVVRPDRVRVRYLDPDNEIREI 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            ADGLLA  LQHE+DHL+GILF+D+LS LKR+M+ +K+ K+
Sbjct: 125 DADGLLAVILQHEIDHLDGILFVDYLSSLKRNMMLRKLRKM 165


>gi|28899816|ref|NP_799421.1| peptide deformylase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837667|ref|ZP_01990334.1| peptide deformylase [Vibrio parahaemolyticus AQ3810]
 gi|260362018|ref|ZP_05775023.1| peptide deformylase [Vibrio parahaemolyticus K5030]
 gi|260876495|ref|ZP_05888850.1| peptide deformylase [Vibrio parahaemolyticus AN-5034]
 gi|260897448|ref|ZP_05905944.1| peptide deformylase [Vibrio parahaemolyticus Peru-466]
 gi|260901339|ref|ZP_05909734.1| peptide deformylase [Vibrio parahaemolyticus AQ4037]
 gi|31076643|sp|Q87KD5|DEF1_VIBPA RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|28808068|dbj|BAC61305.1| polypeptide deformylase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748957|gb|EDM59784.1| peptide deformylase [Vibrio parahaemolyticus AQ3810]
 gi|308087895|gb|EFO37590.1| peptide deformylase [Vibrio parahaemolyticus Peru-466]
 gi|308090413|gb|EFO40108.1| peptide deformylase [Vibrio parahaemolyticus AN-5034]
 gi|308109891|gb|EFO47431.1| peptide deformylase [Vibrio parahaemolyticus AQ4037]
 gi|308114143|gb|EFO51683.1| peptide deformylase [Vibrio parahaemolyticus K5030]
 gi|328471167|gb|EGF42069.1| peptide deformylase [Vibrio parahaemolyticus 10329]
          Length = 172

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 108/160 (67%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P++ +  +I  ++D+M+E MY  +GIGLAA Q+ +  R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVDAVTPEIQKIVDDMIETMYDEEGIGLAATQVDIHKRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEFTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLQGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|264680865|ref|YP_003280775.1| peptide deformylase [Comamonas testosteroni CNB-2]
 gi|262211381|gb|ACY35479.1| peptide deformylase [Comamonas testosteroni CNB-2]
          Length = 170

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 107/160 (66%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+ +++  I  L+ +MLE MY   GIGLAA QI V  R++VID+ 
Sbjct: 5   PILCYPDPRLHKVAKPVAQVDERIQTLVKDMLETMYDAQGIGLAATQIDVHERVIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PM  INP+I+  S++  + +EGCLS+P     V+RS  + V+ +D N   + I
Sbjct: 65  EK--RNEPMALINPEILWASEEKQLGEEGCLSVPGIYDGVERSIAVKVKALDENGNSREI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+G+LA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 DAEGMLAICIQHEMDHLLGKVFVEYLSPLKRNRIKTKLVK 162


>gi|300721398|ref|YP_003710669.1| peptide deformylase [Xenorhabdus nematophila ATCC 19061]
 gi|297627886|emb|CBJ88432.1| peptide deformylase [Xenorhabdus nematophila ATCC 19061]
          Length = 170

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 112/161 (69%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EK++++I  +ID+M E MY+ +GIGLAA Q+ +  R+VVID+ +   
Sbjct: 9   YPDERLRTIAKPVEKVDAEIQRIIDDMFETMYAEEGIGLAATQVDIHQRIVVIDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           RK  +V INP+++  S +  + +EGCLS+P+ R  V R   I ++ +D + Q   + ADG
Sbjct: 67  RKQLLVLINPELLNESGETGI-EEGCLSVPEQRGFVPRFEQIKIKALDYHGQPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKIDRLR 166


>gi|330447316|ref|ZP_08310966.1| peptide deformylase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491507|dbj|GAA05463.1| peptide deformylase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 169

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 104/160 (65%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E I  +I  +ID+MLE MY  +GIGLAA Q+ +  R+VVID  +
Sbjct: 6   VLTFPDERLRTVAKPVEAITPEIQTIIDDMLETMYDEEGIGLAATQVDIHQRIVVIDTSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I     +  + +EGCLS+P  RA V R+A ++V  +D N       
Sbjct: 66  T--RDQPMVLINPEITEKRGEDGI-EEGCLSVPGARALVPRAAEVSVTALDRNGDTICFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I +K+ K+
Sbjct: 123 ADELLAICIQHELDHLAGKLFVDYLSPLKRQRIKQKLEKI 162


>gi|332289299|ref|YP_004420151.1| peptide deformylase [Gallibacterium anatis UMN179]
 gi|330432195|gb|AEC17254.1| peptide deformylase [Gallibacterium anatis UMN179]
          Length = 171

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 105/159 (66%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V+ P+EK++ +I   IDNM E MY  +GIGLAA Q+    R++ ID++ 
Sbjct: 6   VLCFPDERLRTVAAPVEKVDDEIREFIDNMFETMYQQEGIGLAATQVNRHQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+I+  SD  +  +EGCLS+P +R  V R   +TV+ +D N +   + 
Sbjct: 65  -GDKSNQLVLINPEIVE-SDGETGIEEGCLSVPGFRGLVPRKEKVTVKALDRNGEPFTLE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A  LLA C+QHE+DHLNG++F+D+LS LKR+ I  K+ K
Sbjct: 123 ASDLLAICIQHEIDHLNGVMFVDYLSPLKRNRIKDKLVK 161


>gi|94499926|ref|ZP_01306462.1| peptide deformylase [Oceanobacter sp. RED65]
 gi|94428127|gb|EAT13101.1| peptide deformylase [Oceanobacter sp. RED65]
          Length = 171

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 98/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+E++      LID+M E MY   GIGLAA Q+ V  +++V+D+ +   
Sbjct: 9   FPDTRLRTIAKPVEEVTDAHRKLIDDMFETMYDCPGIGLAATQVNVHEQIIVMDISED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINPK+     +    QEGCLS+P +  DV+R     +  +D N Q   + A G
Sbjct: 67  RSEPHVFINPKVTVLDGEPEKMQEGCLSVPGFYEDVERIEHCKIEALDRNGQPYELEARG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHLNG LF+D+LS  KRD I KK+ K
Sbjct: 127 LLAVCIQHEMDHLNGKLFVDYLSTTKRDRIRKKLEK 162


>gi|206889750|ref|YP_002248176.1| peptide deformylase [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|238058215|sp|B5YIL7|DEF_THEYD RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|206741688|gb|ACI20745.1| peptide deformylase [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 165

 Score =  147 bits (370), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 103/153 (67%), Gaps = 1/153 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD +L++ +  I +IN D+  LIDNM+E MY+ +GIGLAA Q+GVL RL+V+D      
Sbjct: 9   YPDEVLKKKAETISEINGDLQKLIDNMIETMYNANGIGLAAPQVGVLKRLIVVDTSPREQ 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            ++ +V INP+ IT S+   + +EGCLS+P +   +KR   + V+ +D N +   I A G
Sbjct: 69  NQSLIVLINPE-ITDSEGEILSEEGCLSLPGFTTRLKRKERVIVKGLDRNGKEIEIEATG 127

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKK 161
           LLA  LQHE+DHL+GIL ID +S LKR++  KK
Sbjct: 128 LLARALQHEIDHLDGILLIDKISPLKRELFRKK 160


>gi|304399256|ref|ZP_07381122.1| peptide deformylase [Pantoea sp. aB]
 gi|304353182|gb|EFM17563.1| peptide deformylase [Pantoea sp. aB]
          Length = 170

 Score =  146 bits (369), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 108/159 (67%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+V+ P++++N+DI  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRKVAAPVKEVNADIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++  S +  + +EGCLSIP+ RA V R+  + VR +D +     + A  
Sbjct: 67  REERLVLINPELLEKSGETGI-EEGCLSIPEQRAFVPRAERVKVRALDRDGNSFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I  K+ KL +
Sbjct: 126 LLAICIQHEIDHLEGKLFIDYLSPLKRQRIKTKLEKLAR 164


>gi|93004869|ref|YP_579306.1| peptide deformylase [Psychrobacter cryohalolentis K5]
 gi|123386822|sp|Q1QET1|DEF_PSYCK RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|92392547|gb|ABE73822.1| peptide deformylase [Psychrobacter cryohalolentis K5]
          Length = 184

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 110/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR ++ P++++ ++I  LI +M+E MY   GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSYPDPRLRTIATPVKEVTAEIKTLITDMIETMYDAQGIGLAASQVDHHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   + +P VFINPK+    ++   Y+EGCLS+PD    V+R   + +  +D N      
Sbjct: 65  ED--KDSPRVFINPKVTPLVEEKQPYEEGCLSVPDVYDKVERPNKVRIEALDENGNKIDE 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
             +GLLA C+QHE+DHLNG++F+D+LSRLK+     K+ K++++R+
Sbjct: 123 EVEGLLAVCIQHEMDHLNGVIFVDYLSRLKQTRARDKVRKVLKIRE 168


>gi|281306913|pdb|2W3T|A Chain A, Chloro Complex Of The Ni-Form Of E.Coli Deformylase
 gi|281306914|pdb|2W3U|A Chain A, Formate Complex Of The Ni-Form Of E.Coli Deformylase
          Length = 188

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 8   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 66  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 124

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 125 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 165


>gi|317486329|ref|ZP_07945159.1| polypeptide deformylase [Bilophila wadsworthia 3_1_6]
 gi|316922399|gb|EFV43655.1| polypeptide deformylase [Bilophila wadsworthia 3_1_6]
          Length = 172

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 101/160 (63%), Gaps = 1/160 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +P+P+L + S PI ++  +I  L + M E MY +DGIG+AA Q+G L RLV+ID+  
Sbjct: 5   IVTYPNPLLGKPSLPITEVTDEIRKLAEEMTEAMYKSDGIGIAAPQVGQLIRLVIIDVTG 64

Query: 66  HAHRKNPMVFINPKIITFSD-DFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
              R+  MV +NP      D  +   +EGCLS+PDYR+ V+R+A + V   D +      
Sbjct: 65  PEKREGKMVLVNPVWTPLPDAGYVESEEGCLSVPDYRSKVRRTARVHVEATDLDGNPVSF 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            AD +LA C+QHE+DHL+G LFID +SRLKR M   K+ K
Sbjct: 125 DADDILAICVQHEIDHLDGKLFIDRISRLKRIMFENKLKK 164


>gi|71905663|ref|YP_283250.1| peptide deformylase [Dechloromonas aromatica RCB]
 gi|71845284|gb|AAZ44780.1| peptide deformylase [Dechloromonas aromatica RCB]
          Length = 167

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 103/160 (64%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP L++V+ P+ K++  I  L+ +M E MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRFPDPRLKKVALPVAKVDDSIRKLVADMAETMYEAPGIGLAATQVDVHKRVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +     FINP +++  +     +EGCLS+P     V+R+  + V Y+D +   Q +
Sbjct: 65  ED--KSELQAFINP-VLSRCEGSQTGEEGCLSVPGIYDKVERAESVVVTYLDLDGNQQTL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA CLQHELDHLNG +F+DHLS LK+  I  K++K
Sbjct: 122 AADGLLAVCLQHELDHLNGTVFVDHLSLLKQTRIRNKLAK 161


>gi|4699740|pdb|1ICJ|A Chain A, Pdf Protein Is Crystallized As Ni2+ Containing Form,
           Cocrystallized With Inhibitor Polyethylene Glycol (Peg)
 gi|4699741|pdb|1ICJ|B Chain B, Pdf Protein Is Crystallized As Ni2+ Containing Form,
           Cocrystallized With Inhibitor Polyethylene Glycol (Peg)
 gi|4699742|pdb|1ICJ|C Chain C, Pdf Protein Is Crystallized As Ni2+ Containing Form,
           Cocrystallized With Inhibitor Polyethylene Glycol (Peg)
 gi|5821888|pdb|1BS4|A Chain A, Peptide Deformylase As Zn2+ Containing Form (Native) In
           Complex With Inhibitor Polyethylene Glycol
 gi|5821889|pdb|1BS4|B Chain B, Peptide Deformylase As Zn2+ Containing Form (Native) In
           Complex With Inhibitor Polyethylene Glycol
 gi|5821890|pdb|1BS4|C Chain C, Peptide Deformylase As Zn2+ Containing Form (Native) In
           Complex With Inhibitor Polyethylene Glycol
 gi|5821891|pdb|1BS5|A Chain A, Peptide Deformylase As Zn2+ Containing Form
 gi|5821892|pdb|1BS5|B Chain B, Peptide Deformylase As Zn2+ Containing Form
 gi|5821893|pdb|1BS5|C Chain C, Peptide Deformylase As Zn2+ Containing Form
 gi|5821894|pdb|1BS6|A Chain A, Peptide Deformylase As Ni2+ Containing Form In Complex
           With Tripeptide Met-Ala-Ser
 gi|5821895|pdb|1BS6|B Chain B, Peptide Deformylase As Ni2+ Containing Form In Complex
           With Tripeptide Met-Ala-Ser
 gi|5821896|pdb|1BS6|C Chain C, Peptide Deformylase As Ni2+ Containing Form In Complex
           With Tripeptide Met-Ala-Ser
 gi|5821900|pdb|1BS7|A Chain A, Peptide Deformylase As Ni2+ Containing Form
 gi|5821901|pdb|1BS7|B Chain B, Peptide Deformylase As Ni2+ Containing Form
 gi|5821902|pdb|1BS7|C Chain C, Peptide Deformylase As Ni2+ Containing Form
 gi|5821903|pdb|1BS8|A Chain A, Peptide Deformylase As Zn2+ Containing Form In Complex
           With Tripeptide Met-Ala-Ser
 gi|5821904|pdb|1BS8|B Chain B, Peptide Deformylase As Zn2+ Containing Form In Complex
           With Tripeptide Met-Ala-Ser
 gi|5821905|pdb|1BS8|C Chain C, Peptide Deformylase As Zn2+ Containing Form In Complex
           With Tripeptide Met-Ala-Ser
 gi|5821915|pdb|1BSZ|A Chain A, Peptide Deformylase As Fe2+ Containing Form (Native) In
           Complex With Inhibitor Polyethylene Glycol
 gi|5821916|pdb|1BSZ|B Chain B, Peptide Deformylase As Fe2+ Containing Form (Native) In
           Complex With Inhibitor Polyethylene Glycol
 gi|5821917|pdb|1BSZ|C Chain C, Peptide Deformylase As Fe2+ Containing Form (Native) In
           Complex With Inhibitor Polyethylene Glycol
 gi|7767088|pdb|1BSJ|A Chain A, Cobalt Deformylase Inhibitor Complex From E.Coli
 gi|7767089|pdb|1BSK|A Chain A, Zinc Deformylase Inhibitor Complex From E.Coli
 gi|16975207|pdb|1G27|A Chain A, Crystal Structure Of E.Coli Polypeptide Deformylase
           Complexed With The Inhibitor Bb-3497
 gi|16975208|pdb|1G27|B Chain B, Crystal Structure Of E.Coli Polypeptide Deformylase
           Complexed With The Inhibitor Bb-3497
 gi|16975209|pdb|1G27|C Chain C, Crystal Structure Of E.Coli Polypeptide Deformylase
           Complexed With The Inhibitor Bb-3497
 gi|16975210|pdb|1G2A|A Chain A, The Crystal Structure Of E.Coli Peptide Deformylase
           Complexed With Actinonin
 gi|16975211|pdb|1G2A|B Chain B, The Crystal Structure Of E.Coli Peptide Deformylase
           Complexed With Actinonin
 gi|16975212|pdb|1G2A|C Chain C, The Crystal Structure Of E.Coli Peptide Deformylase
           Complexed With Actinonin
 gi|22219291|pdb|1LRU|A Chain A, Crystal Structure Of E.Coli Peptide Deformylase Complexed
           With Antibiotic Actinonin
 gi|22219292|pdb|1LRU|B Chain B, Crystal Structure Of E.Coli Peptide Deformylase Complexed
           With Antibiotic Actinonin
 gi|22219293|pdb|1LRU|C Chain C, Crystal Structure Of E.Coli Peptide Deformylase Complexed
           With Antibiotic Actinonin
 gi|62738424|pdb|1XEM|A Chain A, High Resolution Crystal Structure Of Escherichia Coli
           Zinc- Peptide Deformylase Bound To Formate
 gi|62738425|pdb|1XEN|A Chain A, High Resolution Crystal Structure Of Escherichia Coli
           Iron- Peptide Deformylase Bound To Formate
 gi|62738426|pdb|1XEO|A Chain A, High Resolution Crystals Structure Of Cobalt- Peptide
           Deformylase Bound To Formate
 gi|75766233|pdb|2AI8|A Chain A, E.Coli Polypeptide Deformylase Complexed With Sb-485343
 gi|75766234|pdb|2AI8|B Chain B, E.Coli Polypeptide Deformylase Complexed With Sb-485343
 gi|75766235|pdb|2AI8|C Chain C, E.Coli Polypeptide Deformylase Complexed With Sb-485343
          Length = 168

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 8   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 66  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 124

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 125 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 165


>gi|254447455|ref|ZP_05060921.1| peptide deformylase [gamma proteobacterium HTCC5015]
 gi|198262798|gb|EDY87077.1| peptide deformylase [gamma proteobacterium HTCC5015]
          Length = 169

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 71/158 (44%), Positives = 107/158 (67%), Gaps = 3/158 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ FPDP LR+  +P+E+++ ++   ID+M E MY   GIGLAA+Q+    RL++
Sbjct: 1   MAKLEILHFPDPRLRQACKPVEQVDDELRQFIDDMFETMYDAPGIGLAAIQVNRHERLLI 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D+ + A   NP+VFINP+II  +D   V QEGCLS+P +  +V+R+  I V+ +D + +
Sbjct: 61  TDVSEDA--SNPLVFINPEIIE-ADGVEVTQEGCLSVPGFYENVERAEHIVVKALDRDGK 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
              +  DGL A C+QHE+DHL+G LF+D+LS LKR+ I
Sbjct: 118 AFEMACDGLQAVCVQHEIDHLDGKLFVDYLSPLKRNRI 155


>gi|113968375|ref|YP_732168.1| peptide deformylase [Shewanella sp. MR-4]
 gi|114045540|ref|YP_736090.1| peptide deformylase [Shewanella sp. MR-7]
 gi|117918494|ref|YP_867686.1| peptide deformylase [Shewanella sp. ANA-3]
 gi|113883059|gb|ABI37111.1| peptide deformylase [Shewanella sp. MR-4]
 gi|113886982|gb|ABI41033.1| peptide deformylase [Shewanella sp. MR-7]
 gi|117610826|gb|ABK46280.1| peptide deformylase [Shewanella sp. ANA-3]
          Length = 168

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  + P+ +  +++   ID+M E MY   GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRTQATPVTEFTAELQTQIDDMFETMYQEKGIGLAATQVDYHKQLIVMDLQDEVD 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP+II  S DF   +EGCLS+P   A V R+ F+TV+ +D +     + AD 
Sbjct: 69  R--PKVFINPEIIASSGDF-CNEEGCLSVPGIYAKVDRAEFVTVKALDRHGNEFTVEADE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           L A C+QHE+DHL G LF+D+LS LKR  I +K+ K
Sbjct: 126 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEK 161


>gi|15803814|ref|NP_289848.1| peptide deformylase [Escherichia coli O157:H7 EDL933]
 gi|15833406|ref|NP_312179.1| peptide deformylase [Escherichia coli O157:H7 str. Sakai]
 gi|16131166|ref|NP_417745.1| peptide deformylase [Escherichia coli str. K-12 substr. MG1655]
 gi|26249871|ref|NP_755911.1| peptide deformylase [Escherichia coli CFT073]
 gi|82545649|ref|YP_409596.1| peptide deformylase [Shigella boydii Sb227]
 gi|82778584|ref|YP_404933.1| peptide deformylase [Shigella dysenteriae Sd197]
 gi|89110724|ref|AP_004504.1| peptide deformylase [Escherichia coli str. K-12 substr. W3110]
 gi|91212713|ref|YP_542699.1| peptide deformylase [Escherichia coli UTI89]
 gi|110643525|ref|YP_671255.1| peptide deformylase [Escherichia coli 536]
 gi|117625569|ref|YP_858892.1| peptide deformylase [Escherichia coli APEC O1]
 gi|157156138|ref|YP_001464754.1| peptide deformylase [Escherichia coli E24377A]
 gi|157162760|ref|YP_001460078.1| peptide deformylase [Escherichia coli HS]
 gi|168752265|ref|ZP_02777287.1| peptide deformylase [Escherichia coli O157:H7 str. EC4113]
 gi|168758514|ref|ZP_02783521.1| peptide deformylase [Escherichia coli O157:H7 str. EC4401]
 gi|168764969|ref|ZP_02789976.1| peptide deformylase [Escherichia coli O157:H7 str. EC4501]
 gi|168769148|ref|ZP_02794155.1| peptide deformylase [Escherichia coli O157:H7 str. EC4486]
 gi|168777856|ref|ZP_02802863.1| peptide deformylase [Escherichia coli O157:H7 str. EC4196]
 gi|168783853|ref|ZP_02808860.1| peptide deformylase [Escherichia coli O157:H7 str. EC4076]
 gi|168786176|ref|ZP_02811183.1| peptide deformylase [Escherichia coli O157:H7 str. EC869]
 gi|170018478|ref|YP_001723432.1| peptide deformylase [Escherichia coli ATCC 8739]
 gi|170082807|ref|YP_001732127.1| peptide deformylase [Escherichia coli str. K-12 substr. DH10B]
 gi|170769511|ref|ZP_02903964.1| peptide deformylase [Escherichia albertii TW07627]
 gi|191169294|ref|ZP_03031043.1| peptide deformylase [Escherichia coli B7A]
 gi|191174456|ref|ZP_03035957.1| peptide deformylase [Escherichia coli F11]
 gi|193066484|ref|ZP_03047528.1| peptide deformylase [Escherichia coli E22]
 gi|193071544|ref|ZP_03052453.1| peptide deformylase [Escherichia coli E110019]
 gi|194430283|ref|ZP_03062778.1| peptide deformylase [Escherichia coli B171]
 gi|194435085|ref|ZP_03067323.1| peptide deformylase [Shigella dysenteriae 1012]
 gi|194439997|ref|ZP_03072055.1| peptide deformylase [Escherichia coli 101-1]
 gi|195939834|ref|ZP_03085216.1| peptide deformylase [Escherichia coli O157:H7 str. EC4024]
 gi|208806494|ref|ZP_03248831.1| peptide deformylase [Escherichia coli O157:H7 str. EC4206]
 gi|208814593|ref|ZP_03255922.1| peptide deformylase [Escherichia coli O157:H7 str. EC4045]
 gi|208821413|ref|ZP_03261733.1| peptide deformylase [Escherichia coli O157:H7 str. EC4042]
 gi|209400361|ref|YP_002272743.1| peptide deformylase [Escherichia coli O157:H7 str. EC4115]
 gi|209920752|ref|YP_002294836.1| peptide deformylase [Escherichia coli SE11]
 gi|215488586|ref|YP_002331017.1| peptide deformylase [Escherichia coli O127:H6 str. E2348/69]
 gi|217325115|ref|ZP_03441199.1| peptide deformylase [Escherichia coli O157:H7 str. TW14588]
 gi|218550562|ref|YP_002384353.1| peptide deformylase [Escherichia fergusonii ATCC 35469]
 gi|218555844|ref|YP_002388757.1| peptide deformylase [Escherichia coli IAI1]
 gi|218560348|ref|YP_002393261.1| peptide deformylase [Escherichia coli S88]
 gi|218691573|ref|YP_002399785.1| peptide deformylase [Escherichia coli ED1a]
 gi|218696979|ref|YP_002404646.1| peptide deformylase [Escherichia coli 55989]
 gi|218706894|ref|YP_002414413.1| peptide deformylase [Escherichia coli UMN026]
 gi|227883418|ref|ZP_04001223.1| peptide deformylase [Escherichia coli 83972]
 gi|237703016|ref|ZP_04533497.1| peptide deformylase [Escherichia sp. 3_2_53FAA]
 gi|238902377|ref|YP_002928173.1| peptide deformylase [Escherichia coli BW2952]
 gi|253771890|ref|YP_003034721.1| peptide deformylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254038447|ref|ZP_04872503.1| peptide deformylase [Escherichia sp. 1_1_43]
 gi|254163214|ref|YP_003046322.1| peptide deformylase [Escherichia coli B str. REL606]
 gi|254795223|ref|YP_003080060.1| peptide deformylase [Escherichia coli O157:H7 str. TW14359]
 gi|256020645|ref|ZP_05434510.1| peptide deformylase [Shigella sp. D9]
 gi|256025986|ref|ZP_05439851.1| peptide deformylase [Escherichia sp. 4_1_40B]
 gi|260846084|ref|YP_003223862.1| peptide deformylase [Escherichia coli O103:H2 str. 12009]
 gi|261224591|ref|ZP_05938872.1| peptide deformylase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254515|ref|ZP_05947048.1| peptide deformylase [Escherichia coli O157:H7 str. FRIK966]
 gi|293406884|ref|ZP_06650808.1| peptide deformylase [Escherichia coli FVEC1412]
 gi|293412705|ref|ZP_06655373.1| peptide deformylase [Escherichia coli B354]
 gi|293416705|ref|ZP_06659342.1| peptide deformylase [Escherichia coli B185]
 gi|293453605|ref|ZP_06664024.1| peptide deformylase [Escherichia coli B088]
 gi|297517904|ref|ZP_06936290.1| peptide deformylase [Escherichia coli OP50]
 gi|298382625|ref|ZP_06992220.1| def [Escherichia coli FVEC1302]
 gi|300815503|ref|ZP_07095728.1| peptide deformylase [Escherichia coli MS 107-1]
 gi|300896634|ref|ZP_07115151.1| peptide deformylase [Escherichia coli MS 198-1]
 gi|300903535|ref|ZP_07121457.1| peptide deformylase [Escherichia coli MS 84-1]
 gi|300918261|ref|ZP_07134865.1| peptide deformylase [Escherichia coli MS 115-1]
 gi|300921905|ref|ZP_07138060.1| peptide deformylase [Escherichia coli MS 182-1]
 gi|300932179|ref|ZP_07147459.1| peptide deformylase [Escherichia coli MS 187-1]
 gi|300973966|ref|ZP_07172373.1| peptide deformylase [Escherichia coli MS 200-1]
 gi|300979823|ref|ZP_07174725.1| peptide deformylase [Escherichia coli MS 45-1]
 gi|301018856|ref|ZP_07183095.1| peptide deformylase [Escherichia coli MS 69-1]
 gi|301021204|ref|ZP_07185238.1| peptide deformylase [Escherichia coli MS 196-1]
 gi|301046057|ref|ZP_07193236.1| peptide deformylase [Escherichia coli MS 185-1]
 gi|301305496|ref|ZP_07211588.1| peptide deformylase [Escherichia coli MS 124-1]
 gi|301325148|ref|ZP_07218680.1| peptide deformylase [Escherichia coli MS 78-1]
 gi|301643894|ref|ZP_07243924.1| peptide deformylase [Escherichia coli MS 146-1]
 gi|306816371|ref|ZP_07450509.1| peptide deformylase [Escherichia coli NC101]
 gi|307139969|ref|ZP_07499325.1| peptide deformylase [Escherichia coli H736]
 gi|307315135|ref|ZP_07594718.1| peptide deformylase [Escherichia coli W]
 gi|309794562|ref|ZP_07688984.1| peptide deformylase [Escherichia coli MS 145-7]
 gi|312968388|ref|ZP_07782598.1| peptide deformylase [Escherichia coli 2362-75]
 gi|312972452|ref|ZP_07786626.1| peptide deformylase [Escherichia coli 1827-70]
 gi|331643982|ref|ZP_08345111.1| peptide deformylase [Escherichia coli H736]
 gi|331649083|ref|ZP_08350169.1| peptide deformylase [Escherichia coli M605]
 gi|331654879|ref|ZP_08355878.1| peptide deformylase [Escherichia coli M718]
 gi|331659577|ref|ZP_08360515.1| peptide deformylase [Escherichia coli TA206]
 gi|331664899|ref|ZP_08365800.1| peptide deformylase [Escherichia coli TA143]
 gi|331670116|ref|ZP_08370955.1| peptide deformylase [Escherichia coli TA271]
 gi|331679355|ref|ZP_08380025.1| peptide deformylase [Escherichia coli H591]
 gi|332281841|ref|ZP_08394254.1| peptide deformylase [Shigella sp. D9]
 gi|62288071|sp|P0A6K3|DEF_ECOLI RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|62288072|sp|P0A6K4|DEF_ECOL6 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|62288073|sp|P0A6K5|DEF_ECO57 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|122990717|sp|Q1R646|DEF_ECOUT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123048786|sp|Q0TCH5|DEF_ECOL5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123728325|sp|Q31VZ0|DEF_SHIBS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123769545|sp|Q32B63|DEF_SHIDS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|158512616|sp|A1AGH8|DEF_ECOK1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|167012062|sp|A8A591|DEF_ECOHS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189083070|sp|B1IQ13|DEF_ECOLC RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|229487486|sp|B1X6D9|DEF_ECODH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238058209|sp|B6I200|DEF_ECOSE RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238058220|sp|B5YT06|DEF_ECO5E RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767581|sp|B7UK10|DEF_ECO27 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767582|sp|B7MCQ2|DEF_ECO45 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767583|sp|B7LHY3|DEF_ECO55 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767585|sp|B7N171|DEF_ECO81 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767586|sp|B7M0Z2|DEF_ECO8A RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767587|sp|B7NDQ8|DEF_ECOLU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767589|sp|B7LRQ3|DEF_ESCF3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|259645179|sp|C4ZUE1|DEF_ECOBW RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|266618787|pdb|3K6L|A Chain A, The Structure Of E.Coli Peptide Deformylase (Pdf) In
           Complex With Peptidomimetic Ligand Bb2827
 gi|266618788|pdb|3K6L|B Chain B, The Structure Of E.Coli Peptide Deformylase (Pdf) In
           Complex With Peptidomimetic Ligand Bb2827
 gi|266618789|pdb|3K6L|C Chain C, The Structure Of E.Coli Peptide Deformylase (Pdf) In
           Complex With Peptidomimetic Ligand Bb2827
 gi|12517916|gb|AAG58408.1|AE005556_1 peptide deformylase [Escherichia coli O157:H7 str. EDL933]
 gi|26110299|gb|AAN82485.1|AE016767_245 Peptide deformylase [Escherichia coli CFT073]
 gi|41474|emb|CAA45206.1| fms [Escherichia coli K-12]
 gi|443989|emb|CAA54367.1| N-formylmethionylaminoacyl-tRNA deformylase [Escherichia coli K-12]
 gi|471304|emb|CAA54826.1| deformylase [Escherichia coli]
 gi|606221|gb|AAA58084.1| N-formylmethionylaminoacyl-tRNA deformylase [Escherichia coli str.
           K-12 substr. MG1655]
 gi|1789682|gb|AAC76312.1| peptide deformylase [Escherichia coli str. K-12 substr. MG1655]
 gi|13363625|dbj|BAB37575.1| peptide deformylase [Escherichia coli O157:H7 str. Sakai]
 gi|81242732|gb|ABB63442.1| peptide deformylase [Shigella dysenteriae Sd197]
 gi|81247060|gb|ABB67768.1| peptide deformylase [Shigella boydii Sb227]
 gi|85676755|dbj|BAE78005.1| peptide deformylase [Escherichia coli str. K12 substr. W3110]
 gi|91074287|gb|ABE09168.1| peptide deformylase [Escherichia coli UTI89]
 gi|110345117|gb|ABG71354.1| peptide deformylase [Escherichia coli 536]
 gi|115514693|gb|ABJ02768.1| peptide deformylase [Escherichia coli APEC O1]
 gi|157068440|gb|ABV07695.1| peptide deformylase [Escherichia coli HS]
 gi|157078168|gb|ABV17876.1| peptide deformylase [Escherichia coli E24377A]
 gi|169753406|gb|ACA76105.1| peptide deformylase [Escherichia coli ATCC 8739]
 gi|169890642|gb|ACB04349.1| peptide deformylase [Escherichia coli str. K-12 substr. DH10B]
 gi|170121568|gb|EDS90499.1| peptide deformylase [Escherichia albertii TW07627]
 gi|187766994|gb|EDU30838.1| peptide deformylase [Escherichia coli O157:H7 str. EC4196]
 gi|188013857|gb|EDU51979.1| peptide deformylase [Escherichia coli O157:H7 str. EC4113]
 gi|188998869|gb|EDU67855.1| peptide deformylase [Escherichia coli O157:H7 str. EC4076]
 gi|189354695|gb|EDU73114.1| peptide deformylase [Escherichia coli O157:H7 str. EC4401]
 gi|189361833|gb|EDU80252.1| peptide deformylase [Escherichia coli O157:H7 str. EC4486]
 gi|189365123|gb|EDU83539.1| peptide deformylase [Escherichia coli O157:H7 str. EC4501]
 gi|189374112|gb|EDU92528.1| peptide deformylase [Escherichia coli O157:H7 str. EC869]
 gi|190900649|gb|EDV60449.1| peptide deformylase [Escherichia coli B7A]
 gi|190905264|gb|EDV64902.1| peptide deformylase [Escherichia coli F11]
 gi|192925865|gb|EDV80515.1| peptide deformylase [Escherichia coli E22]
 gi|192955132|gb|EDV85626.1| peptide deformylase [Escherichia coli E110019]
 gi|194411672|gb|EDX27999.1| peptide deformylase [Escherichia coli B171]
 gi|194416692|gb|EDX32823.1| peptide deformylase [Shigella dysenteriae 1012]
 gi|194421049|gb|EDX37078.1| peptide deformylase [Escherichia coli 101-1]
 gi|208726295|gb|EDZ75896.1| peptide deformylase [Escherichia coli O157:H7 str. EC4206]
 gi|208735870|gb|EDZ84557.1| peptide deformylase [Escherichia coli O157:H7 str. EC4045]
 gi|208741536|gb|EDZ89218.1| peptide deformylase [Escherichia coli O157:H7 str. EC4042]
 gi|209161761|gb|ACI39194.1| peptide deformylase [Escherichia coli O157:H7 str. EC4115]
 gi|209757358|gb|ACI76991.1| peptide deformylase [Escherichia coli]
 gi|209757360|gb|ACI76992.1| peptide deformylase [Escherichia coli]
 gi|209757362|gb|ACI76993.1| peptide deformylase [Escherichia coli]
 gi|209757366|gb|ACI76995.1| peptide deformylase [Escherichia coli]
 gi|209914011|dbj|BAG79085.1| polypeptide deformylase [Escherichia coli SE11]
 gi|215266658|emb|CAS11097.1| peptide deformylase [Escherichia coli O127:H6 str. E2348/69]
 gi|217321336|gb|EEC29760.1| peptide deformylase [Escherichia coli O157:H7 str. TW14588]
 gi|218353711|emb|CAU99982.1| peptide deformylase [Escherichia coli 55989]
 gi|218358103|emb|CAQ90750.1| peptide deformylase [Escherichia fergusonii ATCC 35469]
 gi|218362612|emb|CAR00238.1| peptide deformylase [Escherichia coli IAI1]
 gi|218367117|emb|CAR04891.1| peptide deformylase [Escherichia coli S88]
 gi|218429137|emb|CAR10089.2| peptide deformylase [Escherichia coli ED1a]
 gi|218433991|emb|CAR14908.1| peptide deformylase [Escherichia coli UMN026]
 gi|222034995|emb|CAP77738.1| Peptide deformylase [Escherichia coli LF82]
 gi|226838953|gb|EEH70976.1| peptide deformylase [Escherichia sp. 1_1_43]
 gi|226902280|gb|EEH88539.1| peptide deformylase [Escherichia sp. 3_2_53FAA]
 gi|227839562|gb|EEJ50028.1| peptide deformylase [Escherichia coli 83972]
 gi|238861987|gb|ACR63985.1| peptide deformylase [Escherichia coli BW2952]
 gi|242378813|emb|CAQ33605.1| peptide deformylase [Escherichia coli BL21(DE3)]
 gi|253322934|gb|ACT27536.1| peptide deformylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975115|gb|ACT40786.1| peptide deformylase [Escherichia coli B str. REL606]
 gi|253979271|gb|ACT44941.1| peptide deformylase [Escherichia coli BL21(DE3)]
 gi|254594623|gb|ACT73984.1| peptide deformylase [Escherichia coli O157:H7 str. TW14359]
 gi|257761231|dbj|BAI32728.1| peptide deformylase [Escherichia coli O103:H2 str. 12009]
 gi|260447695|gb|ACX38117.1| peptide deformylase [Escherichia coli DH1]
 gi|281180321|dbj|BAI56651.1| polypeptide deformylase [Escherichia coli SE15]
 gi|284923293|emb|CBG36387.1| polypeptide deformylase [Escherichia coli 042]
 gi|291321731|gb|EFE61162.1| peptide deformylase [Escherichia coli B088]
 gi|291425695|gb|EFE98729.1| peptide deformylase [Escherichia coli FVEC1412]
 gi|291431281|gb|EFF04266.1| peptide deformylase [Escherichia coli B185]
 gi|291468352|gb|EFF10845.1| peptide deformylase [Escherichia coli B354]
 gi|294491738|gb|ADE90494.1| peptide deformylase [Escherichia coli IHE3034]
 gi|298276461|gb|EFI17979.1| def [Escherichia coli FVEC1302]
 gi|299881612|gb|EFI89823.1| peptide deformylase [Escherichia coli MS 196-1]
 gi|300301942|gb|EFJ58327.1| peptide deformylase [Escherichia coli MS 185-1]
 gi|300308976|gb|EFJ63496.1| peptide deformylase [Escherichia coli MS 200-1]
 gi|300359511|gb|EFJ75381.1| peptide deformylase [Escherichia coli MS 198-1]
 gi|300399513|gb|EFJ83051.1| peptide deformylase [Escherichia coli MS 69-1]
 gi|300404408|gb|EFJ87946.1| peptide deformylase [Escherichia coli MS 84-1]
 gi|300409429|gb|EFJ92967.1| peptide deformylase [Escherichia coli MS 45-1]
 gi|300414522|gb|EFJ97832.1| peptide deformylase [Escherichia coli MS 115-1]
 gi|300421706|gb|EFK05017.1| peptide deformylase [Escherichia coli MS 182-1]
 gi|300460063|gb|EFK23556.1| peptide deformylase [Escherichia coli MS 187-1]
 gi|300532395|gb|EFK53457.1| peptide deformylase [Escherichia coli MS 107-1]
 gi|300839191|gb|EFK66951.1| peptide deformylase [Escherichia coli MS 124-1]
 gi|300847980|gb|EFK75740.1| peptide deformylase [Escherichia coli MS 78-1]
 gi|301077737|gb|EFK92543.1| peptide deformylase [Escherichia coli MS 146-1]
 gi|305850767|gb|EFM51224.1| peptide deformylase [Escherichia coli NC101]
 gi|306905484|gb|EFN36019.1| peptide deformylase [Escherichia coli W]
 gi|307555374|gb|ADN48149.1| peptide deformylase [Escherichia coli ABU 83972]
 gi|307628321|gb|ADN72625.1| peptide deformylase [Escherichia coli UM146]
 gi|308121612|gb|EFO58874.1| peptide deformylase [Escherichia coli MS 145-7]
 gi|309703698|emb|CBJ03039.1| polypeptide deformylase [Escherichia coli ETEC H10407]
 gi|310334829|gb|EFQ01034.1| peptide deformylase [Escherichia coli 1827-70]
 gi|312287213|gb|EFR15123.1| peptide deformylase [Escherichia coli 2362-75]
 gi|312947837|gb|ADR28664.1| peptide deformylase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315062578|gb|ADT76905.1| peptide deformylase [Escherichia coli W]
 gi|315137862|dbj|BAJ45021.1| peptide deformylase [Escherichia coli DH1]
 gi|315255870|gb|EFU35838.1| peptide deformylase [Escherichia coli MS 85-1]
 gi|315284579|gb|EFU44024.1| peptide deformylase [Escherichia coli MS 110-3]
 gi|315292338|gb|EFU51690.1| peptide deformylase [Escherichia coli MS 153-1]
 gi|315297152|gb|EFU56432.1| peptide deformylase [Escherichia coli MS 16-3]
 gi|315617089|gb|EFU97699.1| peptide deformylase [Escherichia coli 3431]
 gi|320173931|gb|EFW49107.1| Peptide deformylase [Shigella dysenteriae CDC 74-1112]
 gi|320182716|gb|EFW57602.1| Peptide deformylase [Shigella boydii ATCC 9905]
 gi|320187008|gb|EFW61720.1| Peptide deformylase [Shigella flexneri CDC 796-83]
 gi|320191679|gb|EFW66329.1| Peptide deformylase [Escherichia coli O157:H7 str. EC1212]
 gi|320195378|gb|EFW70005.1| Peptide deformylase [Escherichia coli WV_060327]
 gi|320199474|gb|EFW74064.1| Peptide deformylase [Escherichia coli EC4100B]
 gi|320639591|gb|EFX09185.1| peptide deformylase [Escherichia coli O157:H7 str. G5101]
 gi|320645089|gb|EFX14105.1| peptide deformylase [Escherichia coli O157:H- str. 493-89]
 gi|320650400|gb|EFX18866.1| peptide deformylase [Escherichia coli O157:H- str. H 2687]
 gi|320655925|gb|EFX23845.1| peptide deformylase [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320666399|gb|EFX33382.1| peptide deformylase [Escherichia coli O157:H7 str. LSU-61]
 gi|323162965|gb|EFZ48800.1| peptide deformylase [Escherichia coli E128010]
 gi|323182765|gb|EFZ68166.1| peptide deformylase [Escherichia coli 1357]
 gi|323189108|gb|EFZ74392.1| peptide deformylase [Escherichia coli RN587/1]
 gi|323376835|gb|ADX49103.1| peptide deformylase [Escherichia coli KO11]
 gi|323934515|gb|EGB30923.1| peptide deformylase [Escherichia coli E1520]
 gi|323939292|gb|EGB35504.1| peptide deformylase [Escherichia coli E482]
 gi|323944293|gb|EGB40369.1| peptide deformylase [Escherichia coli H120]
 gi|323950200|gb|EGB46082.1| peptide deformylase [Escherichia coli H252]
 gi|323954591|gb|EGB50374.1| peptide deformylase [Escherichia coli H263]
 gi|323966248|gb|EGB61683.1| peptide deformylase [Escherichia coli M863]
 gi|323970090|gb|EGB65364.1| peptide deformylase [Escherichia coli TA007]
 gi|323974761|gb|EGB69874.1| peptide deformylase [Escherichia coli TW10509]
 gi|324009052|gb|EGB78271.1| peptide deformylase [Escherichia coli MS 57-2]
 gi|324014963|gb|EGB84182.1| peptide deformylase [Escherichia coli MS 60-1]
 gi|324111965|gb|EGC05944.1| peptide deformylase [Escherichia fergusonii B253]
 gi|324116324|gb|EGC10244.1| peptide deformylase [Escherichia coli E1167]
 gi|326342535|gb|EGD66309.1| Peptide deformylase [Escherichia coli O157:H7 str. 1044]
 gi|326344522|gb|EGD68271.1| Peptide deformylase [Escherichia coli O157:H7 str. 1125]
 gi|327250935|gb|EGE62628.1| peptide deformylase [Escherichia coli STEC_7v]
 gi|330909331|gb|EGH37845.1| peptide deformylase [Escherichia coli AA86]
 gi|331036276|gb|EGI08502.1| peptide deformylase [Escherichia coli H736]
 gi|331041581|gb|EGI13725.1| peptide deformylase [Escherichia coli M605]
 gi|331046894|gb|EGI18972.1| peptide deformylase [Escherichia coli M718]
 gi|331052792|gb|EGI24825.1| peptide deformylase [Escherichia coli TA206]
 gi|331057409|gb|EGI29395.1| peptide deformylase [Escherichia coli TA143]
 gi|331062178|gb|EGI34098.1| peptide deformylase [Escherichia coli TA271]
 gi|331072527|gb|EGI43852.1| peptide deformylase [Escherichia coli H591]
 gi|332085435|gb|EGI90601.1| peptide deformylase [Shigella boydii 5216-82]
 gi|332086260|gb|EGI91416.1| peptide deformylase [Shigella dysenteriae 155-74]
 gi|332090315|gb|EGI95413.1| peptide deformylase [Shigella boydii 3594-74]
 gi|332104193|gb|EGJ07539.1| peptide deformylase [Shigella sp. D9]
 gi|332345234|gb|AEE58568.1| peptide deformylase [Escherichia coli UMNK88]
          Length = 169

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|161506040|ref|YP_001573152.1| peptide deformylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189083077|sp|A9MN80|DEF_SALAR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|160867387|gb|ABX24010.1| hypothetical protein SARI_04221 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 169

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + ADG
Sbjct: 67  RNERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|91205375|ref|YP_537730.1| peptide deformylase [Rickettsia bellii RML369-C]
 gi|91068919|gb|ABE04641.1| Polypeptide deformylase [Rickettsia bellii RML369-C]
          Length = 175

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 110/166 (66%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+ + ++N+ I   +D+M+E MY  DG GLAAVQ+GVL R++VID++
Sbjct: 5   PIVTVPDERLKQKSQAVLEVNNQIRKFMDDMVETMYHEDGGGLAAVQVGVLKRIMVIDIK 64

Query: 65  DHAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   K P  F     +NP+II  S++  +  EGC+S+P+ R ++ RS  I +RY+D + 
Sbjct: 65  DHDPIKRPKDFYPLFIVNPEIIEKSEELVIANEGCISVPEQRYEIARSESIKIRYLDYHN 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS +KRD+  +K+ KL
Sbjct: 125 KPQELEANDWLARVIQHEYDHLEGKLMIDYLSSMKRDIALRKLRKL 170


>gi|16272565|ref|NP_438782.1| peptide deformylase [Haemophilus influenzae Rd KW20]
 gi|260581531|ref|ZP_05849338.1| peptide deformylase [Haemophilus influenzae RdAW]
 gi|1169264|sp|P44786|DEF_HAEIN RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|1573618|gb|AAC22282.1| polypeptide deformylase (def) [Haemophilus influenzae Rd KW20]
 gi|260091805|gb|EEW75761.1| peptide deformylase [Haemophilus influenzae RdAW]
          Length = 169

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ K+N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVTKVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIK 161


>gi|261250604|ref|ZP_05943179.1| peptide deformylase [Vibrio orientalis CIP 102891]
 gi|260939173|gb|EEX95160.1| peptide deformylase [Vibrio orientalis CIP 102891]
          Length = 172

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEAVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ ++ + +     
Sbjct: 66  T--RDEPMVLINPEILEKRGEDGI-EEGCLSVPGARALVSRAAEVTVKALNRDGEEFTFE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|293393278|ref|ZP_06637592.1| peptide deformylase [Serratia odorifera DSM 4582]
 gi|291424188|gb|EFE97403.1| peptide deformylase [Serratia odorifera DSM 4582]
          Length = 169

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 111/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+V+ P++++N+DI  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRKVAAPVKEVNADIQRIVDDMFDTMYAEEGIGLAATQVDIHQRIIVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D N     + AD 
Sbjct: 67  RDQRLVLINPELLEQSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDYNGNSFELAADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKLQ 166


>gi|323173923|gb|EFZ59551.1| peptide deformylase [Escherichia coli LT-68]
 gi|325498855|gb|EGC96714.1| hypothetical protein ECD227_2952 [Escherichia fergusonii ECD227]
          Length = 164

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 4   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 61

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 62  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 120

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 121 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 161


>gi|71064611|ref|YP_263338.1| peptide deformylase [Psychrobacter arcticus 273-4]
 gi|123734488|sp|Q4FVQ4|DEF_PSYA2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|71037596|gb|AAZ17904.1| peptide deformylase [Psychrobacter arcticus 273-4]
          Length = 184

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR ++ P++++ ++I  LI +M+E MY  +GIGLAA Q+    +L+V+DL 
Sbjct: 5   PILSYPDPRLRMIATPVKEVTAEIKTLITDMIETMYDAEGIGLAASQVDHHIQLIVMDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   + +P VFINPK+    ++   Y+EGCLS+PD    V+R   + +  +D N      
Sbjct: 65  ED--KDSPRVFINPKVTPLVEEKQPYEEGCLSVPDVYDKVERPNKVRIEAIDQNGNAIDE 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
             +GLLA C+QHE+DHLNG++F+D+LSRLK+     K+ K++++R+
Sbjct: 123 EVEGLLAVCIQHEIDHLNGVIFVDYLSRLKQTRARDKVRKVLKIRE 168


>gi|329890845|ref|ZP_08269188.1| peptide deformylase [Brevundimonas diminuta ATCC 11568]
 gi|328846146|gb|EGF95710.1| peptide deformylase [Brevundimonas diminuta ATCC 11568]
          Length = 190

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 105/172 (61%), Gaps = 16/172 (9%)

Query: 13  ILRRVSRPIEKINSD-IMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA---- 67
           IL+ V+ P+E   +D +  L+D+MLE MY   GIGLAA QIG L R+VV+DL D      
Sbjct: 17  ILKTVAAPVEGGVTDAVRALMDDMLETMYDAPGIGLAAPQIGELTRVVVMDLGDKPVEGA 76

Query: 68  -----------HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                       R+NP  F+NP+I+  S++   Y+EGCLS+P Y   V+R A + VRYM+
Sbjct: 77  SDEPQTEEEALERRNPRFFVNPEILWSSEEMFSYEEGCLSVPTYYDSVERPARVRVRYMN 136

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
              +      +GL A C QHELDHLNG+LFIDHLSRL+RD    K+ K  ++
Sbjct: 137 YQGETIEEEIEGLYAVCFQHELDHLNGVLFIDHLSRLRRDRAVSKVKKHARM 188


>gi|258545465|ref|ZP_05705699.1| peptide deformylase [Cardiobacterium hominis ATCC 15826]
 gi|258519298|gb|EEV88157.1| peptide deformylase [Cardiobacterium hominis ATCC 15826]
          Length = 184

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 104/172 (60%), Gaps = 15/172 (8%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I PD  LR+ + P+ +  + +  + DNM   MY   GIGLAA Q+ +  R+VV+D+ +
Sbjct: 6   ILIHPDRRLRKTAEPVSQFTNALKTITDNMFATMYEAHGIGLAATQVNIHQRIVVMDVPE 65

Query: 66  H-------------AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
                          H K  +V INP+II  S++ + +QEGCLS+P   ADV+R A I  
Sbjct: 66  RREDDETETPDAPIPHTK--LVLINPEIIATSEETASWQEGCLSLPGQFADVERPAKIRY 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Y D         A+GLL  C+QHE+DHLNG+LFIDHLSRLKR+ + KK++K
Sbjct: 124 AYYDLGGSRCEGEAEGLLGVCIQHEIDHLNGVLFIDHLSRLKRERLEKKLAK 175


>gi|237728621|ref|ZP_04559102.1| peptide deformylase [Citrobacter sp. 30_2]
 gi|283835704|ref|ZP_06355445.1| hypothetical protein CIT292_10096 [Citrobacter youngae ATCC 29220]
 gi|226909243|gb|EEH95161.1| peptide deformylase [Citrobacter sp. 30_2]
 gi|291068383|gb|EFE06492.1| peptide deformylase [Citrobacter youngae ATCC 29220]
          Length = 169

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++   D  +  +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDEQLVLINPELLE-KDGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKSFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|322831106|ref|YP_004211133.1| peptide deformylase [Rahnella sp. Y9602]
 gi|321166307|gb|ADW72006.1| peptide deformylase [Rahnella sp. Y9602]
          Length = 170

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRITAKPVKEVNAEIQQIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIPD RA V R+  + +R +D + +   + AD 
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPDQRALVPRAEKVKIRALDRDGKTFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +KM K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKMEKMAKL 165


>gi|16766695|ref|NP_462310.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56415326|ref|YP_152401.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62181912|ref|YP_218329.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161616432|ref|YP_001590397.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167554203|ref|ZP_02347944.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167995181|ref|ZP_02576271.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168239761|ref|ZP_02664819.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168245233|ref|ZP_02670165.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168264713|ref|ZP_02686686.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168468037|ref|ZP_02701874.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168823236|ref|ZP_02835236.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194444564|ref|YP_002042658.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194451296|ref|YP_002047431.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194734454|ref|YP_002116350.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248664|ref|YP_002148327.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197265509|ref|ZP_03165583.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197364256|ref|YP_002143893.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198245506|ref|YP_002217370.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|200388386|ref|ZP_03214998.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205354966|ref|YP_002228767.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858648|ref|YP_002245299.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|238913879|ref|ZP_04657716.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|23396546|sp|Q8ZLM7|DEF_SALTY RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|75505525|sp|Q57J64|DEF_SALCH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|81677960|sp|Q5PIT8|DEF_SALPA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189083078|sp|A9N8B1|DEF_SALPB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690058|sp|B5F7R3|DEF_SALA4 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690317|sp|B5FJI2|DEF_SALDC RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690438|sp|B5R1E3|DEF_SALEP RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690545|sp|B5RH49|DEF_SALG2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690672|sp|B4TJX7|DEF_SALHS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690738|sp|B5BGV3|DEF_SALPK RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238693518|sp|B4SUQ8|DEF_SALNS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238693718|sp|B4TXB0|DEF_SALSV RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|16421962|gb|AAL22269.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56129583|gb|AAV79089.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62129545|gb|AAX67248.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161365796|gb|ABX69564.1| hypothetical protein SPAB_04247 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403227|gb|ACF63449.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194409600|gb|ACF69819.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194709956|gb|ACF89177.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628902|gb|EDX48312.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095733|emb|CAR61303.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197212367|gb|ACH49764.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197243764|gb|EDY26384.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197287582|gb|EDY26974.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197940022|gb|ACH77355.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199605484|gb|EDZ04029.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205274747|emb|CAR39803.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205321541|gb|EDZ09380.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205327093|gb|EDZ13857.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205336019|gb|EDZ22783.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205340500|gb|EDZ27264.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205346889|gb|EDZ33520.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206710451|emb|CAR34809.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261248563|emb|CBG26401.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995615|gb|ACY90500.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159949|emb|CBW19468.1| polypeptide deformylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914429|dbj|BAJ38403.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320087852|emb|CBY97615.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226458|gb|EFX51508.1| Peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322615053|gb|EFY11977.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322617340|gb|EFY14241.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625562|gb|EFY22387.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626404|gb|EFY23213.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632084|gb|EFY28837.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635037|gb|EFY31760.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322643262|gb|EFY39829.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322646654|gb|EFY43161.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322650000|gb|EFY46419.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322652717|gb|EFY49057.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322659526|gb|EFY55770.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322665532|gb|EFY61719.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322670426|gb|EFY66565.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322670499|gb|EFY66633.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675075|gb|EFY71158.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681612|gb|EFY77641.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322685956|gb|EFY81945.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|322716398|gb|EFZ07969.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323131764|gb|ADX19194.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323195826|gb|EFZ80999.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323196418|gb|EFZ81569.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202703|gb|EFZ87742.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207308|gb|EFZ92258.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211256|gb|EFZ96101.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323216035|gb|EGA00766.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323223474|gb|EGA07802.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226796|gb|EGA10986.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231842|gb|EGA15952.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323233205|gb|EGA17300.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323237272|gb|EGA21337.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245507|gb|EGA29506.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249013|gb|EGA32935.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323250636|gb|EGA34517.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323256865|gb|EGA40579.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263014|gb|EGA46561.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266014|gb|EGA49509.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323272771|gb|EGA56174.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326625151|gb|EGE31496.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326630115|gb|EGE36458.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332990258|gb|AEF09241.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 169

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|283852905|ref|ZP_06370166.1| peptide deformylase [Desulfovibrio sp. FW1012B]
 gi|283571734|gb|EFC19733.1| peptide deformylase [Desulfovibrio sp. FW1012B]
          Length = 175

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 100/159 (62%), Gaps = 1/159 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +P P L + + P+ +I  +I  L   M E MY+  GIGLAA Q+G   RLVVIDL     
Sbjct: 8   YPHPTLAQKAAPVTEITPEIRELAAAMAETMYANQGIGLAAPQVGRSIRLVVIDLSGPDK 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  M  +NP +IT        +EGCLS+ DYR +V R+A +TV+  D +     + ADG
Sbjct: 68  REGLMTLVNP-VITDPAGEEEDEEGCLSVRDYRTNVVRAATVTVKATDLDGNPFCLEADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA CLQHE+DHL+G+LFIDH+SRLKR M  K++ +  +
Sbjct: 127 LLAVCLQHEIDHLDGVLFIDHISRLKRAMYDKRVKRWAR 165


>gi|320105840|ref|YP_004181430.1| peptide deformylase [Terriglobus saanensis SP1PR4]
 gi|319924361|gb|ADV81436.1| peptide deformylase [Terriglobus saanensis SP1PR4]
          Length = 169

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/162 (40%), Positives = 103/162 (63%), Gaps = 1/162 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPDP+L +V+ P+   +  +  L+D+M   MY+ +GIGLAA QI +  R+ +IDL  
Sbjct: 5   IIKFPDPVLEKVAEPVTLFDDSLKKLVDDMFASMYAAEGIGLAAPQINISRRITIIDLSF 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
               +  +V INP++I         +EGCLS+PD R  V R+A++ VR  D   +H  + 
Sbjct: 65  QKRPEEKIVLINPEVIAVEGK-QHEEEGCLSLPDIREKVTRAAWVKVRAQDATGKHFEVE 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              LLA   QHE+DHLNGILFI  +SRLKRD++++++ K+++
Sbjct: 124 GTELLARAFQHEIDHLNGILFISKISRLKRDLVSRRIRKMMK 165


>gi|329118894|ref|ZP_08247589.1| peptide deformylase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464922|gb|EGF11212.1| peptide deformylase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 167

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 102/156 (65%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+EKI++ I  LI +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEKIDARIKTLIADMFETMYEARGIGLAATQVDVHERVVVMDLSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +IT  +  + Y+EGCLS+P     V R+  +TV  ++ N +   + ADG
Sbjct: 67  RNEPRVFINP-VITHKNGETTYEEGCLSVPGIYDTVTRAETVTVEALNENGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVERLSQLKQGRIRTKLKK 161


>gi|320539229|ref|ZP_08038900.1| peptide deformylase [Serratia symbiotica str. Tucson]
 gi|320030867|gb|EFW12875.1| peptide deformylase [Serratia symbiotica str. Tucson]
          Length = 169

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 113/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+++ P++++N+DI  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDDRLRKIAAPVKEVNADIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDISNN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLS+P+ RA V R+A + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSLPEQRALVPRAANVKIRALDFDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|34580779|ref|ZP_00142259.1| polypeptide deformylase [Rickettsia sibirica 246]
 gi|28262164|gb|EAA25668.1| polypeptide deformylase [Rickettsia sibirica 246]
          Length = 176

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 108/166 (65%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID+Q
Sbjct: 6   PIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGAGLAAVQVGVLKRILVIDIQ 65

Query: 65  DH---AHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   A  K+  P+  +NP+II  +++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 66  DHDSVARPKDFYPLFIVNPEIIEKAEELVTANEGCISLPEQRIEVARPESIKIRYLDYHG 125

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 126 KSQELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 171


>gi|259909966|ref|YP_002650322.1| peptide deformylase [Erwinia pyrifoliae Ep1/96]
 gi|224965588|emb|CAX57120.1| Peptide deformylase [Erwinia pyrifoliae Ep1/96]
 gi|283480066|emb|CAY75982.1| peptide deformylase [Erwinia pyrifoliae DSM 12163]
 gi|310765564|gb|ADP10514.1| peptide deformylase [Erwinia sp. Ejp617]
          Length = 169

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/157 (44%), Positives = 110/157 (70%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P++++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRIVAKPVKEVNANIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNSVELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LFID+LS +KR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPMKRQRIRQKLEKL 162


>gi|300822910|ref|ZP_07103046.1| peptide deformylase [Escherichia coli MS 119-7]
 gi|300524676|gb|EFK45745.1| peptide deformylase [Escherichia coli MS 119-7]
          Length = 169

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKLKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|157828155|ref|YP_001494397.1| peptide deformylase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|238650436|ref|YP_002916288.1| peptide deformylase [Rickettsia peacockii str. Rustic]
 gi|157800636|gb|ABV75889.1| peptide deformylase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|238624534|gb|ACR47240.1| peptide deformylase [Rickettsia peacockii str. Rustic]
          Length = 175

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 108/166 (65%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID+Q
Sbjct: 5   PIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGAGLAAVQVGVLKRILVIDIQ 64

Query: 65  DH---AHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   A  K+  P+  +NP+II  +++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 65  DHDSVARPKDFYPLFIVNPEIIEKAEELVTANEGCISLPEQRIEVARPESIKIRYLDYHG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KSQELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|224585201|ref|YP_002639000.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224469729|gb|ACN47559.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 164

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 4   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 61

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + ADG
Sbjct: 62  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNPFELEADG 120

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 121 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 160


>gi|321472939|gb|EFX83908.1| hypothetical protein DAPPUDRAFT_47755 [Daphnia pulex]
          Length = 166

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 104/154 (67%), Gaps = 5/154 (3%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR 69
           P P+L R S PI+ I++ I   +D+MLE MY++ GIGLAA+Q+G+L R++VIDL + +  
Sbjct: 10  PSPLLHRTSLPIKTIDATIHKALDDMLETMYASSGIGLAAIQVGLLKRMLVIDLGEASES 69

Query: 70  ----KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
                 P+  INP+I+  SD+ + + EGCLS+P +  ++ R A I VRY D   ++  I+
Sbjct: 70  DTWAGKPLKIINPQILWTSDNQNTFNEGCLSVPQHYVEISRPAEIKVRYQDETGKYHEIH 129

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRL-KRDMI 158
           A GLLATCLQHE+DHLNGI  ++   R+ +RD +
Sbjct: 130 AAGLLATCLQHEIDHLNGITILNPPIRISQRDFV 163


>gi|292489813|ref|YP_003532703.1| peptide deformylase [Erwinia amylovora CFBP1430]
 gi|292900855|ref|YP_003540224.1| polypeptide deformylase [Erwinia amylovora ATCC 49946]
 gi|291200703|emb|CBJ47836.1| polypeptide deformylase [Erwinia amylovora ATCC 49946]
 gi|291555250|emb|CBA23521.1| peptide deformylase [Erwinia amylovora CFBP1430]
 gi|312173996|emb|CBX82249.1| peptide deformylase [Erwinia amylovora ATCC BAA-2158]
          Length = 169

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P++++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRIVAKPVKEVNANIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + ADG
Sbjct: 67  RDERLVLINPELLEQSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNSFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHELDHL G LFID+LS +KR  I +K+ KL
Sbjct: 126 LLAICIQHELDHLVGKLFIDYLSPMKRQRIRQKLEKL 162


>gi|83941567|ref|ZP_00954029.1| peptide deformylase [Sulfitobacter sp. EE-36]
 gi|83847387|gb|EAP85262.1| peptide deformylase [Sulfitobacter sp. EE-36]
          Length = 153

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 97/143 (67%), Gaps = 1/143 (0%)

Query: 24  INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-LQDHAHRKNPMVFINPKIIT 82
           +  ++ +L D+ML  MY   GIGLAA QIGV+ RL+V+D +++      P+V  NP+II 
Sbjct: 4   MTDELRSLADDMLATMYDAPGIGLAAPQIGVMNRLIVMDCVKEEGETPRPLVMFNPEIIA 63

Query: 83  FSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLN 142
            SD  + Y+EGCLSIP+  ADV R A + VR++D +   Q      L ATC+QHE+DHL+
Sbjct: 64  ASDALNTYEEGCLSIPEQFADVTRPADVDVRWIDIDGNEQTETFTKLWATCVQHEIDHLD 123

Query: 143 GILFIDHLSRLKRDMITKKMSKL 165
           G LFID+L  +KR MIT+KM+KL
Sbjct: 124 GKLFIDYLKPMKRQMITRKMTKL 146


>gi|157373176|ref|YP_001471776.1| peptide deformylase [Shewanella sediminis HAW-EB3]
 gi|157315550|gb|ABV34648.1| Peptide deformylase [Shewanella sediminis HAW-EB3]
          Length = 170

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/161 (45%), Positives = 100/161 (62%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ + N+D+   IDNM + MY   GIGLAA Q+     L+++DLQD   
Sbjct: 9   FPDERLRTIAKPVAEFNADLQAQIDNMFDTMYEEKGIGLAATQVDFHQHLIIMDLQDDVE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFIN +I T  D     +EGCLS+P   A+V R+  +T++  D       + ADG
Sbjct: 69  R--PTVFINMEI-TARDGSCTNEEGCLSVPGIYANVDRAESVTIKAFDREGVEFTLDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A CLQHELDHLNG LF+D+LS LKR  I +K+ K  +L 
Sbjct: 126 LFAICLQHELDHLNGKLFVDYLSPLKRQRIKQKLEKAARLE 166


>gi|83855044|ref|ZP_00948574.1| peptide deformylase [Sulfitobacter sp. NAS-14.1]
 gi|83842887|gb|EAP82054.1| peptide deformylase [Sulfitobacter sp. NAS-14.1]
          Length = 153

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 97/143 (67%), Gaps = 1/143 (0%)

Query: 24  INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-LQDHAHRKNPMVFINPKIIT 82
           +  ++ +L D+ML  MY   GIGLAA QIGV+ RL+V+D +++      P+V  NP+II 
Sbjct: 4   MTDELRSLADDMLATMYDAPGIGLAAPQIGVMNRLIVMDCVKEEGEAPRPLVMFNPEIIA 63

Query: 83  FSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLN 142
            SD  + Y+EGCLSIP+  ADV R A + VR++D +   Q      L ATC+QHE+DHL+
Sbjct: 64  ASDALNTYEEGCLSIPEQFADVTRPADVDVRWIDIDGNEQTETFTKLWATCVQHEIDHLD 123

Query: 143 GILFIDHLSRLKRDMITKKMSKL 165
           G LFID+L  +KR MIT+KM+KL
Sbjct: 124 GKLFIDYLKPMKRQMITRKMTKL 146


>gi|171057041|ref|YP_001789390.1| peptide deformylase [Leptothrix cholodnii SP-6]
 gi|170774486|gb|ACB32625.1| peptide deformylase [Leptothrix cholodnii SP-6]
          Length = 171

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 105/160 (65%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +++RP+ +++  I  L+ +M E MY   GIGLAA Q+ V  R++VID+ 
Sbjct: 5   PILRYPDPRLNKIARPVIQVDERIRQLVSDMFETMYEARGIGLAATQVDVHERVIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R +P+V INP+I+  S++  V  EGCLS+P     V+R A + V  +D N Q    
Sbjct: 65  EE--RNDPLVLINPRIVAASEEMMVGDEGCLSVPTIYDRVERHAQVQVEALDRNGQRYEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLL+ C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 123 EADGLLSVCVQHEMDHLLGKVFVEYLSPLKRNRIRSKMIK 162


>gi|226329516|ref|ZP_03805034.1| hypothetical protein PROPEN_03425 [Proteus penneri ATCC 35198]
 gi|225202702|gb|EEG85056.1| hypothetical protein PROPEN_03425 [Proteus penneri ATCC 35198]
          Length = 174

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 110/160 (68%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EK++++I  ++D+M E MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRTIAKPVEKVDAEIQKIVDDMFETMYLEEGIGLAATQVNIHQRIIVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  + D  + +EGCLSIP+ RA + R+  + VR +D N Q   + AD 
Sbjct: 67  RDERLVLINPELLDANGDTGI-EEGCLSIPEQRAFIPRAEHVKVRALDYNGQPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKLDKL 165


>gi|187732040|ref|YP_001881970.1| peptide deformylase [Shigella boydii CDC 3083-94]
 gi|238689490|sp|B2U2Q4|DEF_SHIB3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|187429032|gb|ACD08306.1| peptide deformylase [Shigella boydii CDC 3083-94]
          Length = 169

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP  RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPKQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|165932853|ref|YP_001649642.1| peptide deformylase [Rickettsia rickettsii str. Iowa]
 gi|165907940|gb|ABY72236.1| peptide deformylase [Rickettsia rickettsii str. Iowa]
          Length = 175

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 108/166 (65%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID+Q
Sbjct: 5   PIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGAGLAAVQVGVLKRILVIDIQ 64

Query: 65  DH---AHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   A  K+  P+  +NP++I  +++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 65  DHDSVARPKDFYPLFIVNPEVIEKAEELVTANEGCISLPEQRIEVARPESIKIRYLDYHG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KSQELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|157830814|pdb|1DFF|A Chain A, Peptide Deformylase
          Length = 164

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 113/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 8   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 66  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 124

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L
Sbjct: 125 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRL 164


>gi|183600719|ref|ZP_02962212.1| hypothetical protein PROSTU_04315 [Providencia stuartii ATCC 25827]
 gi|188019699|gb|EDU57739.1| hypothetical protein PROSTU_04315 [Providencia stuartii ATCC 25827]
          Length = 174

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 109/161 (67%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EK++++I  ++D+M E MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRTIAKPVEKVDAEIQQIVDDMFETMYEEEGIGLAATQVDIHQRIIVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+    V R+  + VR +D N     + ADG
Sbjct: 67  RDQRLVLINPELLDKSGETGI-EEGCLSIPEQHGFVPRAEHVKVRALDYNGDSFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL ++R
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKLDRMR 166


>gi|157372744|ref|YP_001480733.1| peptide deformylase [Serratia proteamaculans 568]
 gi|167012065|sp|A8GKG5|DEF_SERP5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|157324508|gb|ABV43605.1| peptide deformylase [Serratia proteamaculans 568]
          Length = 169

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 113/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+V+ P++++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   YPDDRLRKVAAPVKEVNANIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+A + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAAAVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|223041757|ref|ZP_03611950.1| peptide deformylase [Actinobacillus minor 202]
 gi|240948040|ref|ZP_04752457.1| peptide deformylase [Actinobacillus minor NM305]
 gi|223017441|gb|EEF15859.1| peptide deformylase [Actinobacillus minor 202]
 gi|240297656|gb|EER48133.1| peptide deformylase [Actinobacillus minor NM305]
          Length = 170

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PD  L +V  P+  ++ ++   ID+M + MY  +GIGLAA Q+ VL R++ ID++ 
Sbjct: 6   VVLYPDENLAKVCEPVAVVDDELNRFIDDMFDTMYEHEGIGLAAPQVDVLKRVITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              + N +V INP+II  S +  + +EGCLSIP +RA V R   + V+ ++   +  +  
Sbjct: 65  -GDKTNQVVLINPEIIESSGETGI-EEGCLSIPGHRALVPRKEKVKVKALNRQGEEVVYD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGL A C+QHE+DHLNGILF+DHLS LKR  I +KM KL
Sbjct: 123 ADGLFAICIQHEIDHLNGILFVDHLSPLKRQRIKEKMVKL 162


>gi|56459130|ref|YP_154411.1| N-formylmethionyl-tRNA deformylase [Idiomarina loihiensis L2TR]
 gi|81678352|sp|Q5QXI5|DEF_IDILO RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|56178140|gb|AAV80862.1| N-formylmethionyl-tRNA deformylase [Idiomarina loihiensis L2TR]
          Length = 174

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 107/168 (63%), Gaps = 3/168 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PD  LR+V++ IEK++ +I ++ID+M E MY   G+GLAA Q+ V  RL V
Sbjct: 1   MAKMTVLQYPDERLRKVAQKIEKVDDNIRSVIDDMFETMYEEQGVGLAATQVDVHRRLFV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D  +  +   P+VFINP+I      F    EGCLS P   A V+R+  ITV  +D N +
Sbjct: 61  SDCSEDQN--EPLVFINPEITEAEGHFK-NDEGCLSFPGVYAKVERAERITVTALDKNGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
                A+GLLA C+QHE+DHL+G LF+D+LS LKR+ I KK+ K  +L
Sbjct: 118 RFSRSAEGLLAICIQHEIDHLDGKLFVDYLSPLKRERIRKKLEKEQRL 165


>gi|309785609|ref|ZP_07680240.1| peptide deformylase [Shigella dysenteriae 1617]
 gi|308926729|gb|EFP72205.1| peptide deformylase [Shigella dysenteriae 1617]
          Length = 169

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+  GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEGGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|24114564|ref|NP_709074.1| peptide deformylase [Shigella flexneri 2a str. 301]
 gi|30064608|ref|NP_838779.1| peptide deformylase [Shigella flexneri 2a str. 2457T]
 gi|74313805|ref|YP_312224.1| peptide deformylase [Shigella sonnei Ss046]
 gi|110807134|ref|YP_690654.1| peptide deformylase [Shigella flexneri 5 str. 8401]
 gi|170680840|ref|YP_001745549.1| peptide deformylase [Escherichia coli SMS-3-5]
 gi|218702049|ref|YP_002409678.1| peptide deformylase [Escherichia coli IAI39]
 gi|260857407|ref|YP_003231298.1| peptide deformylase [Escherichia coli O26:H11 str. 11368]
 gi|260870029|ref|YP_003236431.1| peptide deformylase [Escherichia coli O111:H- str. 11128]
 gi|300935284|ref|ZP_07150295.1| peptide deformylase [Escherichia coli MS 21-1]
 gi|331674794|ref|ZP_08375551.1| peptide deformylase [Escherichia coli TA280]
 gi|331684929|ref|ZP_08385515.1| peptide deformylase [Escherichia coli H299]
 gi|39930879|sp|Q83PZ1|DEF_SHIFL RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|122957164|sp|Q0T016|DEF_SHIF8 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123773439|sp|Q3YWX3|DEF_SHISS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767584|sp|B7NLK6|DEF_ECO7I RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767588|sp|B1LGP3|DEF_ECOSM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|24053759|gb|AAN44781.1| peptide deformylase [Shigella flexneri 2a str. 301]
 gi|30042867|gb|AAP18590.1| peptide deformylase [Shigella flexneri 2a str. 2457T]
 gi|73857282|gb|AAZ89989.1| peptide deformylase [Shigella sonnei Ss046]
 gi|110616682|gb|ABF05349.1| peptide deformylase [Shigella flexneri 5 str. 8401]
 gi|170518558|gb|ACB16736.1| peptide deformylase [Escherichia coli SMS-3-5]
 gi|218372035|emb|CAR19895.1| peptide deformylase [Escherichia coli IAI39]
 gi|257756056|dbj|BAI27558.1| peptide deformylase [Escherichia coli O26:H11 str. 11368]
 gi|257766385|dbj|BAI37880.1| peptide deformylase [Escherichia coli O111:H- str. 11128]
 gi|281602655|gb|ADA75639.1| putative N-formylmethionyl-tRNA deformylase [Shigella flexneri
           2002017]
 gi|300459487|gb|EFK22980.1| peptide deformylase [Escherichia coli MS 21-1]
 gi|323154124|gb|EFZ40327.1| peptide deformylase [Escherichia coli EPECa14]
 gi|323164851|gb|EFZ50642.1| peptide deformylase [Shigella sonnei 53G]
 gi|323179177|gb|EFZ64751.1| peptide deformylase [Escherichia coli 1180]
 gi|331067703|gb|EGI39101.1| peptide deformylase [Escherichia coli TA280]
 gi|331077300|gb|EGI48512.1| peptide deformylase [Escherichia coli H299]
 gi|332749605|gb|EGJ80022.1| peptide deformylase [Shigella flexneri K-671]
 gi|332753999|gb|EGJ84372.1| peptide deformylase [Shigella flexneri 2747-71]
 gi|332996761|gb|EGK16386.1| peptide deformylase [Shigella flexneri K-272]
 gi|332998313|gb|EGK17913.1| peptide deformylase [Shigella flexneri K-218]
 gi|333012534|gb|EGK31915.1| peptide deformylase [Shigella flexneri K-304]
 gi|333014514|gb|EGK33862.1| peptide deformylase [Shigella flexneri K-227]
          Length = 169

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + A+G
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|313648791|gb|EFS13231.1| peptide deformylase [Shigella flexneri 2a str. 2457T]
 gi|332749748|gb|EGJ80163.1| peptide deformylase [Shigella flexneri 4343-70]
 gi|332766530|gb|EGJ96737.1| peptide deformylase [Shigella flexneri 2930-71]
 gi|332998300|gb|EGK17901.1| peptide deformylase [Shigella flexneri VA-6]
          Length = 164

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 4   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 61

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + A+G
Sbjct: 62  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEAEG 120

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 121 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 161


>gi|197287101|ref|YP_002152973.1| peptide deformylase [Proteus mirabilis HI4320]
 gi|227354903|ref|ZP_03839317.1| polypeptide deformylase [Proteus mirabilis ATCC 29906]
 gi|194684588|emb|CAR46445.1| polypeptide deformylase [Proteus mirabilis HI4320]
 gi|227164985|gb|EEI49824.1| polypeptide deformylase [Proteus mirabilis ATCC 29906]
          Length = 171

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 109/161 (67%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EK++++I  ++D+M E MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRTIAKPVEKVDAEIQKIVDDMFETMYLEEGIGLAATQVDIHQRIIVIDISET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++    D  + +EGCLSIP+ RA V R+  + VR +D N Q   + AD 
Sbjct: 67  RDQKLVLINPELLDQEGDTGI-EEGCLSIPEQRAFVPRAERVKVRALDYNGQPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL + R
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKLDKRR 166


>gi|38639603|ref|NP_943372.1| peptide deformylase [Klebsiella pneumoniae]
 gi|168998831|ref|YP_001688099.1| peptide deformylase [Klebsiella pneumoniae NTUH-K2044]
 gi|262040714|ref|ZP_06013948.1| peptide deformylase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|38016701|gb|AAR07722.1| N-formylmethionylaminoacyl-tRNA deformylase [Klebsiella pneumoniae]
 gi|238549851|dbj|BAH66202.1| N-formylmethionylaminoacyl-tRNA deformylase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259041938|gb|EEW42975.1| peptide deformylase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 169

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 114/162 (70%), Gaps = 3/162 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R ++   +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALNRYGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+D
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKD 167


>gi|315635057|ref|ZP_07890338.1| peptide deformylase [Aggregatibacter segnis ATCC 33393]
 gi|315476319|gb|EFU67070.1| peptide deformylase [Aggregatibacter segnis ATCC 33393]
          Length = 170

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 109/160 (68%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+P+  L+ V  P+  +N D   +ID+M + MY  +GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPEEHLKVVCDPVLNVNDDTRKIIDDMFDTMYQEEGIGLAAPQVDILQRIITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INP+I+    +  + +EGCLSIP +RA V R   +TV+ +D + +   + 
Sbjct: 65  -GDKQNQLVLINPEILDAEGETGI-EEGCLSIPGFRALVPRKEKVTVKALDRDGKEFTLK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K+
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLMKV 162


>gi|283788078|ref|YP_003367943.1| polypeptide deformylase [Citrobacter rodentium ICC168]
 gi|282951532|emb|CBG91231.1| polypeptide deformylase [Citrobacter rodentium ICC168]
          Length = 169

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++    +  + +EGCLSIP+ RA V R+  + +R +D   +   + ADG
Sbjct: 67  RDERLVLINPELLEKEGETGI-EEGCLSIPEQRALVPRAEKVKIRALDREGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|299531890|ref|ZP_07045290.1| peptide deformylase [Comamonas testosteroni S44]
 gi|298720065|gb|EFI61022.1| peptide deformylase [Comamonas testosteroni S44]
          Length = 170

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 107/160 (66%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+ +++  I  L+ +MLE MY   GIGLAA QI V  R++VID+ 
Sbjct: 5   PILCYPDPRLHKVAKPVAQVDERIQTLVKDMLETMYDAQGIGLAATQIDVHERVIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PM  INP+I+  S++  + +EGCLS+P     V+RS  + V+ +D +   + I
Sbjct: 65  EK--RNEPMALINPEILWASEEKQLGEEGCLSVPGIYDGVERSIAVKVKALDESGNSREI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+G+LA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 DAEGMLAICIQHEMDHLLGKVFVEYLSPLKRNRIKTKLVK 162


>gi|83404829|ref|YP_424843.1| peptide deformylase [Escherichia coli]
 gi|157149370|ref|YP_001451409.1| peptide deformylase [Escherichia coli E24377A]
 gi|298206469|ref|YP_003717571.1| peptide deformylase [Escherichia coli ETEC 1392/75]
 gi|83308554|emb|CAI79523.1| peptide deformylase [Escherichia coli]
 gi|157076537|gb|ABV16250.1| peptide deformylase [Escherichia coli E24377A]
 gi|297374341|emb|CBL93313.1| peptide deformylase [Escherichia coli ETEC 1392/75]
          Length = 169

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+  GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIRRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|145631964|ref|ZP_01787717.1| hypothetical protein CGSHi22421_05742 [Haemophilus influenzae
           R3021]
 gi|144982378|gb|EDJ89955.1| hypothetical protein CGSHi22421_05742 [Haemophilus influenzae
           R3021]
 gi|309973885|gb|ADO97086.1| N-formylmethionyl-tRNA deformylase [Haemophilus influenzae R2846]
          Length = 169

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVAEVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIK 161


>gi|323959563|gb|EGB55216.1| peptide deformylase [Escherichia coli H489]
          Length = 169

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 114/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  + +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKNGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|68249189|ref|YP_248301.1| peptide deformylase [Haemophilus influenzae 86-028NP]
 gi|145629886|ref|ZP_01785678.1| peptide deformylase [Haemophilus influenzae 22.1-21]
 gi|145637962|ref|ZP_01793602.1| peptide deformylase [Haemophilus influenzae PittHH]
 gi|145639368|ref|ZP_01794973.1| peptide deformylase [Haemophilus influenzae PittII]
 gi|145642285|ref|ZP_01797850.1| peptide deformylase [Haemophilus influenzae R3021]
 gi|148826745|ref|YP_001291498.1| peptide deformylase [Haemophilus influenzae PittEE]
 gi|148827778|ref|YP_001292531.1| peptide deformylase [Haemophilus influenzae PittGG]
 gi|229846679|ref|ZP_04466787.1| peptide deformylase [Haemophilus influenzae 7P49H1]
 gi|81336405|sp|Q4QMV6|DEF_HAEI8 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|166198517|sp|A5UEB4|DEF_HAEIE RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|166198518|sp|A5UH92|DEF_HAEIG RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|68057388|gb|AAX87641.1| peptide deformylase [Haemophilus influenzae 86-028NP]
 gi|144977740|gb|EDJ87687.1| peptide deformylase [Haemophilus influenzae 22.1-21]
 gi|145268853|gb|EDK08816.1| peptide deformylase [Haemophilus influenzae PittHH]
 gi|145271415|gb|EDK11327.1| peptide deformylase [Haemophilus influenzae PittII]
 gi|145273041|gb|EDK12922.1| peptide deformylase [Haemophilus influenzae 22.4-21]
 gi|148716905|gb|ABQ99115.1| peptide deformylase [Haemophilus influenzae PittEE]
 gi|148719020|gb|ABR00148.1| hypothetical protein CGSHiGG_06235 [Haemophilus influenzae PittGG]
 gi|229810772|gb|EEP46490.1| peptide deformylase [Haemophilus influenzae 7P49H1]
 gi|301169340|emb|CBW28939.1| peptide deformylase [Haemophilus influenzae 10810]
 gi|309751783|gb|ADO81767.1| N-formylmethionyl-tRNA deformylase [Haemophilus influenzae R2866]
          Length = 169

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVTEVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIK 161


>gi|145633869|ref|ZP_01789590.1| peptide deformylase [Haemophilus influenzae 3655]
 gi|145635938|ref|ZP_01791624.1| peptide deformylase [Haemophilus influenzae PittAA]
 gi|229845579|ref|ZP_04465706.1| peptide deformylase [Haemophilus influenzae 6P18H1]
 gi|144985241|gb|EDJ92084.1| peptide deformylase [Haemophilus influenzae 3655]
 gi|145266797|gb|EDK06815.1| peptide deformylase [Haemophilus influenzae PittAA]
 gi|229811514|gb|EEP47216.1| peptide deformylase [Haemophilus influenzae 6P18H1]
          Length = 169

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVTEVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIK 161


>gi|198282168|ref|YP_002218489.1| peptide deformylase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667290|ref|YP_002424533.1| polypeptide deformylase [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198246689|gb|ACH82282.1| peptide deformylase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519503|gb|ACK80089.1| polypeptide deformylase [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 167

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 105/162 (64%), Gaps = 3/162 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  L+ V+RPI +++  I  L D+M E MY   GIGLAA Q+   +RL+V+D+ ++  
Sbjct: 9   IPDARLKDVARPIARVDKQIQQLADDMAETMYDAPGIGLAAPQVAAGHRLIVVDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R + +  +NP+II  + +  + +EGCLS+P     V+R+  +TVR      +   + ADG
Sbjct: 67  RNDLLTLLNPEIIARTGEEEM-KEGCLSVPGVLETVRRAEKVTVRATTVQGKTVELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           LLA CLQHE+DHL+G LFIDHLSRLK+ +I +K  K V+L D
Sbjct: 126 LLAVCLQHEIDHLDGTLFIDHLSRLKQSLIRRKAEKRVRLGD 167


>gi|262040754|ref|ZP_06013985.1| peptide deformylase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041898|gb|EEW42938.1| peptide deformylase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 169

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++   D  +  +EGCLSIP+ RA V R+  + +R +D N +   + ADG
Sbjct: 67  REEQLVLINPEMLE-KDGETGIEEGCLSIPEQRALVPRAEKVKIRALDRNDKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRLR 166


>gi|88607030|ref|YP_505871.1| peptide deformylase [Anaplasma phagocytophilum HZ]
 gi|88598093|gb|ABD43563.1| peptide deformylase [Anaplasma phagocytophilum HZ]
          Length = 187

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 110/189 (58%), Gaps = 24/189 (12%)

Query: 1   MVKKPLVIFPDPILRRVSRPI------EKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGV 54
           M  +PLV+ PD  L   S  +      EK NS    L+++M + MY+  GIGLAAVQ+GV
Sbjct: 1   MSVRPLVVLPDSRLFLCSEEVRETDFCEKFNS----LVEDMFDTMYAEQGIGLAAVQVGV 56

Query: 55  LYRLVVIDLQDHAHRKN--------------PMVFINPKIITFSDDFSVYQEGCLSIPDY 100
             R+ VIDL       +              PMV INP+I+  S D    +EGCLS+PD 
Sbjct: 57  HKRIFVIDLGPKTEESSEIADDPDGYHSTCGPMVVINPEIVEKSVDLVSMEEGCLSVPDQ 116

Query: 101 RADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITK 160
           R  V R   I ++Y D + + +I+ A GLL+ CLQHE+DHLNG +F+ H+S+LKRD++ +
Sbjct: 117 RELVVRPERIVMQYTDLHGKRKILKAQGLLSRCLQHEIDHLNGTVFLKHISKLKRDLVMQ 176

Query: 161 KMSKLVQLR 169
           KM K   LR
Sbjct: 177 KMRKAASLR 185


>gi|319775435|ref|YP_004137923.1| peptide deformylase [Haemophilus influenzae F3047]
 gi|329122537|ref|ZP_08251120.1| peptide deformylase [Haemophilus aegyptius ATCC 11116]
 gi|317450026|emb|CBY86240.1| peptide deformylase [Haemophilus influenzae F3047]
 gi|327473142|gb|EGF18566.1| peptide deformylase [Haemophilus aegyptius ATCC 11116]
          Length = 169

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVTEVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLLK 161


>gi|311277759|ref|YP_003939990.1| peptide deformylase [Enterobacter cloacae SCF1]
 gi|308746954|gb|ADO46706.1| peptide deformylase [Enterobacter cloacae SCF1]
          Length = 169

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 112/161 (69%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V+ P++++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   IPDERLRKVAEPVQEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP++I   D  +  +EGCLS+P+ RA V R+  + VR +D + +   + ADG
Sbjct: 67  REQQLVLINPELIE-KDGETGIEEGCLSVPEQRALVPRAETVKVRALDRDGKPFELNADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +++
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRMK 166


>gi|251793801|ref|YP_003008533.1| peptide deformylase [Aggregatibacter aphrophilus NJ8700]
 gi|247535200|gb|ACS98446.1| peptide deformylase [Aggregatibacter aphrophilus NJ8700]
          Length = 170

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 112/165 (67%), Gaps = 3/165 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+P+  L+ +  P+ ++N D   +ID+M + MY  +GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPEDHLKVICDPVTEVNDDTRKIIDDMFDTMYQEEGIGLAAPQVDILQRIITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQLVLINPEILESEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           AD LLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K+ + R+
Sbjct: 123 ADRLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIKVKKQRE 167


>gi|270264340|ref|ZP_06192606.1| peptide deformylase [Serratia odorifera 4Rx13]
 gi|270041476|gb|EFA14574.1| peptide deformylase [Serratia odorifera 4Rx13]
          Length = 169

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+V+ P++++N+ I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   YPDERLRKVAAPVKEVNATIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+A + +R +D + +   + AD 
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAANVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLMGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|238021725|ref|ZP_04602151.1| hypothetical protein GCWU000324_01628 [Kingella oralis ATCC 51147]
 gi|237866339|gb|EEP67381.1| hypothetical protein GCWU000324_01628 [Kingella oralis ATCC 51147]
          Length = 167

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 104/160 (65%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  P+  L  V++P+ +++  I  L+ +M E MY++ GIGLAA Q+ V  R+VVIDL 
Sbjct: 5   PILTHPNERLHIVAQPVAQVDERIRTLVQDMAETMYASKGIGLAATQVDVHERVVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +   +  INP +IT  D  + Y+EGCLS+P    +V R+  ITV ++D     Q +
Sbjct: 65  EE--KNQLLALINP-VITKKDGETTYEEGCLSVPGIYEEVTRAETITVEFLDIQGNKQTL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHLNG LF+++LS LK++ I  KM K
Sbjct: 122 DADGLLAICVQHELDHLNGKLFVEYLSPLKQNRIKTKMKK 161


>gi|254282388|ref|ZP_04957356.1| peptide deformylase [gamma proteobacterium NOR51-B]
 gi|219678591|gb|EED34940.1| peptide deformylase [gamma proteobacterium NOR51-B]
          Length = 168

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 98/160 (61%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR  ++P+ +++  I  LID+MLE MY   GIGLAA Q+ V  R++VID+ 
Sbjct: 5   PILEFPDPRLRTRAKPVTEVDQRIRRLIDDMLETMYDAPGIGLAASQVDVHERVIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +  +R  P VFINP++         Y EGCLS+P +   V R + I V  +D        
Sbjct: 65  E--NRDEPRVFINPEVTVIDKTLGSYDEGCLSVPGFFETVNRPSSIEVTALDREGDTFAE 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             DGLLA CLQHE+DHL G LF+D+LS LKR  I  K+ K
Sbjct: 123 ELDGLLAICLQHEIDHLEGKLFVDYLSPLKRQRIRSKLEK 162


>gi|157826975|ref|YP_001496039.1| peptide deformylase [Rickettsia bellii OSU 85-389]
 gi|157802279|gb|ABV79002.1| peptide deformylase [Rickettsia bellii OSU 85-389]
          Length = 175

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 110/166 (66%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+ + ++N+ I   +D+M+E MY  DG GLAAVQ+GVL R++VID++
Sbjct: 5   PIVTVPDERLKQKSQAVLEVNNQIRKFMDDMVETMYHEDGGGLAAVQVGVLKRIMVIDIK 64

Query: 65  DHAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   K P  F     +NP+II  S++  +  EGC+S+P+ R ++ RS  I +RY+D + 
Sbjct: 65  DHDPIKRPKDFYPLFIVNPEIIEKSEELVIANEGCISVPEQRYEIARSESIKIRYLDYHN 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS +KR++  +K+ KL
Sbjct: 125 KPQELEANDWLARVIQHEYDHLEGKLMIDYLSSMKRNIALRKLRKL 170


>gi|312882739|ref|ZP_07742474.1| peptide deformylase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369597|gb|EFP97114.1| peptide deformylase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 173

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V+ P+E +  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVATPVENVTPEIQKFVDDMIETMYDEEGIGLAATQVDCHKRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I+    +  + +EGCLS+P  RA V R+A +TV+ +D + +     
Sbjct: 66  T--RDQPMVLINPEILDKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGKEFTFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLTKI 162


>gi|229586451|ref|YP_002844952.1| peptide deformylase [Rickettsia africae ESF-5]
 gi|228021501|gb|ACP53209.1| Polypeptide deformylase [Rickettsia africae ESF-5]
          Length = 175

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 108/166 (65%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID+Q
Sbjct: 5   PIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGAGLAAVQVGVLKRILVIDIQ 64

Query: 65  DH---AHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   A  K+  P+  +NP++I  +++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 65  DHDSVARPKDFYPLFIVNPEMIEQAEELVTANEGCISLPEQRIEVARPESIKIRYLDYHG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KSQELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|332533677|ref|ZP_08409536.1| peptide deformylase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036841|gb|EGI73302.1| peptide deformylase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 168

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 108/164 (65%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ FPD  LR V++ + +++  +  ++ +MLE MY  +GIGLAA Q+ +  R+VV
Sbjct: 1   MARLEVLRFPDERLRTVAKDVVQVDDTVRQIVKDMLETMYDENGIGLAATQVDIHQRIVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R  P+V INP+II   D  +V +EGCLS+P+  A V R+  +TV  ++ N +
Sbjct: 61  IDVSEE--RNEPLVLINPQIIK-KDGSTVSEEGCLSVPNSYAKVDRAETVTVAALNENGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             ++ AD LLA C+QHELDHL G LFID+LS LKR  I KK+ K
Sbjct: 118 EFVLDADELLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEK 161


>gi|329114447|ref|ZP_08243209.1| Peptide deformylase [Acetobacter pomorum DM001]
 gi|326696523|gb|EGE48202.1| Peptide deformylase [Acetobacter pomorum DM001]
          Length = 275

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 111/163 (68%), Gaps = 4/163 (2%)

Query: 5   PLVIF--PDPILRRVSRPIEKIN-SDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           PL I   P P+LR+ +R ++  + +DI  ++ NM   MY   GIGLAA Q+G+  R +++
Sbjct: 109 PLQILTPPHPVLRQKARLVKPEDVADIRKILPNMFSAMYQAPGIGLAAPQVGLSQRFLLV 168

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           DL +   R +P+V INP++I  ++D +V +EGCLS+P+  A+V R   I VR+ + N   
Sbjct: 169 DLGEKDAR-DPIVMINPEVIAETEDMAVREEGCLSLPNQYAEVVRPEKIRVRWNNINGDV 227

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
               A+GLLATC+QHE+DHL G+LF+DHLS L+R+MI ++++K
Sbjct: 228 VEREAEGLLATCIQHEIDHLEGVLFVDHLSALRRNMILRRLAK 270


>gi|258541770|ref|YP_003187203.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632848|dbj|BAH98823.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635905|dbj|BAI01874.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638960|dbj|BAI04922.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642014|dbj|BAI07969.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645069|dbj|BAI11017.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648124|dbj|BAI14065.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651177|dbj|BAI17111.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654168|dbj|BAI20095.1| N-formylmethionylaminoacyl-tRNA deformylase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 186

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 111/163 (68%), Gaps = 4/163 (2%)

Query: 5   PLVIF--PDPILRRVSRPIEKIN-SDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           PL I   P P+LR+ +R ++  + ++I  ++ NM   MY   GIGLAA Q+G+  R +++
Sbjct: 20  PLQILTPPHPVLRQKARLVKPEDVAEIRKILPNMFSAMYQAPGIGLAAPQVGLSQRFILV 79

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           DL +   R +P+V INP++I  ++D +V +EGCLS+P+  A+V R   I VR+ + N   
Sbjct: 80  DLGEKDAR-DPIVMINPEVIAETEDMAVREEGCLSLPNQYAEVVRPEKIRVRWNNVNGDV 138

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
               A+GLLATC+QHE+DHL G+LF+DHLS L+R+MI ++++K
Sbjct: 139 VEREAEGLLATCIQHEIDHLEGVLFVDHLSALRRNMILRRLAK 181


>gi|117620047|ref|YP_854786.1| peptide deformylase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117561454|gb|ABK38402.1| peptide deformylase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 170

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 109/159 (68%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V+ P+E    ++ +++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRTVAAPVETFTPELQHIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R++P+V INP+II  +    + +EGCLS+P  RA V R+ ++ VR +D + +   + AD 
Sbjct: 67  REDPLVLINPEIIEQAGSTGI-EEGCLSVPGSRALVPRAEWVKVRALDRHGKAFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAR 164


>gi|271502213|ref|YP_003335239.1| peptide deformylase [Dickeya dadantii Ech586]
 gi|270345768|gb|ACZ78533.1| peptide deformylase [Dickeya dadantii Ech586]
          Length = 169

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 108/159 (67%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N++I  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRTQAKPVKEVNAEIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S D  + +EGCLSIP+ RA V R+  + VR +D   +   + ADG
Sbjct: 67  RDQRLVLINPELLEKSGDTGI-EEGCLSIPETRALVPRAEHVKVRALDREGKPFELDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKLAR 164


>gi|260599606|ref|YP_003212177.1| peptide deformylase [Cronobacter turicensis z3032]
 gi|260218783|emb|CBA34131.1| Peptide deformylase [Cronobacter turicensis z3032]
          Length = 177

 Score =  144 bits (364), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHR 69
           PD  LR V+ P++++N+DI  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  R
Sbjct: 16  PDERLRIVAEPVKEVNADIQRIVDDMFDTMYAEEGIGLAATQVDIHQRIIVIDVSEN--R 73

Query: 70  KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGL 129
              +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D N +   + ADGL
Sbjct: 74  DERLVLINPELLEQSGETGI-EEGCLSIPEQRAFVPRAEKVKIRALDRNGKSFELEADGL 132

Query: 130 LATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LA C+QHE+DHL G LFID+LS +KR  I +K+ KL +++
Sbjct: 133 LAICIQHEMDHLVGKLFIDYLSPMKRQRIRQKVEKLDRMK 172


>gi|291619142|ref|YP_003521884.1| Def [Pantoea ananatis LMG 20103]
 gi|291154172|gb|ADD78756.1| Def [Pantoea ananatis LMG 20103]
 gi|327395471|dbj|BAK12893.1| peptide deformylase Def [Pantoea ananatis AJ13355]
          Length = 170

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 108/159 (67%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+++ P++++N+D+  ++D+M E MYS +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRKIAAPVKEVNADVQRIVDDMFETMYSEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + VR +D   +   +    
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRAFVPRAERVKVRALDREGKSFELETGD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL+G LFID+LS LKR  I  K+ KL +
Sbjct: 126 LLAICIQHEIDHLDGKLFIDYLSPLKRQRIKTKLEKLAR 164


>gi|289209433|ref|YP_003461499.1| peptide deformylase [Thioalkalivibrio sp. K90mix]
 gi|288945064|gb|ADC72763.1| peptide deformylase [Thioalkalivibrio sp. K90mix]
          Length = 177

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 107/164 (65%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K+ ++ FPDP LR  + P+E ++ +I  L+D+MLE MY   GIGLAA QI V  R++V
Sbjct: 1   MAKREILHFPDPRLRLKAEPVETVDDEIRTLVDDMLETMYDAPGIGLAATQINVQKRVLV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            D+ D   +  P V INP+I+  S +  +  EGCLS+P +   V+R+  I VR +  + +
Sbjct: 61  ADVSDD--QSEPHVLINPEILETSGEEEM-DEGCLSVPGFYEKVQRADRIRVRALGRDGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              +  DGLLA C+QHE+DHL+G LF+D+LS LKR+ I KK+ K
Sbjct: 118 PFELDIDGLLAVCIQHEIDHLDGKLFVDYLSSLKRNRIRKKLEK 161


>gi|242237892|ref|YP_002986073.1| peptide deformylase [Dickeya dadantii Ech703]
 gi|242129949|gb|ACS84251.1| peptide deformylase [Dickeya dadantii Ech703]
          Length = 170

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 108/157 (68%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N+DI  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRITAKPVKEVNADIQRIVDDMFDTMYAEEGIGLAATQVNIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S D  + +EGCLSIP+ RA V R+  + +R +D + +   +  DG
Sbjct: 67  RDQRLVLINPELLEKSGDTGI-EEGCLSIPETRALVPRAERVKIRALDKDGKPFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKL 162


>gi|37521797|ref|NP_925174.1| peptide deformylase [Gloeobacter violaceus PCC 7421]
 gi|39930959|sp|Q7NIF5|DEF2_GLOVI RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|35212795|dbj|BAC90169.1| polypeptide deformylase [Gloeobacter violaceus PCC 7421]
          Length = 187

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/153 (45%), Positives = 96/153 (62%), Gaps = 2/153 (1%)

Query: 1   MVKKPLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRL 58
           + K PL I    D +LR+ S+ I  IN ++  L   ML+ MYS DGIGLAA Q+GV  R+
Sbjct: 12  LAKPPLAIHTLGDRVLRQGSKQISGINDEVRKLAQQMLQTMYSADGIGLAAPQVGVNKRM 71

Query: 59  VVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +V+D+      + P+V INP I  FS D +V QEGCLS+P   ADV+R   +   Y D N
Sbjct: 72  IVVDIDPENAARPPLVLINPLIKQFSSDLAVDQEGCLSVPSIYADVRRPERVVATYRDLN 131

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
            +   + A GLLA C+QHE+DHL+G+LF+D + 
Sbjct: 132 GRPVTLEATGLLARCIQHEIDHLDGVLFVDRVE 164


>gi|330827125|ref|YP_004390428.1| peptide deformylase [Alicycliphilus denitrificans K601]
 gi|329312497|gb|AEB86912.1| Peptide deformylase [Alicycliphilus denitrificans K601]
          Length = 171

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 106/160 (66%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+  ++  +  ++D+ML  MY  +GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILCYPDPRLHKVAKPVATVDERVRAIVDDMLATMYDANGIGLAATQVDVHERIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I   S +  + +EGCLS+P     V+RS  +  R +D + Q + I
Sbjct: 65  EE--RDQPLVLINPEITWASPEMRMGEEGCLSVPGIYDGVERSLAVHARALDRDGQPRTI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 EAEGLLAVCIQHEMDHLLGKVFVEYLSPLKRNRIKTKLLK 162


>gi|251788004|ref|YP_003002725.1| peptide deformylase [Dickeya zeae Ech1591]
 gi|247536625|gb|ACT05246.1| peptide deformylase [Dickeya zeae Ech1591]
          Length = 169

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 108/159 (67%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N++I  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRIQAKPVKEVNAEIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S D  + +EGCLSIP+ RA V R+  + VR +D   +   + ADG
Sbjct: 67  RDQRLVLINPELLEKSGDTGI-EEGCLSIPETRALVPRAEHVKVRALDREGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKLAR 164


>gi|168234463|ref|ZP_02659521.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|194472649|ref|ZP_03078633.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194459013|gb|EDX47852.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205331619|gb|EDZ18383.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
          Length = 169

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + A+G
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNPFELEANG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRL 165


>gi|149190435|ref|ZP_01868706.1| peptide deformylase [Vibrio shilonii AK1]
 gi|148835689|gb|EDL52655.1| peptide deformylase [Vibrio shilonii AK1]
          Length = 169

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I  ++D+M+E MY  +GIGLAA Q+    R+VVID+ D
Sbjct: 6   VLTFPDDRLRTVAKPVEAVTPEIQKVVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I     +  + +EGCLS+P  RA V R+A ++V+ ++ + +     
Sbjct: 66  T--RDQPMVLINPEITEKRGEDGI-EEGCLSVPGARALVPRAAEVSVKALNRDGEEFTFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K+ K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIKDKLEKI 162


>gi|302341791|ref|YP_003806320.1| peptide deformylase [Desulfarculus baarsii DSM 2075]
 gi|301638404|gb|ADK83726.1| peptide deformylase [Desulfarculus baarsii DSM 2075]
          Length = 170

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 1/153 (0%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+  +PDP+L      I++++ ++  L  +M++ MY   G+GLAA Q+G   R+VV+D  
Sbjct: 5   PICKYPDPVLAEKCAEIDRVDDELRRLAQDMIDTMYDAPGVGLAAPQVGRAIRMVVVDTA 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PMV INP+++       V+ E CLS+PDYRADV R++ + V   D       I
Sbjct: 65  EDDKRGTPMVLINPRVVAKRGQL-VWDEACLSVPDYRADVVRASEVVVEAGDLEGNDLRI 123

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
            A+GL A CLQHE+DHL+G+LF+DH+S LKR M
Sbjct: 124 EAEGLTAVCLQHEIDHLDGVLFLDHISSLKRAM 156


>gi|149910328|ref|ZP_01898971.1| peptide deformylase [Moritella sp. PE36]
 gi|149806576|gb|EDM66544.1| peptide deformylase [Moritella sp. PE36]
          Length = 167

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 107/159 (67%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  L+++++P+++I      +ID+MLE MY+ +GIGLAAVQ+ +L R+VVID+     
Sbjct: 9   FPDDRLKKIAQPVQEITPATQIIIDDMLETMYAEEGIGLAAVQVNILQRIVVIDVS--GT 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P++ INP ++T     +  +EGCLS+P+ RA V R+  +TV  +D +     + A  
Sbjct: 67  RGEPLILINP-VLTNKCGETGIEEGCLSVPESRAFVPRAESVTVTALDRDGNEFTLEAHD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA CLQHE+DHLNG LFID+LS LK+  I KK+ KL +
Sbjct: 126 LLAICLQHEVDHLNGKLFIDYLSPLKQQRIRKKLEKLAR 164


>gi|297183538|gb|ADI19667.1| N-formylmethionyl-tRNA deformylase [uncultured Alteromonadales
           bacterium HF4000_16C08]
          Length = 169

 Score =  144 bits (363), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P+E++N +I  L+ +M E M   +GIGLAA Q+    ++VV+D+ +   
Sbjct: 9   FPDERLRTVAKPVEEVNDEIKQLVSDMFETMKDENGIGLAATQVNRHVQVVVMDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+I T  D  ++ +EGCLS+P   A V+R+  ITV+ ++   +   + A+G
Sbjct: 67  QNEPRVFINPEI-TRKDGSTISEEGCLSVPGNYAKVERAEAITVKALNEEGEAFELDAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LFID+LS LKR  I KK+ K  +L
Sbjct: 126 LLAICIQHELDHLKGKLFIDYLSPLKRQRIRKKLEKDARL 165


>gi|254497986|ref|ZP_05110749.1| peptide deformylase [Legionella drancourtii LLAP12]
 gi|254352763|gb|EET11535.1| peptide deformylase [Legionella drancourtii LLAP12]
          Length = 171

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 103/160 (64%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PDP LR +S+P+   +  +  LID+M E MY   G+GLAA QIGV  RL VID+  
Sbjct: 6   ILYLPDPRLRELSKPVVTFDDTLQTLIDDMFETMYDAHGVGLAAAQIGVSLRLSVIDIL- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +KN +V INP+II  S+  S + EGCLS+P     V R+  +TV+ +D + +   I 
Sbjct: 65  -GDKKNQIVIINPEIIA-SEGESKFDEGCLSVPGAYDTVTRAEKVTVKALDRHGKPFEIK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A+GLLA CLQHE+DH+NG LFID LS LK+ M  KK+ K 
Sbjct: 123 AEGLLAECLQHEIDHMNGKLFIDMLSPLKKAMARKKLDKF 162


>gi|15892201|ref|NP_359915.1| peptide deformylase [Rickettsia conorii str. Malish 7]
 gi|20137640|sp|Q92IZ1|DEF1_RICCN RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|15619334|gb|AAL02816.1| polypeptide deformylase [Rickettsia conorii str. Malish 7]
          Length = 175

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 108/166 (65%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID+Q
Sbjct: 5   PIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGAGLAAVQVGVLKRILVIDIQ 64

Query: 65  DH---AHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   A  K+  P+  +NP+II  +++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 65  DHDSVARPKDFYPLFIVNPEIIEKAEELVTANEGCISLPEQRIEVARPESIKIRYLDYHG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + + + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KSRELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|317049806|ref|YP_004117454.1| peptide deformylase [Pantoea sp. At-9b]
 gi|316951423|gb|ADU70898.1| peptide deformylase [Pantoea sp. At-9b]
          Length = 170

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 108/159 (67%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+++ P++ +++ +  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDDRLRKIAAPVKTVDAGVQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++    +  + +EGCLSIP+ RA V R+ ++ VR  D +     +  DG
Sbjct: 67  REERLVLINPELLEKGGETGI-EEGCLSIPEQRAFVPRAEWVKVRAQDRDGNSFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL+G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEIDHLDGKLFIDYLSPLKRQRIKQKLEKLAR 164


>gi|78224529|ref|YP_386276.1| peptide deformylase [Geobacter metallireducens GS-15]
 gi|78195784|gb|ABB33551.1| peptide deformylase [Geobacter metallireducens GS-15]
          Length = 167

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 104/164 (63%), Gaps = 1/164 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++ +P+PIL++ + P+  IN     L+ +M E MY   G+GLAA QIGV  R++VID+
Sbjct: 3   RTILTYPNPILKKKAVPVAVINDATRELVRDMAETMYDAQGVGLAAPQIGVSQRVIVIDV 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                R   +V INP +   ++  S  +EGCLS+P Y A+V R A + V+ ++ + +   
Sbjct: 63  SQREERPELIVCINP-VFVHTEGESYEEEGCLSVPKYSANVHRHAKVVVKALNLDGEEVT 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             A+GLLA   QHE+DHL G+LF+DHLS LKR+M  KK  ++V+
Sbjct: 122 YRAEGLLAIAFQHEIDHLEGMLFVDHLSPLKREMFKKKYRRMVE 165


>gi|57238784|ref|YP_179920.1| peptide deformylase [Ehrlichia ruminantium str. Welgevonden]
 gi|58578709|ref|YP_196921.1| peptide deformylase [Ehrlichia ruminantium str. Welgevonden]
 gi|58616771|ref|YP_195970.1| peptide deformylase [Ehrlichia ruminantium str. Gardel]
 gi|57160863|emb|CAH57765.1| putative peptide deformylase 1 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58416383|emb|CAI27496.1| Peptide deformylase [Ehrlichia ruminantium str. Gardel]
 gi|58417335|emb|CAI26539.1| Peptide deformylase [Ehrlichia ruminantium str. Welgevonden]
          Length = 181

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 105/171 (61%), Gaps = 12/171 (7%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV----I 61
           LV  PD  L   S  + ++  +I  L+D+M EVM++ +GIGLAAVQ+G+  R+ V    +
Sbjct: 6   LVTIPDHRLSLCSEEVTEVTQEIKKLVDDMFEVMHTNNGIGLAAVQVGIHKRIFVADVPV 65

Query: 62  DLQDHAHRK--------NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVR 113
           D +DH   K         P   INPKI+  S +    QEGCLS+PD    V R  ++T++
Sbjct: 66  DYKDHETIKTDGYKSHGGPYCMINPKIVDMSQEKVKMQEGCLSVPDCLEYVMRPKYVTMQ 125

Query: 114 YMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           Y+D N    II A G LA CL+HELDHLNGI+F+ +LS+ KRD+I +K+ K
Sbjct: 126 YLDYNGNKCIIKAQGWLARCLEHELDHLNGIVFLKYLSKFKRDLIVEKIRK 176


>gi|301064006|ref|ZP_07204471.1| peptide deformylase [delta proteobacterium NaphS2]
 gi|300441917|gb|EFK06217.1| peptide deformylase [delta proteobacterium NaphS2]
          Length = 171

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 96/144 (66%), Gaps = 1/144 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +P+P+L++ + P++ I+ ++  +ID MLE MY+  GIGLAA Q+GVL R++V D      
Sbjct: 9   YPEPVLKKNAEPVKNIDEELQEIIDQMLETMYAAPGIGLAANQVGVLKRVIVFDGSPREE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
             NP + INP+I+        + E CLS+PD+ A+V R+A I V+ +D N +   + A  
Sbjct: 69  GANPQILINPEIVAAEGSIK-WDEACLSVPDFTAEVNRNANIQVKGLDRNGKPLELEAKD 127

Query: 129 LLATCLQHELDHLNGILFIDHLSR 152
           LLA CLQHE+DHL+GILFID +SR
Sbjct: 128 LLAVCLQHEIDHLDGILFIDRISR 151


>gi|121596335|ref|YP_988231.1| peptide deformylase [Acidovorax sp. JS42]
 gi|222112559|ref|YP_002554823.1| peptide deformylase [Acidovorax ebreus TPSY]
 gi|120608415|gb|ABM44155.1| peptide deformylase [Acidovorax sp. JS42]
 gi|221732003|gb|ACM34823.1| peptide deformylase [Acidovorax ebreus TPSY]
          Length = 170

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 105/160 (65%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+  ++  +  ++D+M   MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILCYPDPRLHKVAQPVTAVDERVRAIVDDMFATMYDAHGIGLAATQVDVHERIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I   S +  V  EGCLS+P     V+RS  + VR +D + Q ++I
Sbjct: 65  EE--RDTPLVLINPEITWASAEKQVGDEGCLSVPGIYDGVERSTAVHVRALDRDGQPRVI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 EAEGLLAVCIQHEMDHLLGKVFVEYLSPLKRNRIKTKLLK 162


>gi|294141147|ref|YP_003557125.1| polypeptide deformylase [Shewanella violacea DSS12]
 gi|293327616|dbj|BAJ02347.1| polypeptide deformylase [Shewanella violacea DSS12]
          Length = 163

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/162 (46%), Positives = 105/162 (64%), Gaps = 5/162 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R +R +E I+S +   ID++LE +Y T DGIGLAA Q+G  + ++VIDL 
Sbjct: 6   ILTIPDERLKRKARTVEDIDS-VQGFIDDLLETLYDTEDGIGLAATQVGSEHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P V INP+I+    DF + +EGCLSIP YRA V RS  +TV+ +D   +   I
Sbjct: 65  EE--RDQPQVLINPEIVATQGDF-IGEEGCLSIPGYRAKVARSEQVTVKALDRTGKPFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV 166
             D  LA  LQHE+DHL GI+F DHLS+LK+ +  KK+ K V
Sbjct: 122 ETDTFLAIVLQHEMDHLQGIVFTDHLSKLKQQIALKKVKKYV 163


>gi|152972195|ref|YP_001337341.1| peptide deformylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238896783|ref|YP_002921528.1| peptide deformylase [Klebsiella pneumoniae NTUH-K2044]
 gi|330002243|ref|ZP_08304254.1| peptide deformylase [Klebsiella sp. MS 92-3]
 gi|166198519|sp|A6TEU0|DEF_KLEP7 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|150957044|gb|ABR79074.1| peptide deformylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238549110|dbj|BAH65461.1| peptide deformylase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328537382|gb|EGF63631.1| peptide deformylase [Klebsiella sp. MS 92-3]
          Length = 169

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++   D  +  +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  REEQLVLINPEMLE-KDGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRLR 166


>gi|319764921|ref|YP_004128858.1| peptide deformylase [Alicycliphilus denitrificans BC]
 gi|317119482|gb|ADV01971.1| peptide deformylase [Alicycliphilus denitrificans BC]
          Length = 171

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 106/160 (66%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+  ++  +  ++D+ML  MY  +GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILCYPDPRLHKVAKPVATVDERVRAIVDDMLATMYDANGIGLAATQVDVHERIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I   S +  + +EGCLS+P     V+RS  +  R +D + Q + I
Sbjct: 65  EE--RDQPLVLINPEITWASPETRMGEEGCLSVPGIYDGVERSLAVHARALDRDGQPRTI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 EAEGLLAVCIQHEMDHLLGKVFVEYLSPLKRNRIKTKLLK 162


>gi|294638020|ref|ZP_06716280.1| peptide deformylase [Edwardsiella tarda ATCC 23685]
 gi|291088812|gb|EFE21373.1| peptide deformylase [Edwardsiella tarda ATCC 23685]
          Length = 171

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 107/157 (68%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ ++  +I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRTIAKPVNEVTPEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDISEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++    +  + +EGCLS+P+ RA V R+  ITVR +D + +   +  DG
Sbjct: 67  RDQRLVLINPELLQKGGETGI-EEGCLSVPEQRALVPRAETITVRALDRDGKPFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLMGKLFIDYLSPLKRQRIRQKLEKL 162


>gi|206580091|ref|YP_002236311.1| peptide deformylase [Klebsiella pneumoniae 342]
 gi|288933300|ref|YP_003437359.1| peptide deformylase [Klebsiella variicola At-22]
 gi|290512102|ref|ZP_06551470.1| peptide deformylase [Klebsiella sp. 1_1_55]
 gi|238058213|sp|B5XNC4|DEF_KLEP3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|206569149|gb|ACI10925.1| peptide deformylase [Klebsiella pneumoniae 342]
 gi|288888029|gb|ADC56347.1| peptide deformylase [Klebsiella variicola At-22]
 gi|289775892|gb|EFD83892.1| peptide deformylase [Klebsiella sp. 1_1_55]
          Length = 169

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++   D  +  +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  REERLVLINPELLE-KDGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRLR 166


>gi|119471681|ref|ZP_01614066.1| N-terminal methionine peptide deformylase [Alteromonadales
           bacterium TW-7]
 gi|119445460|gb|EAW26747.1| N-terminal methionine peptide deformylase [Alteromonadales
           bacterium TW-7]
          Length = 168

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 107/164 (65%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ FPD  LR +++ +  ++  +  ++ +MLE MY  +GIGLAA Q+ +  R+VV
Sbjct: 1   MARLEVLRFPDERLRTIAKDVADVDDQVRQIVKDMLETMYDENGIGLAATQVNIHQRIVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R  P+V INP+II   D  ++ +EGCLS+P+  A V R+  +TV  ++ N +
Sbjct: 61  IDVSEE--RDEPLVLINPQIIK-KDGSTISEEGCLSVPNSYAKVDRAETVTVAALNENGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             ++ AD LLA C+QHELDHL G LFID+LS LKR  I KK+ K
Sbjct: 118 EFVLDADELLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEK 161


>gi|194439835|ref|ZP_03071900.1| peptide deformylase [Escherichia coli 101-1]
 gi|194421225|gb|EDX37247.1| peptide deformylase [Escherichia coli 101-1]
 gi|323974492|gb|EGB69619.1| peptide deformylase [Escherichia coli TW10509]
          Length = 169

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+  GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIRRIVDDMFETMYAEKGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + A+G
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|222054052|ref|YP_002536414.1| peptide deformylase [Geobacter sp. FRC-32]
 gi|221563341|gb|ACM19313.1| peptide deformylase [Geobacter sp. FRC-32]
          Length = 171

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 107/167 (64%), Gaps = 2/167 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M+KK ++ FPDP L++  +P+  IN  +  L+ +M E MY   G+GLAA QIGV  R+VV
Sbjct: 1   MIKK-ILTFPDPELKKKCQPVTVINDKVRELVRDMAETMYDAPGVGLAAPQIGVHQRVVV 59

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+     +   +V INP +I  +D  +  +EGCLSIP Y A+V+R   + V+ ++   +
Sbjct: 60  IDVTGKDEQPQLLVAINP-VIVHADGEAYEEEGCLSIPKYAANVRRHERVVVKALNLEGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLA   QHE+DHL+GILFIDH+S LKR++  +K  + ++
Sbjct: 119 EVTFKADGLLAIAFQHEIDHLDGILFIDHISPLKREIFRRKYRRTME 165


>gi|319897841|ref|YP_004136038.1| peptide deformylase [Haemophilus influenzae F3031]
 gi|317433347|emb|CBY81725.1| peptide deformylase [Haemophilus influenzae F3031]
          Length = 169

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+    P+ ++N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVACEPVTEVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   +TVR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVTVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLLK 161


>gi|307132806|ref|YP_003884822.1| peptide deformylase [Dickeya dadantii 3937]
 gi|306530335|gb|ADN00266.1| peptide deformylase [Dickeya dadantii 3937]
          Length = 169

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 109/159 (68%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N++I  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRIKAQPVKEVNAEIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S D  + +EGCLSIP+ RA V R+  ++VR +D   +   + A+G
Sbjct: 67  RDQRLVLINPELLEKSGDTGI-EEGCLSIPETRALVPRAERVSVRALDREGKPFELEAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKLEKLAR 164


>gi|77917861|ref|YP_355676.1| polypeptide deformylase [Pelobacter carbinolicus DSM 2380]
 gi|77543944|gb|ABA87506.1| peptide deformylase [Pelobacter carbinolicus DSM 2380]
          Length = 171

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 104/163 (63%), Gaps = 6/163 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+  +PDP+L+  S PI  I  +I  L  +M E MY+  G+GLAA Q+G+  +LVV+D  
Sbjct: 5   PIRHYPDPVLKNKSEPILTITEEIKTLAADMAETMYAAPGVGLAAPQVGINKKLVVMDC- 63

Query: 65  DHAHRKNP--MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
             A ++NP  +V INP+II    D S  +EGCLS+P Y   +KR++ + VRY +   Q  
Sbjct: 64  --APKENPELIVAINPEIIEREGD-SFEEEGCLSVPGYYCRIKRNSHVKVRYQNLEGQTV 120

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              A GLLA   QHE+DHL+G+LF+DHLS LK++M  KK  K+
Sbjct: 121 EREATGLLAIAFQHEIDHLHGLLFVDHLSSLKKNMFRKKYQKI 163


>gi|56417231|ref|YP_154305.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. St. Maries]
 gi|222475595|ref|YP_002564012.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. Florida]
 gi|254995399|ref|ZP_05277589.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. Mississippi]
 gi|255003586|ref|ZP_05278550.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. Puerto Rico]
 gi|255004717|ref|ZP_05279518.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. Virginia]
 gi|56388463|gb|AAV87050.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. St. Maries]
 gi|222419733|gb|ACM49756.1| N-formylmethionylaminoacyl-tRNA deformylase [Anaplasma marginale
           str. Florida]
          Length = 185

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 103/177 (58%), Gaps = 17/177 (9%)

Query: 5   PLVIFPDPILRRVSRPIEK--INSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL+  PD  L   S  +        +  L +NMLE MY   GIGLAAVQ+GV  R+ V+D
Sbjct: 5   PLLTLPDSRLSLCSEEVHAADFGPQLETLTNNMLETMYHNKGIGLAAVQVGVHKRICVVD 64

Query: 63  LQDHAHRK---------------NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRS 107
           L+  + R                 P+V +NP ++  S+  +  +EGCLS+P YR  V+R 
Sbjct: 65  LEYGSDRYEIPEDDGVGEYRATCGPVVILNPIVVEESEQLATMEEGCLSVPGYRETVQRP 124

Query: 108 AFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             I V+Y D N Q + I A GLLA CLQHELDHLNG++F+  +S+LKRDM+ +K+ K
Sbjct: 125 ERIVVQYTDLNRQTKYIKACGLLARCLQHELDHLNGVVFLQRVSKLKRDMVMEKIRK 181


>gi|254784305|ref|YP_003071733.1| peptide deformylase [Teredinibacter turnerae T7901]
 gi|259645186|sp|C5BKQ0|DEF_TERTT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|237684580|gb|ACR11844.1| peptide deformylase [Teredinibacter turnerae T7901]
          Length = 168

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 105/160 (65%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPD  LR V++P+E+++  +  +ID+M E MY   GIGLAA Q+ V  +++VID+ 
Sbjct: 5   PILEFPDARLRTVAKPVEQVDERVRAIIDDMFETMYDAPGIGLAATQVNVHEQIIVIDIS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++     P+VFINP+I    +    Y+EGCLS+P +  +V R   + V  ++ + +  ++
Sbjct: 65  EN--HDEPLVFINPRIDVLDETLFDYEEGCLSVPGFYEEVTRPRHVRVTALNRDGEEFVL 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             +GLLA C+QHE+DHL G LF+D++S +KR  I KK+ K
Sbjct: 123 EPEGLLAVCIQHEIDHLKGKLFVDYVSNIKRQRIRKKLEK 162


>gi|288941787|ref|YP_003444027.1| peptide deformylase [Allochromatium vinosum DSM 180]
 gi|288897159|gb|ADC62995.1| peptide deformylase [Allochromatium vinosum DSM 180]
          Length = 185

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPDP LR+ +RP+E+++  I  L+D+MLE MY+  GIGLAA Q+ V  +++VID+ +
Sbjct: 6   ILTFPDPRLRQKARPVEQVDDQIRRLVDDMLETMYAAPGIGLAATQVDVQRQIIVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H   P+ FINP+++   +      EGCLS+P +   V R+  +TV  +D + +   + 
Sbjct: 66  -GH-DTPLCFINPRLVA-REGTEQMDEGCLSVPGFFETVTRAERVTVEALDRDGKPFKLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHL+G LF+DH+S LKR  I  K+ K
Sbjct: 123 ADGLLAVCIQHEMDHLDGKLFVDHISILKRQRIRHKLEK 161


>gi|15603424|ref|NP_246498.1| peptide deformylase [Pasteurella multocida subsp. multocida str.
           Pm70]
 gi|13431442|sp|P57948|DEF_PASMU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|12721951|gb|AAK03643.1| Def [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 170

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 111/165 (67%), Gaps = 3/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++++PD  L+ +++P+ ++N +I  ++DNM E MY  +GIGLAA Q+ +  R++ 
Sbjct: 1   MARLNVLVYPDERLKIIAKPVVEVNDEIREIVDNMFETMYLEEGIGLAATQVNIHQRIIT 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID++    ++N  V INP+II    +  + +EGCLS+P +R  V R   +T++ +D + +
Sbjct: 61  IDVE--GTKENQYVLINPEIIDSCGETGI-EEGCLSLPGFRGFVPRKEKVTIKALDRHGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              + A+GLLA C+QHE+DHLNGI+F D+LS LKR  + +K+ KL
Sbjct: 118 EYTLSAEGLLAICIQHEIDHLNGIVFADYLSPLKRQRMKEKLLKL 162


>gi|95928563|ref|ZP_01311310.1| Peptide deformylase [Desulfuromonas acetoxidans DSM 684]
 gi|95135353|gb|EAT17005.1| Peptide deformylase [Desulfuromonas acetoxidans DSM 684]
          Length = 171

 Score =  143 bits (361), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 104/161 (64%), Gaps = 6/161 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD +L  +S PI  ++ +I  L  +M E MY+  G+GLAA Q+G+  RL+V+D      
Sbjct: 9   YPDAVLAEMSEPIAVVDDEIRQLAADMAETMYAAPGVGLAAPQVGISRRLIVLDC---GG 65

Query: 69  RKNPMVF--INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYA 126
            +NP +   +NP+I+    D S  +EGCLS+P Y A VKRS+++ VRY+D + Q     A
Sbjct: 66  EENPELIKAVNPEILERQGD-SCEEEGCLSVPGYYAAVKRSSWVKVRYVDMDGQTVEREA 124

Query: 127 DGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           +GLLA C QHE+DHL+G LF+D LS LK+ M  KK  K+++
Sbjct: 125 EGLLAICFQHEIDHLDGKLFVDRLSSLKKGMFRKKYPKILE 165


>gi|254483306|ref|ZP_05096537.1| peptide deformylase [marine gamma proteobacterium HTCC2148]
 gi|214036401|gb|EEB77077.1| peptide deformylase [marine gamma proteobacterium HTCC2148]
          Length = 168

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR V+ P+  +      L+D+MLE MY+  GIGLAA Q+ V  R++VIDL +   
Sbjct: 9   FPDPRLRTVAAPVNSVTDKHRQLLDDMLETMYAAPGIGLAATQVNVHERILVIDLSEK-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +P+VFINP++     +   Y EGCLS+P Y   V R   I V+ +  + +      +G
Sbjct: 67  QNDPLVFINPEVEILDKELGEYDEGCLSVPGYYETVNRPQRIAVKALGRDGKPFSSEIEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA CLQHE+DHL+G LF+D+LS LKR+ I KK+ K
Sbjct: 127 LLAICLQHEIDHLDGKLFVDYLSPLKRNRIRKKLEK 162


>gi|88801027|ref|ZP_01116576.1| peptide deformylase [Reinekea sp. MED297]
 gi|88776230|gb|EAR07456.1| peptide deformylase [Reinekea sp. MED297]
          Length = 169

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 100/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR V++PIEK++ +I  L D+MLE MY   GIGLAA Q+    RL+V+D+ +   
Sbjct: 9   FPDPRLRTVAKPIEKVDGEIQKLADDMLETMYDAPGIGLAASQVDRHIRLIVVDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +P + INP+     +D   YQEGCLS+P Y   V RS  I+VR ++ +       A  
Sbjct: 67  QNDPHILINPEYDRLGEDIE-YQEGCLSVPGYYEKVSRSDRISVRALNRDGDAIEFEATD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           L A C+QHE+DHL+G LF+D+LS LKR  I KK+ K
Sbjct: 126 LFAICIQHEIDHLDGKLFVDYLSNLKRTRIRKKLEK 161


>gi|22127893|ref|NP_671316.1| peptide deformylase [Yersinia pestis KIM 10]
 gi|45440100|ref|NP_991639.1| peptide deformylase [Yersinia pestis biovar Microtus str. 91001]
 gi|51597955|ref|YP_072146.1| peptide deformylase [Yersinia pseudotuberculosis IP 32953]
 gi|108809222|ref|YP_653138.1| peptide deformylase [Yersinia pestis Antiqua]
 gi|108813987|ref|YP_649754.1| peptide deformylase [Yersinia pestis Nepal516]
 gi|145597483|ref|YP_001161558.1| peptide deformylase [Yersinia pestis Pestoides F]
 gi|150260710|ref|ZP_01917438.1| polypeptide deformylase [Yersinia pestis CA88-4125]
 gi|153950090|ref|YP_001402830.1| peptide deformylase [Yersinia pseudotuberculosis IP 31758]
 gi|162418261|ref|YP_001605206.1| peptide deformylase [Yersinia pestis Angola]
 gi|165927898|ref|ZP_02223730.1| peptide deformylase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936499|ref|ZP_02225067.1| peptide deformylase [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010552|ref|ZP_02231450.1| peptide deformylase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213183|ref|ZP_02239218.1| peptide deformylase [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167398768|ref|ZP_02304292.1| peptide deformylase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419139|ref|ZP_02310892.1| peptide deformylase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425700|ref|ZP_02317453.1| peptide deformylase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167468246|ref|ZP_02332950.1| peptide deformylase [Yersinia pestis FV-1]
 gi|170022577|ref|YP_001719082.1| peptide deformylase [Yersinia pseudotuberculosis YPIII]
 gi|186897151|ref|YP_001874263.1| peptide deformylase [Yersinia pseudotuberculosis PB1/+]
 gi|218927448|ref|YP_002345323.1| peptide deformylase [Yersinia pestis CO92]
 gi|229836276|ref|ZP_04456443.1| peptide deformylase [Yersinia pestis Pestoides A]
 gi|229840100|ref|ZP_04460259.1| peptide deformylase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842182|ref|ZP_04462337.1| peptide deformylase [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229904518|ref|ZP_04519629.1| peptide deformylase [Yersinia pestis Nepal516]
 gi|270488264|ref|ZP_06205338.1| peptide deformylase [Yersinia pestis KIM D27]
 gi|294502316|ref|YP_003566378.1| peptide deformylase [Yersinia pestis Z176003]
 gi|23396545|sp|Q8ZJ79|DEF_YERPE RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|81691640|sp|Q664V4|DEF_YERPS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123073067|sp|Q1CCX6|DEF_YERPN RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123372104|sp|Q1C2X9|DEF_YERPA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|158514064|sp|A4TH23|DEF_YERPP RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|167012067|sp|A7FNK2|DEF_YERP3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238687338|sp|A9R927|DEF_YERPG RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238688470|sp|B1JJH8|DEF_YERPY RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238691391|sp|B2K504|DEF_YERPB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|21961030|gb|AAM87567.1|AE014004_5 peptide deformylase [Yersinia pestis KIM 10]
 gi|45434955|gb|AAS60516.1| polypeptide deformylase [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591237|emb|CAH22903.1| polypeptide deformylase [Yersinia pseudotuberculosis IP 32953]
 gi|108777635|gb|ABG20154.1| peptide deformylase [Yersinia pestis Nepal516]
 gi|108781135|gb|ABG15193.1| peptide deformylase [Yersinia pestis Antiqua]
 gi|115346059|emb|CAL18925.1| polypeptide deformylase [Yersinia pestis CO92]
 gi|145209179|gb|ABP38586.1| peptide deformylase [Yersinia pestis Pestoides F]
 gi|149290118|gb|EDM40195.1| polypeptide deformylase [Yersinia pestis CA88-4125]
 gi|152961585|gb|ABS49046.1| peptide deformylase [Yersinia pseudotuberculosis IP 31758]
 gi|162351076|gb|ABX85024.1| peptide deformylase [Yersinia pestis Angola]
 gi|165915615|gb|EDR34224.1| peptide deformylase [Yersinia pestis biovar Orientalis str. IP275]
 gi|165920174|gb|EDR37475.1| peptide deformylase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990642|gb|EDR42943.1| peptide deformylase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205481|gb|EDR49961.1| peptide deformylase [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166963133|gb|EDR59154.1| peptide deformylase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051272|gb|EDR62680.1| peptide deformylase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055390|gb|EDR65184.1| peptide deformylase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749111|gb|ACA66629.1| peptide deformylase [Yersinia pseudotuberculosis YPIII]
 gi|186700177|gb|ACC90806.1| peptide deformylase [Yersinia pseudotuberculosis PB1/+]
 gi|229678636|gb|EEO74741.1| peptide deformylase [Yersinia pestis Nepal516]
 gi|229690492|gb|EEO82546.1| peptide deformylase [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696466|gb|EEO86513.1| peptide deformylase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706344|gb|EEO92351.1| peptide deformylase [Yersinia pestis Pestoides A]
 gi|262360396|gb|ACY57117.1| peptide deformylase [Yersinia pestis D106004]
 gi|262364346|gb|ACY60903.1| peptide deformylase [Yersinia pestis D182038]
 gi|270336768|gb|EFA47545.1| peptide deformylase [Yersinia pestis KIM D27]
 gi|294352775|gb|ADE63116.1| peptide deformylase [Yersinia pestis Z176003]
 gi|320013375|gb|ADV96946.1| peptide deformylase [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 170

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHQQIIVIDISEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   +  DG
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|119475268|ref|ZP_01615621.1| peptide deformylase [marine gamma proteobacterium HTCC2143]
 gi|119451471|gb|EAW32704.1| peptide deformylase [marine gamma proteobacterium HTCC2143]
          Length = 168

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++ ++ ++  I  L+D+ML  MY   GIGLAA QI +  R+VVID+ +   
Sbjct: 9   FPDPRLRTIAKTVDTVDESIRTLLDDMLVTMYDASGIGLAATQINIHQRIVVIDVSETGD 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP+II        Y+EGCLS+P +   V R   I V+ +D +     +  +G
Sbjct: 69  Q--PQVFINPEIIILDGPDHEYEEGCLSVPGFHETVSRPEKIIVKALDRDGNPFELQPEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHLNG LF+DH+S+LKR  I  K+ K
Sbjct: 127 LLAVCIQHEVDHLNGKLFVDHISQLKRKRIRAKLEK 162


>gi|148262893|ref|YP_001229599.1| peptide deformylase [Geobacter uraniireducens Rf4]
 gi|146396393|gb|ABQ25026.1| peptide deformylase [Geobacter uraniireducens Rf4]
          Length = 171

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 110/167 (65%), Gaps = 2/167 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M++K ++ FPDP L++ S+P+  IN+ ++ L+ +M E MY   G+GLAA QIGV  R+VV
Sbjct: 1   MIRK-ILTFPDPELKKKSQPVVVINNKVIELVRDMAETMYDAPGVGLAAPQIGVHQRIVV 59

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+         +V INP +I  +D  S  +EGCLSIP Y A+V+R   + V+ ++ + +
Sbjct: 60  IDVAGKDDPPQLIVAINP-VIIHADGESYEEEGCLSIPKYAANVRRHERVVVKALNLDGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                ADGLLA   QHE+DHL+GILFIDH+S LKR++  +K  + ++
Sbjct: 119 EITCKADGLLAIAFQHEIDHLDGILFIDHISPLKREIFRRKYRRTLE 165


>gi|261866825|ref|YP_003254747.1| peptide deformylase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391665|ref|ZP_06635999.1| peptide deformylase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261412157|gb|ACX81528.1| peptide deformylase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952199|gb|EFE02318.1| peptide deformylase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 170

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 107/157 (68%), Gaps = 3/157 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+P+  L+ V  P+ ++N +   +IDNM + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPEEHLKVVCDPVVEVNDNTRKIIDNMFDTMYQEGGIGLAAPQVDILQRIITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INP+I+    +  + +EGCLSIP +RA V R   +TV+ +D + +   + 
Sbjct: 65  -GDKQNQLVLINPEILESEGETGI-EEGCLSIPGFRALVPRKEKVTVKALDRHGKEFTLK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKL 159


>gi|148978497|ref|ZP_01814971.1| peptide deformylase [Vibrionales bacterium SWAT-3]
 gi|145962404|gb|EDK27684.1| peptide deformylase [Vibrionales bacterium SWAT-3]
          Length = 171

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PD  LR V++P++++  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTLPDDRLRTVAKPVKEVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+II    +  + +EGCLS+P  RA V R+A +TV+ +D +       
Sbjct: 66  T--RDEPMVLINPEIIEKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDRDGNEFTFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|326793337|ref|YP_004311157.1| peptide deformylase [Marinomonas mediterranea MMB-1]
 gi|326544101|gb|ADZ89321.1| Peptide deformylase [Marinomonas mediterranea MMB-1]
          Length = 168

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 106/155 (68%), Gaps = 4/155 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR V++ +E++  +I   ID+ML+ MY   GIGLAA Q+ +  R+VV+D  
Sbjct: 5   PVLEYPDPKLRTVAKEVEQVTPEIQAYIDDMLDTMYDESGIGLAATQVDIHLRIVVMD-- 62

Query: 65  DHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            H+  +N PMVFINP+ +   D+ + +QEGCLS+P Y   + R+A + V+ +D + +   
Sbjct: 63  -HSEERNEPMVFINPEFVVLDDEPNEFQEGCLSVPGYYEHIYRAAKVKVKALDRDGKPFE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
           +  D L+A C+QHE+DHL+G LF+D++S LKR+ I
Sbjct: 122 MEVDELMAVCVQHEIDHLDGKLFVDYISPLKRNRI 156


>gi|167950832|ref|ZP_02537906.1| peptide deformylase [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 194

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 104/161 (64%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P+ +++  I  L+D+M E MY   GIGLAA Q+ V  +++VIDL +   
Sbjct: 27  FPDSRLRNKAKPVSQVDDAIRKLVDDMFETMYEAPGIGLAATQVNVAKQIIVIDLSEE-- 84

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P+  INP+I++   +  +  EGCLS+P     VKR+A I+VR +D +     +  +G
Sbjct: 85  KNQPLCLINPEILSKEGEEKM-DEGCLSVPGIYESVKRAARISVRALDRDGAPFELETEG 143

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHLNG LF+D+LS LKR  I K++ K  +LR
Sbjct: 144 LLAVCIQHEIDHLNGKLFVDYLSSLKRQRIRKRLEKESRLR 184


>gi|260583339|ref|ZP_05851112.1| peptide deformylase [Haemophilus influenzae NT127]
 gi|260093610|gb|EEW77525.1| peptide deformylase [Haemophilus influenzae NT127]
          Length = 169

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V  P+ ++N  I  ++D+M + MY   GIGLAA Q+ +L R++ ID++ 
Sbjct: 6   VLIYPDDHLKVVCEPVAEVNDAIRKIVDDMFDTMYQEKGIGLAAPQVDILQRIITIDVE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N  V INP+I+    +  + +EGCLSIP +RA V R   + VR +D + +   + 
Sbjct: 65  -GDKQNQFVLINPEILASEGETGI-EEGCLSIPGFRALVPRKEKVKVRALDRDGKEFTLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGILF+D+LS LKR  I +K+ K
Sbjct: 123 ADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIK 161


>gi|227328917|ref|ZP_03832941.1| peptide deformylase [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 170

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N+DI  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRITAQPVKEVNADIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++I  S D  + +EGCLSIP+ RA V R+  + VR +D   +   + A  
Sbjct: 67  RDQRLVLINPELIEKSGDTGI-EEGCLSIPETRALVPRAEHVKVRALDREGKAFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKLEKLAK 164


>gi|88860597|ref|ZP_01135234.1| N-terminal methionine peptide deformylase [Pseudoalteromonas
           tunicata D2]
 gi|88817192|gb|EAR27010.1| N-terminal methionine peptide deformylase [Pseudoalteromonas
           tunicata D2]
          Length = 167

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ +++  I  ++ +M + MY   GIGLAA Q  +  R+VVID+ +   
Sbjct: 9   FPDERLRTIAKPVTQVDDSIKKIVADMFDTMYEESGIGLAATQANIHLRIVVIDVTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + + +V INP+I T  D  ++ +EGCLS+P+  A V R+  +TV+ ++ + Q   + ADG
Sbjct: 67  KSDQLVLINPEI-TKKDGSTISEEGCLSVPNSYAKVDRAETVTVKALNLDGQEFSLDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHELDHL G LF+D+LS LKRD I KK+ K  ++
Sbjct: 126 LLAICIQHELDHLQGKLFVDYLSPLKRDRIRKKLEKEAKM 165


>gi|171464332|ref|YP_001798445.1| peptide deformylase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|238692833|sp|B1XSN2|DEF_POLNS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|171193870|gb|ACB44831.1| peptide deformylase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 171

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/159 (41%), Positives = 107/159 (67%), Gaps = 2/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PD  L +V++P+ ++++ I  ++ +M + MY   G+GLAA Q+ +  R+VVID+ D
Sbjct: 6   VLCYPDSRLHKVAKPVAQVDARIKKIVADMADTMYEAPGVGLAATQVDIHERIVVIDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +   MVFINP+I+  S +   ++EGCLS+P++  +V+R A I V+ +D + +   I 
Sbjct: 66  E--QNELMVFINPEIVWTSSETKSWREGCLSVPEFYDEVERPAEIRVKALDIDGKEFEIE 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADG LA CLQHELDHL G +F+++LS  KR  I++KM K
Sbjct: 124 ADGSLAVCLQHELDHLQGKVFVEYLSIFKRTRISQKMKK 162


>gi|253690150|ref|YP_003019340.1| peptide deformylase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|259645184|sp|C6DFR5|DEF_PECCP RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|251756728|gb|ACT14804.1| peptide deformylase [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 170

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N+DI  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRITAQPVKEVNADIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++I  S D  + +EGCLSIP+ RA V R+  + VR +D   +   + A  
Sbjct: 67  RDQRLVLINPELIEKSGDTGI-EEGCLSIPETRALVPRAEHVKVRALDREGKTFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKLEKLAK 164


>gi|156932268|ref|YP_001436184.1| peptide deformylase [Cronobacter sakazakii ATCC BAA-894]
 gi|166198516|sp|A7MPE9|DEF_ENTS8 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|156530522|gb|ABU75348.1| hypothetical protein ESA_00039 [Cronobacter sakazakii ATCC BAA-894]
          Length = 171

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 112/161 (69%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR V+ P++++N+DI  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRIVAEPVKEVNADIQRIVDDMFDTMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEQSGETGI-EEGCLSIPEQRAFVPRAEKVKIRALDRDGKSFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS +KR  I +K+ KL +++
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPMKRQRIRQKVEKLDRMK 166


>gi|15617090|ref|NP_240303.1| polypeptide deformylase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681842|ref|YP_002468228.1| polypeptide deformylase [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|219682397|ref|YP_002468781.1| polypeptide deformylase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471547|ref|ZP_05635546.1| peptide deformylase [Buchnera aphidicola str. LSR1 (Acyrthosiphon
           pisum)]
 gi|11131992|sp|P57563|DEF_BUCAI RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767572|sp|B8D9R9|DEF_BUCA5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|254767573|sp|B8D821|DEF_BUCAT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|25303709|pir||E84987 formylmethionine deformylase (EC 3.5.1.31) [imported] - Buchnera
           sp. (strain APS)
 gi|10039155|dbj|BAB13189.1| polypeptide deformylase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622130|gb|ACL30286.1| polypeptide deformylase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624685|gb|ACL30840.1| polypeptide deformylase [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
          Length = 173

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 108/157 (68%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+++IN  I  + ++M++ MY  +GIGLAA Q+ +  +++V++  +   
Sbjct: 9   YPDIRLRILAKPVKEINKKIQKIANDMIDTMYQEEGIGLAATQVNIPLQIIVVNTMEQ-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +KN +V INPKII    D S+ +EGCLSIP+Y+A + RS +I V+ ++ + +   I A  
Sbjct: 67  KKNNLVLINPKIIKKEGDISI-EEGCLSIPEYQASIPRSNYIQVQAVNLDGEKIEIEAKS 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +L+ C+QHE+DHL G LFID+LS+ KR+ I KK  K+
Sbjct: 126 ILSICIQHEIDHLKGKLFIDYLSKFKRERIQKKFEKI 162


>gi|311109268|ref|YP_003982121.1| peptide deformylase 2 [Achromobacter xylosoxidans A8]
 gi|310763957|gb|ADP19406.1| peptide deformylase 2 [Achromobacter xylosoxidans A8]
          Length = 170

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 108/160 (67%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L + ++P+ +++  I  L+ +M E MY   G+GLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRYPDPRLHKKAKPVAEVDDRIRQLVRDMAETMYDAPGVGLAATQVDVHERVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           + +++   +V INP+I   SDD+ +Y+EGCLS+P    DV+R++ I  + +D + +    
Sbjct: 65  EDSNQL--LVLINPEITWHSDDYKIYEEGCLSVPGVYDDVERASRIRCKALDVDGKPFEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G +F+++LS LK++ I  ++ K
Sbjct: 123 EADGLLAVCVQHELDHLEGKVFVEYLSSLKQNRIKTRLKK 162


>gi|188535243|ref|YP_001909040.1| peptide deformylase [Erwinia tasmaniensis Et1/99]
 gi|238692005|sp|B2VK93|DEF_ERWT9 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|188030285|emb|CAO98174.1| Peptide deformylase [Erwinia tasmaniensis Et1/99]
          Length = 169

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 109/157 (69%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P++++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRIVAKPVKEVNANIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V I+P+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + ADG
Sbjct: 67  RDERLVLIDPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNSFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LFID+LS +KR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPMKRQRIRQKLEKL 162


>gi|167648525|ref|YP_001686188.1| peptide deformylase [Caulobacter sp. K31]
 gi|189083067|sp|B0T1S9|DEF_CAUSK RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|167350955|gb|ABZ73690.1| peptide deformylase [Caulobacter sp. K31]
          Length = 173

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 97/152 (63%)

Query: 13  ILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNP 72
           +L++VS+ +  ++  +  L+D+MLE MY   GIGLAAVQ+G L  ++V+DL        P
Sbjct: 17  VLKQVSKDVPAVDDALRGLMDDMLETMYDAPGIGLAAVQVGELVNVIVMDLAREGEEPAP 76

Query: 73  MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLAT 132
             F+NPKI   S++   Y+EGCLS+P+    V+R A + + Y++   +     A+ L A 
Sbjct: 77  RYFVNPKITWASEELFEYEEGCLSVPEVYDAVERPAKVKISYLNYQGEAVEEDAEELFAV 136

Query: 133 CLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           C+QHE+DHL G+LFIDHLSRLKRD    K+ K
Sbjct: 137 CIQHEMDHLKGVLFIDHLSRLKRDRAISKVKK 168


>gi|50122919|ref|YP_052086.1| peptide deformylase [Pectobacterium atrosepticum SCRI1043]
 gi|81693081|sp|Q6D002|DEF_ERWCT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|49613445|emb|CAG76896.1| peptide deformylase [Pectobacterium atrosepticum SCRI1043]
          Length = 169

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N+DI  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRITAQPVKEVNADIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++I  S D  + +EGCLSIP+ RA V R+  + VR +D   +   + A  
Sbjct: 67  RDQRLVLINPELIEKSGDTGI-EEGCLSIPETRALVPRAEHVKVRALDREGKAFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKLEKLAK 164


>gi|298529648|ref|ZP_07017051.1| peptide deformylase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511084|gb|EFI34987.1| peptide deformylase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 169

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 105/159 (66%), Gaps = 1/159 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD IL + +RP+EKI+  I++L  +M  +MY   GIGLAA Q+G   R+V +DL    +
Sbjct: 8   YPDKILTQKARPVEKIDDYIIDLSRDMARLMYEHRGIGLAAPQVGESLRVVTVDLSGPDN 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +++   +INP+II  S+D +  +EGCLS+  Y+  V R+  + VR ++   +  I   + 
Sbjct: 68  QEDLFTYINPEIIA-SEDETTTEEGCLSVAGYQTRVCRARKVKVRALNLQGEEVIHEGED 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           L A CLQHE+DHLNGILFIDH+SRLKR M  KK+ K ++
Sbjct: 127 LWAVCLQHEIDHLNGILFIDHISRLKRAMYDKKVKKWLE 165


>gi|239948084|ref|ZP_04699837.1| peptide deformylase [Rickettsia endosymbiont of Ixodes scapularis]
 gi|241563350|ref|XP_002401667.1| polypeptide deformylase, putative [Ixodes scapularis]
 gi|215501859|gb|EEC11353.1| polypeptide deformylase, putative [Ixodes scapularis]
 gi|239922360|gb|EER22384.1| peptide deformylase [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 175

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 106/166 (63%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+M++ MY  DG GLAAVQ+GVL R++VID++
Sbjct: 5   PIVKAPDERLKQKSQPVLEFTDQTRKFMDDMIKTMYHEDGAGLAAVQVGVLKRILVIDIK 64

Query: 65  DHAHRKNP-----MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   + P     +  +NP+II  S++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 65  DHDSVERPKDLYPLFIVNPEIIEKSEELVTANEGCISLPEQRIEVARPESIKIRYLDYHN 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KQQELEANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|117923458|ref|YP_864075.1| peptide deformylase [Magnetococcus sp. MC-1]
 gi|117607214|gb|ABK42669.1| peptide deformylase [Magnetococcus sp. MC-1]
          Length = 173

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 98/156 (62%), Gaps = 4/156 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL- 63
           P+V  PDP+L++ + P+  +++ I  L+ +MLE MY+  GIGLAA Q+GV  R++V+D+ 
Sbjct: 5   PIVTAPDPVLKKRAEPVVAVDASIQQLMRDMLETMYAAPGIGLAAPQVGVSKRVIVVDVT 64

Query: 64  --QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
             +  A    P    NP+II    + + ++EGCLS+P+    V R   + VR ++   + 
Sbjct: 65  YSEAAAQDGEPYCLANPEIIAAEGEIT-WEEGCLSVPESYGKVDRKEHVVVRGLNAQGEL 123

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
             + A GL A CLQHE+DHL+G LFIDHLS LKR M
Sbjct: 124 VTLEAHGLFAVCLQHEIDHLDGTLFIDHLSSLKRTM 159


>gi|330831510|ref|YP_004394462.1| peptide deformylase 1 [Aeromonas veronii B565]
 gi|328806646|gb|AEB51845.1| Peptide deformylase 1 [Aeromonas veronii B565]
          Length = 170

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V+ P+E    ++  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRTVAAPVETFTPELQQIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R++P+V INP++I       + +EGCLS+P  RA V R+  I +R +D N +   + AD 
Sbjct: 67  REDPLVLINPEVIEQCGSTGI-EEGCLSVPGSRALVPRAEQIKIRALDRNGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAR 164


>gi|300946508|ref|ZP_07160774.1| peptide deformylase [Escherichia coli MS 116-1]
 gi|300955324|ref|ZP_07167706.1| peptide deformylase [Escherichia coli MS 175-1]
 gi|300317768|gb|EFJ67552.1| peptide deformylase [Escherichia coli MS 175-1]
 gi|300453814|gb|EFK17434.1| peptide deformylase [Escherichia coli MS 116-1]
          Length = 169

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 113/161 (70%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +  +D + +   + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKICALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 126 LLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 166


>gi|88608268|ref|YP_506280.1| peptide deformylase [Neorickettsia sennetsu str. Miyayama]
 gi|123763725|sp|Q2GE16|DEF_NEOSM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|88600437|gb|ABD45905.1| peptide deformylase [Neorickettsia sennetsu str. Miyayama]
          Length = 186

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 109/173 (63%), Gaps = 13/173 (7%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ- 64
           L+I PDP+L  VS  +  ++ +    +D+MLE MY   GIGLAAVQ+GVL R++V+D+  
Sbjct: 6   LIIEPDPLLHEVSEAVAGLSDEKRVFLDDMLETMYHCGGIGLAAVQVGVLERIIVVDVPV 65

Query: 65  ---------DHAHRKN---PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
                    +H   K+   P  F+NP+II FS +     EGCLS+P+   ++ R   + V
Sbjct: 66  GKEWHSSPLNHVGYKSSGGPYYFVNPEIIEFSQNLVPADEGCLSLPEQHYEIIRPDAVVV 125

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +Y++ + +  ++ A+G LA C+QHE+DHLNG L++ HLS+LK D+  KK +++
Sbjct: 126 KYLNYDGEECLLKANGWLARCIQHEMDHLNGRLYVSHLSKLKHDLAIKKAAEI 178


>gi|325272511|ref|ZP_08138888.1| peptide deformylase [Pseudomonas sp. TJI-51]
 gi|324102354|gb|EGB99823.1| peptide deformylase [Pseudomonas sp. TJI-51]
          Length = 168

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 101/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+   +  +  LID+M E MY   GIGLAA Q+ V  ++VV+DL +   
Sbjct: 9   FPDPRLRTIAKPVTVFDDALRQLIDDMFETMYEAPGIGLAATQVNVHQQVVVMDLSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +   +DD   YQEGCLS+P +  +V R   + V+  D + +   +  +G
Sbjct: 67  RSEPRVFINPTVEELTDDMGQYQEGCLSVPGFYENVDRPLRVRVKAQDRDGKPFELECEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DHLNG LF+D+LS+LKRD I KK+ K
Sbjct: 127 LLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEK 162


>gi|227115518|ref|ZP_03829174.1| peptide deformylase [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 170

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 106/159 (66%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++P++++N+DI  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRITAQPVKEVNADIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++I  S D  + +EGCLSIP+ RA V R+  + VR +D   +   + A  
Sbjct: 67  RDQRLVLINPELIEKSGDTGI-EEGCLSIPETRALVPRAEHVKVRALDREGKPFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKLEKLAK 164


>gi|241760428|ref|ZP_04758522.1| peptide deformylase [Neisseria flavescens SK114]
 gi|241319097|gb|EER55590.1| peptide deformylase [Neisseria flavescens SK114]
          Length = 167

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+EKI+  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEKIDERIQTLVADMFETMYEARGIGLAATQVDVHERIVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++HLS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVEHLSQLKQGRIKTKLKK 161


>gi|225075032|ref|ZP_03718231.1| hypothetical protein NEIFLAOT_00031 [Neisseria flavescens
           NRL30031/H210]
 gi|261380545|ref|ZP_05985118.1| peptide deformylase [Neisseria subflava NJ9703]
 gi|319639522|ref|ZP_07994269.1| peptide deformylase [Neisseria mucosa C102]
 gi|224953637|gb|EEG34846.1| hypothetical protein NEIFLAOT_00031 [Neisseria flavescens
           NRL30031/H210]
 gi|284796513|gb|EFC51860.1| peptide deformylase [Neisseria subflava NJ9703]
 gi|317399093|gb|EFV79767.1| peptide deformylase [Neisseria mucosa C102]
          Length = 167

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+EKI+  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEKIDERIQTLVADMFETMYEARGIGLAATQVDVHERIVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++HLS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVEHLSQLKQGRIKTKLKK 161


>gi|238792969|ref|ZP_04636599.1| Peptide deformylase 2 [Yersinia intermedia ATCC 29909]
 gi|238727823|gb|EEQ19347.1| Peptide deformylase 2 [Yersinia intermedia ATCC 29909]
          Length = 170

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHKQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + VR +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKVRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|238758793|ref|ZP_04619967.1| Peptide deformylase 2 [Yersinia aldovae ATCC 35236]
 gi|238703090|gb|EEP95633.1| Peptide deformylase 2 [Yersinia aldovae ATCC 35236]
          Length = 170

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHKQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + VR +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKVRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|188574933|ref|YP_001911862.1| peptide deformylase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188519385|gb|ACD57330.1| peptide deformylase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 152

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 97/135 (71%), Gaps = 5/135 (3%)

Query: 31  LIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKN-PMVFINPKIITFSDDFSV 89
           L+D+M + MY   GIGLAA Q+ V  R +VID+ D    KN P VF+NP+I++   +  +
Sbjct: 16  LLDDMFQTMYEAPGIGLAASQVDVHKRFMVIDVSD---EKNLPQVFVNPEIVSKQGE-QL 71

Query: 90  YQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDH 149
            QEGCLS+P   ADV R+  ITVRY+D   Q Q ++ADGLLA C+QHE+DHL+G LF+D+
Sbjct: 72  CQEGCLSVPGIYADVSRADAITVRYLDRQGQAQELHADGLLAVCIQHEMDHLDGKLFVDY 131

Query: 150 LSRLKRDMITKKMSK 164
           LS LKR+M+ KK++K
Sbjct: 132 LSPLKREMVRKKLAK 146


>gi|91791393|ref|YP_561044.1| peptide deformylase [Shewanella denitrificans OS217]
 gi|91713395|gb|ABE53321.1| peptide deformylase [Shewanella denitrificans OS217]
          Length = 170

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 102/161 (63%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR ++ P+      +   ID+M+E MY+  GIGLAA Q+    +L+V+DLQD   
Sbjct: 9   FPDERLRTIAVPVTDFGPQLQAQIDSMIETMYAEKGIGLAASQVDFHQQLIVMDLQDDIE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P +FINP+I+  S +FS  +EGCLS+P   A V R+ F+T++ +D + +   + AD 
Sbjct: 69  R--PKIFINPEIVAKSGEFS-NEEGCLSVPGVYAKVDRAEFVTLKALDRDGKPFTVEADE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           L A C+QHE+DHL G LF+D+LS LKR  I  K+ K  +L 
Sbjct: 126 LFAICIQHEMDHLKGKLFVDYLSPLKRQRIKTKLEKEARLE 166


>gi|238752657|ref|ZP_04614128.1| Peptide deformylase 2 [Yersinia rohdei ATCC 43380]
 gi|238709084|gb|EEQ01331.1| Peptide deformylase 2 [Yersinia rohdei ATCC 43380]
          Length = 170

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++NS+I  ++D+M + MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNSEIQRIVDDMFDTMYAEEGIGLAATQVDVHLQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKLAKL 165


>gi|118578953|ref|YP_900203.1| peptide deformylase [Pelobacter propionicus DSM 2379]
 gi|118501663|gb|ABK98145.1| peptide deformylase [Pelobacter propionicus DSM 2379]
          Length = 172

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 101/154 (65%), Gaps = 1/154 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++ +P+P L++ S  +  I  +I  L+ +M E MY   G+GLAA QIGV  R+++ID+
Sbjct: 3   RTILTYPNPELKKKSAAVTIITDEIRELVSDMTETMYHAPGVGLAAPQIGVHQRVIIIDV 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
             H      ++ INP +I  ++  S  +EGCLS+P Y A+V+R A +TVR +D   + Q 
Sbjct: 63  SAHDEPNELIIAINP-VIVHAEGESYEEEGCLSVPKYAANVRRHASVTVRGLDLEGREQT 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
            +A+GLLA   QHE+DHL+G LF+DHLS LKRD+
Sbjct: 122 WHAEGLLAIAFQHEIDHLDGRLFVDHLSPLKRDL 155


>gi|238921409|ref|YP_002934924.1| peptide deformylase (PDF) [Edwardsiella ictaluri 93-146]
 gi|259645180|sp|C5BF17|DEF_EDWI9 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238870978|gb|ACR70689.1| peptide deformylase (PDF) [Edwardsiella ictaluri 93-146]
          Length = 171

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 106/157 (67%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ ++  +I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRTIAKPVHEVTPEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++    +  + +EGCLS+P+ RA V R+  I VR +D + +   +  DG
Sbjct: 67  RDQRLVLINPELLQHDGEAGI-EEGCLSVPEQRALVTRAENIKVRALDRDGKSFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLMGKLFIDYLSPLKRQRIRQKLEKL 162


>gi|261346901|ref|ZP_05974545.1| peptide deformylase [Providencia rustigianii DSM 4541]
 gi|282564968|gb|EFB70503.1| peptide deformylase [Providencia rustigianii DSM 4541]
          Length = 173

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 108/161 (67%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EK+++ I  ++D+M E MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRTIAKPVEKVDASIQRIVDDMFETMYDEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++I    +  + +EGCLSIP+ +  V R+  + VR ++ N +   + ADG
Sbjct: 67  RSERLVLINPELIDKKGETGI-EEGCLSIPEQQGFVARAEQVKVRALNYNGELFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL + R
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKLDRQR 166


>gi|327398774|ref|YP_004339643.1| peptide deformylase [Hippea maritima DSM 10411]
 gi|327181403|gb|AEA33584.1| Peptide deformylase [Hippea maritima DSM 10411]
          Length = 168

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 102/158 (64%), Gaps = 2/158 (1%)

Query: 8   IFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA 67
           ++PD ILR+ ++ +EKI+  I++L++ M E MY  +GIGLAA Q+G+  +LVVIDL+   
Sbjct: 5   VYPDGILRKKAKDVEKIDDRIVDLLNQMRETMYKFNGIGLAAEQVGLQEKLVVIDLRPDG 64

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVK-RSAFITVRYMDCNAQHQIIYA 126
            +  P+  INP II     F  ++EGCLS+P Y   VK R  +I V+Y+D N   QI+  
Sbjct: 65  -KNQPIELINPVIIASEGIFEEHEEGCLSVPGYYDVVKDRKKWIKVKYLDRNENEQILET 123

Query: 127 DGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           D  L+  +QHE+DHLNG LFIDHL   +++   K+  K
Sbjct: 124 DEFLSVVIQHEIDHLNGKLFIDHLPPTRKEFFKKQWKK 161


>gi|238763701|ref|ZP_04624660.1| Peptide deformylase 2 [Yersinia kristensenii ATCC 33638]
 gi|238698003|gb|EEP90761.1| Peptide deformylase 2 [Yersinia kristensenii ATCC 33638]
          Length = 170

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHLQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|254467786|ref|ZP_05081192.1| peptide deformylase [beta proteobacterium KB13]
 gi|207086596|gb|EDZ63879.1| peptide deformylase [beta proteobacterium KB13]
          Length = 166

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (64%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +++  +E  +     L+ +M E MY + GIGLAA Q+ V  R++VID+ D   
Sbjct: 9   YPDPRLHKIAEIVEVFDESTEKLVQDMAETMYESKGIGLAATQVDVHRRIIVIDISDD-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +K+ +V INPK+I F D    Y EGCLS+P +   VKR   IT+ Y D     + + ADG
Sbjct: 67  KKDLLVLINPKLIKF-DGQQEYDEGCLSVPGFFETVKRYENITISYQDLKGNIKTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LL+ C+QHE+DHL G +FI++LS+LK+  I KK+SKL
Sbjct: 126 LLSVCIQHEMDHLVGKVFIEYLSQLKQQRIKKKISKL 162


>gi|317401262|gb|EFV81903.1| peptide deformylase 1 [Achromobacter xylosoxidans C54]
          Length = 170

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 108/160 (67%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L + ++P+ +++  I  L+ +M E MY   G+GLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRYPDPRLHKKAKPVAEVDDRIRQLVRDMAETMYDAPGVGLAATQVDVHERVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           + +++   +V INP+I   SDD+ +Y+EGCLS+P    +V+R++ I  + +D + +    
Sbjct: 65  EESNQL--LVLINPEITWRSDDYKIYEEGCLSVPGIYDEVERASRIRCKALDIDGKPFEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G +F+++LS LK++ I  K+ K
Sbjct: 123 DADGLLAVCVQHELDHLEGKVFVEYLSNLKQNRIKTKLKK 162


>gi|157964273|ref|YP_001499097.1| peptide deformylase [Rickettsia massiliae MTU5]
 gi|157844049|gb|ABV84550.1| Polypeptide deformylase [Rickettsia massiliae MTU5]
          Length = 176

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 107/166 (64%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID++
Sbjct: 6   PIVTAPDERLKQKSQPVLEFTDQTRKFMDDMLKTMYHKDGAGLAAVQVGVLKRILVIDIK 65

Query: 65  DH---AHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   A  K+  P+  +NP+II  S++     EGC+S+P+ R +V R   I +R +D + 
Sbjct: 66  DHDSVARPKDFYPLFIVNPEIIEKSEELVTANEGCISLPEQRIEVARPESIKIRCLDYHG 125

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 126 KSQELQANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 171


>gi|291278698|ref|YP_003495533.1| formylmethionine deformylase [Deferribacter desulfuricans SSM1]
 gi|290753400|dbj|BAI79777.1| formylmethionine deformylase [Deferribacter desulfuricans SSM1]
          Length = 172

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +P+PILRR S+ +++I+  ++ LID+M+E MY+  G+GLAA Q+GV  R++VID   
Sbjct: 5   IVKYPNPILRRKSKEVKEIDGRVIKLIDDMVETMYAAPGLGLAAPQVGVNERILVIDPSA 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +   +  INP +I  +D   + +EGCLSIP   A+V+R+A + V+ +D + +   I 
Sbjct: 65  GEDKSKLIKIINP-VIVEADGEVIEEEGCLSIPGEYANVRRAAKVLVKGLDVDGKEVEIE 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           A+ LLA   QHE+DHLNG+LFID LS  KR+ I K + K +   D
Sbjct: 124 AEDLLARAFQHEIDHLNGVLFIDRLSPTKRETIQKHIKKRIAAGD 168


>gi|269140540|ref|YP_003297241.1| peptide deformylase [Edwardsiella tarda EIB202]
 gi|267986201|gb|ACY86030.1| peptide deformylase [Edwardsiella tarda EIB202]
 gi|304560325|gb|ADM42989.1| Peptide deformylase [Edwardsiella tarda FL6-60]
          Length = 171

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 106/157 (67%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++P+ ++  +I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   FPDERLRTIAKPVHEVTPEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++    +  + +EGCLS+P+ RA V R+  I VR +D + +   +  DG
Sbjct: 67  RDQRLVLINPELLQHDGEAGI-EEGCLSVPEQRALVTRAESIKVRALDRDGKPFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLMGKLFIDYLSPLKRQRIRQKLEKL 162


>gi|67458716|ref|YP_246340.1| peptide deformylase [Rickettsia felis URRWXCal2]
 gi|67004249|gb|AAY61175.1| Polypeptide deformylase [Rickettsia felis URRWXCal2]
          Length = 175

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 106/166 (63%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+M++ MY  DG GLAAVQ+GVL R++VID++
Sbjct: 5   PIVTAPDDRLKQKSQPVLEFTDQTRKFMDDMVKTMYHEDGGGLAAVQVGVLKRIMVIDIK 64

Query: 65  DHAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   + P  F     +NP+II  S++     EGC+S+P+ R +V R   I +RY+D + 
Sbjct: 65  DHDPIERPKDFYPLFIVNPEIIEKSEELITANEGCISVPEQRIEVARPESIKIRYLDYHG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KSQELEANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|238797211|ref|ZP_04640712.1| Peptide deformylase 2 [Yersinia mollaretii ATCC 43969]
 gi|238718848|gb|EEQ10663.1| Peptide deformylase 2 [Yersinia mollaretii ATCC 43969]
          Length = 170

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHLQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|123444064|ref|YP_001008034.1| peptide deformylase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|238788878|ref|ZP_04632668.1| Peptide deformylase 2 [Yersinia frederiksenii ATCC 33641]
 gi|332163227|ref|YP_004299804.1| peptide deformylase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|158512897|sp|A1JRZ1|DEF_YERE8 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|122091025|emb|CAL13908.1| polypeptide deformylase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238722905|gb|EEQ14555.1| Peptide deformylase 2 [Yersinia frederiksenii ATCC 33641]
 gi|318607709|emb|CBY29207.1| peptide deformylase [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325667457|gb|ADZ44101.1| peptide deformylase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330861818|emb|CBX71990.1| peptide deformylase [Yersinia enterocolitica W22703]
          Length = 170

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 111/160 (69%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHLQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|157825411|ref|YP_001493131.1| peptide deformylase [Rickettsia akari str. Hartford]
 gi|166198521|sp|A8GMJ8|DEF_RICAH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|157799369|gb|ABV74623.1| peptide deformylase [Rickettsia akari str. Hartford]
          Length = 175

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 105/166 (63%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S+P+ +        +D+ML+ MY  DG GLAAVQ+GVL R++VID++
Sbjct: 5   PIVTAPDDRLKQKSQPVLEFTDQTRKFMDDMLKTMYHEDGAGLAAVQVGVLKRILVIDIK 64

Query: 65  DHAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   + P  F     +NP++I  S++     EGC+S+P  R +V R   I +RY+D + 
Sbjct: 65  DHDSVERPKDFYPLFIVNPEMIEKSEELIKSNEGCISVPGQRIEVARPESIKIRYLDYHG 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KSQELKANDWLARVIQHEYDHLEGKLMIDYLSNLKRDVVLRKLKKL 170


>gi|238898789|ref|YP_002924471.1| peptide deformylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259645182|sp|C4K6Y0|DEF_HAMD5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|229466549|gb|ACQ68323.1| peptide deformylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 171

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 109/162 (67%), Gaps = 3/162 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+++ P++K++  I  + D+MLE MY  +GIGLAA Q+ +  R++VID+ +  H
Sbjct: 9   FPDDRLRKIASPVKKMDDQIRQIADDMLETMYQAEGIGLAATQVNIHQRIIVIDVSEDRH 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P++ INP+++  S +  + +EGCLSIP  +A + R+  IT++ ++   +   + AD 
Sbjct: 69  Q--PLILINPELLEKSGETGI-EEGCLSIPGEKAFIPRAKEITIQALNREGRSFRLSADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           LLA C+QHE+DHL G LF+D+LS  KR  I KKM KL ++ +
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPFKRQRIQKKMEKLQKINE 167


>gi|189426265|ref|YP_001953442.1| peptide deformylase [Geobacter lovleyi SZ]
 gi|189422524|gb|ACD96922.1| peptide deformylase [Geobacter lovleyi SZ]
          Length = 166

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 104/161 (64%), Gaps = 1/161 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           +P++ FPDP+L++ S P+  I  +I+ L  +M E MY   G+GLAA QIGVL R++VID+
Sbjct: 3   RPILAFPDPLLKQKSAPVTIITDEIIQLARDMAETMYDAPGVGLAAPQIGVLQRVIVIDV 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                    +  INP ++   +  +  +EGCLS+PD+ A+VKR   + V+ +    Q +I
Sbjct: 63  AAKNEPPQLITAINP-VVIHGEGETYEEEGCLSVPDFSANVKRHERVVVKGLSLEGQERI 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            +ADGLLA   QHE+DHL+GILF+D LS LKRD+  KK  K
Sbjct: 122 WHADGLLAVAFQHEIDHLDGILFVDRLSPLKRDLFVKKCKK 162


>gi|310778475|ref|YP_003966808.1| peptide deformylase [Ilyobacter polytropus DSM 2926]
 gi|309747798|gb|ADO82460.1| peptide deformylase [Ilyobacter polytropus DSM 2926]
          Length = 170

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 4/157 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           + DP+LR+ + P+E +N +I  +ID+M+E M+   G+GLAA QIGV  R+ VID++D   
Sbjct: 8   YGDPVLRKEALPVEDVNDEIREIIDSMVESMHEAGGVGLAAPQIGVSKRIFVIDIEDGKI 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           RK     INP+ + FS +   ++EGCLS+P     VKR A + ++Y + N +  I  A+G
Sbjct: 68  RK----VINPEFLEFSKEIVEHEEGCLSVPGVYKKVKRPARVKIKYTNENGEKVIEEAEG 123

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LL+   QHE DHL+  LF+D LS + + M++KK+  L
Sbjct: 124 LLSRAFQHEADHLDATLFVDKLSPVAKRMVSKKLQAL 160


>gi|304415447|ref|ZP_07396096.1| peptide deformylase [Candidatus Regiella insecticola LSR1]
 gi|304282711|gb|EFL91225.1| peptide deformylase [Candidatus Regiella insecticola LSR1]
          Length = 200

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 110/167 (65%), Gaps = 10/167 (5%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD--- 65
           FPD  LR++++P+EKI+++I  ++D+M + +Y+ +GIGLAA Q+ +  +++VI + D   
Sbjct: 32  FPDVQLRKIAKPVEKIDANIERIVDDMFDTIYAEEGIGLAATQVNIHKQIIVIHIPDDSD 91

Query: 66  -----HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
                 AH + P+V INP+++  S +  + +EGCLSIP  R  VKRS  + +R +D +  
Sbjct: 92  QNERIEAHYR-PLVLINPELLEESGETGI-KEGCLSIPGVREWVKRSERVKIRALDRDGN 149

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              + ADGLLA C+QHE+DHL G LFID+LS LK   I KK+ K  Q
Sbjct: 150 SFTLEADGLLAICIQHEMDHLKGKLFIDYLSPLKFQRIQKKIRKKAQ 196


>gi|77359005|ref|YP_338580.1| N-terminal methionine peptide deformylase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123587108|sp|Q3IDI2|DEF_PSEHT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|76873916|emb|CAI85137.1| N-terminal methionine peptide deformylase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 167

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 102/156 (65%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR +++ +  ++  +  +I +MLE MY  +GIGLAA Q+ +  R+VVID+ +   
Sbjct: 9   FPDERLRTIAQEVAHVDDQVRVIIKDMLETMYDENGIGLAATQVNIHQRIVVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P+V INP+II   D  +V +EGCLS+P+  A V R+  +TV  ++   +  ++ AD 
Sbjct: 67  RNEPLVLINPQIIK-KDGTTVSEEGCLSVPNSYAKVDRAETVTVAALNEQGEEFVLDADE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL G LFID+LS LKR  I KK+ K
Sbjct: 126 LLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEK 161


>gi|84393441|ref|ZP_00992198.1| peptide deformylase [Vibrio splendidus 12B01]
 gi|86147129|ref|ZP_01065445.1| peptide deformylase [Vibrio sp. MED222]
 gi|84375957|gb|EAP92847.1| peptide deformylase [Vibrio splendidus 12B01]
 gi|85835013|gb|EAQ53155.1| peptide deformylase [Vibrio sp. MED222]
          Length = 170

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 103/160 (64%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PD  LR V++P++++  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTLPDDRLRTVAKPVKEVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I     +  + +EGCLS+P  RA V R+A +TV+ +D         
Sbjct: 66  T--RDEPMVLINPEITDKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDREGNEFTFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKI 162


>gi|56750222|ref|YP_170923.1| peptide deformylase [Synechococcus elongatus PCC 6301]
 gi|81300149|ref|YP_400357.1| peptide deformylase [Synechococcus elongatus PCC 7942]
 gi|56685181|dbj|BAD78403.1| polypeptide deformylase [Synechococcus elongatus PCC 6301]
 gi|81169030|gb|ABB57370.1| peptide deformylase [Synechococcus elongatus PCC 7942]
          Length = 192

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 98/153 (64%), Gaps = 2/153 (1%)

Query: 1   MVKKPLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRL 58
           + K PL +    D +LR+ ++ + +I+ ++   I  ML+ MYS DGIGLAA Q+G+  +L
Sbjct: 14  LAKPPLDLHYLGDRVLRQPAKRVSRIDDELRQTIRQMLQTMYSADGIGLAAPQVGINKQL 73

Query: 59  VVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
           +VIDL+    +  P+V INPKI   + D    QEGCLSIP    DV+R   + V Y D N
Sbjct: 74  IVIDLELEDEQAPPLVLINPKIERTAGDLEQCQEGCLSIPGVYLDVERPEIVEVSYKDEN 133

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
            + Q + ADGLLA C+QHE+DHLNG+LF+D + 
Sbjct: 134 GRPQRLVADGLLARCIQHEMDHLNGVLFVDRVE 166


>gi|291333895|gb|ADD93575.1| peptide deformylase [uncultured marine bacterium
           MedDCM-OCT-S04-C385]
          Length = 171

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 103/157 (65%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR  ++P++++ +    LIDNM+  MY + GIGLAA Q+    R++VID+ +   
Sbjct: 9   FPDPRLRTKAKPVQEVTNVHKELIDNMIHTMYESKGIGLAATQVDFHERILVIDISEE-- 66

Query: 69  RKNPMVFINPKI-ITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
           R +P VFINP++ I    + S Y+EGCLS+P +  ++ R   I V Y+D + + Q +  +
Sbjct: 67  RDDPQVFINPEVEILNKKEKSGYEEGCLSVPGFYEEIIRPEKIKVTYLDRDGKKQTLMPE 126

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           GLLA  +QHE+DHL GIL +D++S +KR  I +K+ K
Sbjct: 127 GLLAVVIQHEIDHLEGILMVDYISSIKRQRIKQKLQK 163


>gi|238754205|ref|ZP_04615563.1| Peptide deformylase 2 [Yersinia ruckeri ATCC 29473]
 gi|238707701|gb|EEQ00061.1| Peptide deformylase 2 [Yersinia ruckeri ATCC 29473]
          Length = 170

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 112/160 (70%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  +++VID+ ++  
Sbjct: 9   YPDERLRKVATPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHQQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  I +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKIKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +L
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLDKLAKL 165


>gi|224826194|ref|ZP_03699297.1| peptide deformylase [Lutiella nitroferrum 2002]
 gi|224601831|gb|EEG08011.1| peptide deformylase [Lutiella nitroferrum 2002]
          Length = 167

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 102/156 (65%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V+RP+  ++  I  LID+M E MY  +GIGLAA Q+ V  R+VVID+ +   
Sbjct: 9   YPDERLHKVARPVGAVDERIRQLIDDMAETMYECNGIGLAATQVNVHERVVVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +     F+NP+I+    D +VY+EGCLS+P     V RS ++ VR ++ N +   I  DG
Sbjct: 67  KSALTAFVNPEIVERRGD-TVYEEGCLSVPGIYDKVHRSEWVRVRALNRNGEPFEIETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL+G +F+D+LS+LK+  I  KM K
Sbjct: 126 LLAICIQHEIDHLDGKVFVDYLSQLKQSRIKAKMKK 161


>gi|315125137|ref|YP_004067140.1| N-terminal methionine peptide deformylase [Pseudoalteromonas sp.
           SM9913]
 gi|315013650|gb|ADT66988.1| N-terminal methionine peptide deformylase [Pseudoalteromonas sp.
           SM9913]
          Length = 168

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 105/164 (64%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ FPD  LR +++ +  ++  +  ++ +MLE MY  +GIGLAA Q+ +  R+VV
Sbjct: 1   MARLEVLRFPDERLRTIAKEVTVVDDQVREIVKDMLETMYDENGIGLAATQVDIHQRIVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R  P+V INP+II   D  +V +EGCLS+P   A V R+  +TV  ++   +
Sbjct: 61  IDVSEE--RNEPLVLINPQIIK-KDGSTVSEEGCLSVPHSYAKVDRAETVTVAALNEEGK 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             I+ AD LLA C+QHELDHL G LFID+LS LKR  I KK+ K
Sbjct: 118 EFILDADELLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEK 161


>gi|261378988|ref|ZP_05983561.1| peptide deformylase [Neisseria cinerea ATCC 14685]
 gi|269144603|gb|EEZ71021.1| peptide deformylase [Neisseria cinerea ATCC 14685]
          Length = 167

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEQVDERIQKLVADMFETMYEARGIGLAATQVDVHERIVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAESVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++HLS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVEHLSQLKQGRIKTKLKK 161


>gi|121606766|ref|YP_984095.1| peptide deformylase [Polaromonas naphthalenivorans CJ2]
 gi|120595735|gb|ABM39174.1| peptide deformylase [Polaromonas naphthalenivorans CJ2]
          Length = 173

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 103/162 (63%), Gaps = 4/162 (2%)

Query: 5   PLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I  +PDP L  V++P+   ++ +  L D M   MY+ +GIGLAA Q+ V  RLVVID
Sbjct: 3   PLTILRYPDPRLHTVAKPVAAFDARLRQLADAMFHTMYAAEGIGLAATQVDVHERLVVID 62

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           + +   R  P+V INP+I+  S +  +  EGCLS+P     V+R+  + V  +D N Q Q
Sbjct: 63  VSEG--RNQPLVLINPEIVWASAETRIGDEGCLSVPGIYDGVERALAVKVAALDLNGQKQ 120

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           +  A+G+LA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 121 LHEAEGMLAVCIQHEMDHLIGKVFVEYLSPLKRNRIKTKLIK 162


>gi|332285819|ref|YP_004417730.1| peptide deformylase [Pusillimonas sp. T7-7]
 gi|330429772|gb|AEC21106.1| peptide deformylase [Pusillimonas sp. T7-7]
          Length = 170

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 109/160 (68%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+++++  I  L+ +M E MY   G+GLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRYPDPRLHKVAKPVQEVDDRIRQLVRDMAETMYDAPGVGLAATQVDVHERVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +  +  + +V INP+I+  SD+  VY+EGCLS+P    +V+RSA I VR ++   +    
Sbjct: 65  EDGN--DLIVLINPEILWKSDEVQVYEEGCLSVPGVYDEVERSARIRVRALNEQGEPYEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHELDHL G +F+++LS LK++ I  ++ K
Sbjct: 123 DAEGLLAVCVQHELDHLLGKVFVEYLSVLKQNRIKTRLRK 162


>gi|269958379|ref|YP_003328166.1| peptide deformylase [Anaplasma centrale str. Israel]
 gi|269848208|gb|ACZ48852.1| peptide deformylase [Anaplasma centrale str. Israel]
          Length = 199

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (60%), Gaps = 23/180 (12%)

Query: 5   PLVIFPDPILRRVSRPIEKINSD-----IMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLV 59
           PLV  PD    R+S   E++++D     +  L ++ML+ MY   GIGLAAVQ+GV  R+ 
Sbjct: 16  PLVTLPDS---RLSLCSEEVHADDFGQQLETLANDMLDTMYHNKGIGLAAVQVGVHKRIF 72

Query: 60  VIDLQDHAHRK---------------NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADV 104
           V+DL+  + R                 P V +NP I+  S+     +EGCLS+PDYR  V
Sbjct: 73  VVDLEYGSDRYEVPRDDGAGEFRATCGPTVVVNPVIVEESERLVAMEEGCLSVPDYRETV 132

Query: 105 KRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           +R   I V+Y+D N + + I A GLLA CLQHELDHLNG++F+  +S+LKRDM+ +K+ +
Sbjct: 133 RRPESIVVQYVDLNRRQKYIKACGLLARCLQHELDHLNGVVFLQRISKLKRDMVMEKIRR 192


>gi|268593574|ref|ZP_06127795.1| peptide deformylase [Providencia rettgeri DSM 1131]
 gi|291310851|gb|EFE51304.1| peptide deformylase [Providencia rettgeri DSM 1131]
          Length = 173

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 110/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P++K+++ I  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRTIAKPVDKVDASIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R + +V INP+++  S +  + +EGCLSIP+    V R+  + VR ++ N +   + ADG
Sbjct: 67  RDDRLVLINPELLDKSGETGI-EEGCLSIPEQHGFVPRAEQVKVRALNYNGESFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKLDRLR 166


>gi|212709012|ref|ZP_03317140.1| hypothetical protein PROVALCAL_00044 [Providencia alcalifaciens DSM
           30120]
 gi|212688378|gb|EEB47906.1| hypothetical protein PROVALCAL_00044 [Providencia alcalifaciens DSM
           30120]
          Length = 173

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 107/161 (66%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR V++P+EK+++ I  +ID+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRTVAKPVEKVDASIQRIIDDMFDTMYDEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++    +  + +EGCLS+P+    V R+  + VR ++ N     + ADG
Sbjct: 67  RNERLVLINPELLNKEGETGI-EEGCLSVPEQHGFVPRAEKVKVRALNYNGDAFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKLDRLR 166


>gi|254491036|ref|ZP_05104217.1| peptide deformylase [Methylophaga thiooxidans DMS010]
 gi|224463549|gb|EEF79817.1| peptide deformylase [Methylophaga thiooxydans DMS010]
          Length = 167

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 101/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR+ + PI  +N  I  L D+MLE MY   GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDPRLRKKAEPITDVNDKIRQLADDMLETMYDAPGIGLAATQVNIQKRILVIDISED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +P+V INP+I+    +   ++EGCLS+P+    V R+  + ++ ++   +      DG
Sbjct: 67  KSDPLVLINPEIVAAEGERE-FEEGCLSVPEAYEAVIRADKVKIKAVNLQGEDFEFTTDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLATC+QHE+DHL+G LF+D+LS LKR  I K++ K
Sbjct: 126 LLATCVQHEIDHLDGKLFVDYLSNLKRQRIKKRLEK 161


>gi|37528512|ref|NP_931857.1| peptide deformylase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|39930823|sp|Q7MYI2|DEF_PHOLL RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|36787950|emb|CAE17067.1| polypeptide deformylase (PDF) (formylmethionine deformylase)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 170

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 107/157 (68%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR ++ P+E ++++I  +ID+M E MY+ +GIGLAA Q+ +  R+VVID+ +   
Sbjct: 9   YPDERLRTIATPVETVDAEIRRIIDDMFETMYAEEGIGLAATQVDIHQRIVVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + ++ +D N +   + AD 
Sbjct: 67  RNERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIKALDYNGRPFELQADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKVEKL 162


>gi|170718226|ref|YP_001785248.1| peptide deformylase [Haemophilus somnus 2336]
 gi|189083072|sp|B0UWZ5|DEF_HAES2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|168826355|gb|ACA31726.1| peptide deformylase [Haemophilus somnus 2336]
          Length = 170

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 103/160 (64%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V+ P+   + ++   IDNM E MY  +GIGLAA Q+ V  R++ ID++ 
Sbjct: 6   VLIYPDERLKTVAEPVSVFDEELQTFIDNMFETMYHEEGIGLAATQVNVHKRIITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INPKI+    +  + +EGCLS+P  R  V R   + V+  +   +  ++ 
Sbjct: 65  -GTKENQIVLINPKILESFGETGI-EEGCLSLPGLRGFVPRKETVKVKAQNRQGEEFMLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHE+DHLNGI+F DHLS LKR  + +K+ KL
Sbjct: 123 ADGLLAICIQHEIDHLNGIVFADHLSPLKRQRMKEKLLKL 162


>gi|260774331|ref|ZP_05883246.1| peptide deformylase [Vibrio metschnikovii CIP 69.14]
 gi|260611292|gb|EEX36496.1| peptide deformylase [Vibrio metschnikovii CIP 69.14]
          Length = 171

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 110/163 (67%), Gaps = 5/163 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP L+  +  ++ I S +  LID+MLE +YSTD GIGLA+VQ+G    +V+IDL 
Sbjct: 6   ILTAPDPRLKITAEKVQDIES-VQKLIDDMLETLYSTDNGIGLASVQVGRKEAVVIIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P++ INP++++ S+  ++ QEGCLS+PDY A+V+R   + V  +D   Q   I
Sbjct: 65  DN--RDQPLILINPEVVSGSNK-ALGQEGCLSVPDYYAEVERYTSVVVSALDRTGQRITI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +D  LA  +QHE+DHL+G LFID++S LKR M  KK+ K V+
Sbjct: 122 ESDDFLAIVMQHEIDHLSGNLFIDYISPLKRQMAMKKVKKYVK 164


>gi|323141161|ref|ZP_08076062.1| peptide deformylase [Phascolarctobacterium sp. YIT 12067]
 gi|322414304|gb|EFY05122.1| peptide deformylase [Phascolarctobacterium sp. YIT 12067]
          Length = 160

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 96/148 (64%), Gaps = 6/148 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  +VI   P+LR V++P+E+I+  +  L+ +M E MYS DG+GLAA Q+GV  R+VV
Sbjct: 1   MAKLKIVIAGAPVLREVAQPVERIDKKLQRLLRDMAETMYSADGVGLAAPQVGVSKRVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +  +       INP+I+       +  EGCLS+PDY  +V+RS ++   + D   Q
Sbjct: 61  IDVGEGLYE-----LINPEIVKREGKV-LGSEGCLSVPDYEGEVERSEYVECEFTDKTGQ 114

Query: 121 HQIIYADGLLATCLQHELDHLNGILFID 148
             ++ A GLLA C+QHELDHL+GILFID
Sbjct: 115 RMLLSASGLLAICIQHELDHLDGILFID 142


>gi|253997897|ref|YP_003049960.1| peptide deformylase [Methylovorus sp. SIP3-4]
 gi|313199962|ref|YP_004038620.1| peptide deformylase [Methylovorus sp. MP688]
 gi|253984576|gb|ACT49433.1| peptide deformylase [Methylovorus sp. SIP3-4]
 gi|312439278|gb|ADQ83384.1| peptide deformylase [Methylovorus sp. MP688]
          Length = 166

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 72/157 (45%), Positives = 107/157 (68%), Gaps = 5/157 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L  V++P++++N++I  LID+M E MY+  GIGLAA Q+ V  +++V+DL +   
Sbjct: 9   YPDPRLYTVAKPVKEVNANIRRLIDDMAETMYAAPGIGLAATQVDVHQQIIVMDLSEA-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINPKI T       Y+EGCLS+P    +V R+A +TV  +D N +  ++ A 
Sbjct: 67  -KNELRVFINPKI-TAKCGAQDYEEGCLSVPGIYENVTRAAEVTVEALDRNGEPFVLEAQ 124

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           GLLA C+QHE+DHL G +F+D+LS LK++ I  K+ K
Sbjct: 125 GLLAVCIQHEMDHLLGKVFVDYLSPLKQNRIKTKLKK 161


>gi|330881833|gb|EGH15982.1| peptide deformylase [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 136

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 69/136 (50%), Positives = 91/136 (66%), Gaps = 2/136 (1%)

Query: 33  DNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQE 92
           D+M E MY   GIGLAA Q+ V  R+VV+DL +   R  PMVFINP+I   +D+   YQE
Sbjct: 1   DDMFETMYEAPGIGLAATQVNVHKRVVVMDLSED--RSEPMVFINPEIEKLTDEMDQYQE 58

Query: 93  GCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSR 152
           GCLS+P +  +V R   + V+ +D N +   + A+GLLA C+QHE DHLNG LF+D+LS 
Sbjct: 59  GCLSVPGFYENVDRPQKVRVKALDRNGKPYELVAEGLLAICIQHECDHLNGKLFVDYLSN 118

Query: 153 LKRDMITKKMSKLVQL 168
           LKRD I KK+ K  +L
Sbjct: 119 LKRDRIKKKLEKQHKL 134


>gi|317494307|ref|ZP_07952721.1| peptide deformylase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917557|gb|EFV38902.1| peptide deformylase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 169

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 110/157 (70%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR V++P++++  +I  ++D+M + MY+ +GIGLAA Q+ V  R++VID+ ++  
Sbjct: 9   FPDERLRTVAQPVKEVTPEIQRIVDDMFDTMYAEEGIGLAATQVDVHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++++ SD  +  +EGCLS+P++RA V R+  + +R +D + +   + AD 
Sbjct: 67  RDQRLVLINPELLS-SDGETGIEEGCLSVPEHRALVPRAERVKIRALDRDGKPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ KL
Sbjct: 126 LLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKL 162


>gi|94312496|ref|YP_585706.1| peptide deformylase [Cupriavidus metallidurans CH34]
 gi|93356348|gb|ABF10437.1| formylmethionine deformylase [Cupriavidus metallidurans CH34]
          Length = 168

 Score =  140 bits (353), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 108/169 (63%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PDP L +V++P+E ++  I  L+ +M E MY   GIGLAA Q+ V  R++V
Sbjct: 1   MAKLDILTYPDPRLHKVAKPVEVVDDRIRQLVKDMAETMYEAPGIGLAATQVDVHERVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R   MVFINP++   S++  V++EGCLS+P+    V+R   + VR +D   +
Sbjct: 61  IDISES--RDELMVFINPEVTWASENRKVWEEGCLSVPEVYDRVERPDRVKVRALDEKGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              + AD LLA C+QHE+DHL+G +F+++LS LK   I  K+ K V+ R
Sbjct: 119 AFELDADDLLAVCIQHEIDHLDGKVFVEYLSPLKLQRIKSKLQKRVRSR 167


>gi|152994060|ref|YP_001338895.1| peptide deformylase [Marinomonas sp. MWYL1]
 gi|150834984|gb|ABR68960.1| peptide deformylase [Marinomonas sp. MWYL1]
          Length = 181

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 104/160 (65%), Gaps = 2/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR++++PI K   ++   ID+ML+ MY  +G+GLAA Q+   +RLVV+D  +   
Sbjct: 19  YPDKRLRKIAKPITKFTDELQTKIDDMLDTMYDENGLGLAATQVDYHHRLVVMDFSEE-- 76

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P+VFINP+     D+ + +QEGCLS+P +   + R+A + V+ +D N +   +  D 
Sbjct: 77  RNEPIVFINPEFEVLDDEPNEFQEGCLSVPGFYEHIYRAAKVRVKALDRNGKPFTLEVDE 136

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           L+A C+QHE+DHL+G L +D+L+ LKR+ I  K+ K  +L
Sbjct: 137 LMAVCVQHEVDHLDGKLMVDYLTPLKRNRIKSKLEKAHKL 176


>gi|149375618|ref|ZP_01893387.1| polypeptide deformylase [Marinobacter algicola DG893]
 gi|149360020|gb|EDM48475.1| polypeptide deformylase [Marinobacter algicola DG893]
          Length = 167

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 100/157 (63%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LR +++P++++  +   LID+M E MY   GIGLAA Q+ V  +++V+DL +   
Sbjct: 8   YPDPRLRTIAKPVDEVTDETRKLIDDMFETMYDAPGIGLAATQVNVHKQIIVMDLSED-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP++     +    QEGCLS+P +  DV R     +R +  + +   I A G
Sbjct: 66  KSEPRVFINPEVEVLEGELEEMQEGCLSVPGFYEDVSRIEHCMIRAIGRDGKPFEIEARG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHLNG LF+D+LS LKR  I KK+ KL
Sbjct: 126 LLAVCIQHEMDHLNGKLFVDYLSSLKRTRIRKKLEKL 162


>gi|269468439|gb|EEZ80104.1| N-formylmethionyl-tRNA deformylase [uncultured SUP05 cluster
           bacterium]
          Length = 185

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (60%), Gaps = 20/182 (10%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR  ++ ++ +N     L+ NM E MY+ DGIGLAA QI    ++VV+D+ 
Sbjct: 4   PILHYPDPRLRTKAKEVDAVNDKTRILVKNMFETMYAEDGIGLAATQINQHLQIVVMDVP 63

Query: 65  DH--------AHRKN-----------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVK 105
           D          +RKN           P+ FINPKI T S     + EGCLS+P ++A+V+
Sbjct: 64  DSQDDYELLLKNRKNDSDKETNIQHHPLCFINPKITTISG-HEKHIEGCLSVPGFQAEVE 122

Query: 106 RSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           RS  IT+  ++   +   ++A  LLA C+QHELDHL GILF+D+LS+LK+  + +K  K+
Sbjct: 123 RSNQITIEALNEQGESFTLHASNLLAVCIQHELDHLKGILFVDYLSKLKQKRLLEKTKKV 182

Query: 166 VQ 167
           ++
Sbjct: 183 IK 184


>gi|21672742|ref|NP_660809.1| polypeptide deformylase [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25008354|sp|Q8K975|DEF_BUCAP RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|21623388|gb|AAM68020.1| polypeptide deformylase [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 167

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 102/148 (68%), Gaps = 3/148 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EKI  +I  + +NM++ MY  +GIGLAA Q+ +  +++VI  + HA 
Sbjct: 9   YPDQRLRLIAKPVEKITKEIYKITNNMIDTMYQEEGIGLAATQVNIQLQIIVIH-KIHAI 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            KN ++ INPKII      S+ +EGCLSIP+YRA V R  +I ++ ++ N     I AD 
Sbjct: 68  EKN-LILINPKIIEKKGSISI-EEGCLSIPEYRAFVPRFNYIKIQAINLNGNTVEIEADS 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRD 156
           +L+ C+QHE+DHLNG LFID+LS LKR+
Sbjct: 126 ILSICIQHEIDHLNGKLFIDYLSELKRE 153


>gi|218710998|ref|YP_002418619.1| peptide deformylase [Vibrio splendidus LGP32]
 gi|218324017|emb|CAV20379.1| Peptide deformylase [Vibrio splendidus LGP32]
          Length = 206

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 105/165 (63%), Gaps = 3/165 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PD  LR V++P++++  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 42  VLTLPDNRLRTVAKPVKEVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDISE 101

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP+I     +  + +EGCLS+P  RA V R+A +TV+ +D         
Sbjct: 102 T--RDEPMVLINPEITDKRGEDGI-EEGCLSVPGARALVPRAAEVTVKALDREGNEFTFD 158

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           AD LLA C+QHELDHL G LF+D+LS LKR  I  K++K+ +  +
Sbjct: 159 ADDLLAICVQHELDHLEGKLFVDYLSPLKRKRIQDKLAKIKRFNE 203


>gi|325294662|ref|YP_004281176.1| peptide deformylase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065110|gb|ADY73117.1| Peptide deformylase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 177

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 101/160 (63%), Gaps = 3/160 (1%)

Query: 8   IFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA 67
           I+PD +L++ +  + + N ++  L+++M E MY   G+GLAA QIG+L ++VVIDL    
Sbjct: 7   IYPDDVLKKKAEVVTEFNEELEQLVNDMFETMYKRGGVGLAANQIGILKKVVVIDLHSGK 66

Query: 68  HR--KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
            +  K  ++ INP+I+    +  V +EGCLS+P     VKR+A+  V+  +   +  II 
Sbjct: 67  EKQGKEQIILINPEIVALEGE-EVKEEGCLSLPGLYKKVKRAAYAKVKAQNLKGEEFIIE 125

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            +GLLA   QHE+DHLNGI+FID LS L+R +  +K  KL
Sbjct: 126 GEGLLARAFQHEIDHLNGIVFIDRLSPLQRRLALEKYKKL 165


>gi|300313962|ref|YP_003778054.1| polypeptide deformylase [Herbaspirillum seropedicae SmR1]
 gi|300076747|gb|ADJ66146.1| polypeptide deformylase protein [Herbaspirillum seropedicae SmR1]
          Length = 172

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +++ P+   +  I  L+ +M E MY+  G+GLAA Q+ V  ++VVID+ D   
Sbjct: 9   YPDPRLHKIAAPVTVFDERIKKLVADMAETMYAAPGVGLAATQVDVHEQVVVIDVSDDG- 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            KN  VFINP+I+  S+D  VY EGCLS+P     V+R A + VR  D + +   + AD 
Sbjct: 68  -KNLQVFINPEIVWASEDKRVYDEGCLSVPGIYDGVERPARVKVRAFDADGKAFEVDADE 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 127 LLAVCIQHEMDHLKGKVFVEYLSPLKRNRIKTKLQK 162


>gi|290477161|ref|YP_003470076.1| peptide deformylase [Xenorhabdus bovienii SS-2004]
 gi|289176509|emb|CBJ83318.1| peptide deformylase [Xenorhabdus bovienii SS-2004]
          Length = 170

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+EK+++ I ++ID+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   YPDERLRTIAKPVEKVDAGIQSIIDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++       + +EGCLS+P+ RA V R   + ++ +D + Q   + AD 
Sbjct: 67  RDQRLVLINPELMNEVGATGI-EEGCLSVPEQRAFVPRFEQVKIKALDYHGQQFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ K+ +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKVEKIDRLR 166


>gi|260465452|ref|ZP_05812642.1| peptide deformylase [Mesorhizobium opportunistum WSM2075]
 gi|259029756|gb|EEW31042.1| peptide deformylase [Mesorhizobium opportunistum WSM2075]
          Length = 166

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/167 (39%), Positives = 104/167 (62%), Gaps = 3/167 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++ FP+P+LR V+ P++  +SD+  L  ++++ M++  GIG+    IG+L RLVV
Sbjct: 1   MAVRPIIRFPNPLLRAVAEPVKLFDSDLHGLAGDLVDTMHAAPGIGITGPHIGILRRLVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           I L   A    P +++NP I+  S +   + EG +S+P    D++R A I VRY D +  
Sbjct: 61  IQLPSAA---KPGIYVNPSIVHASTEMIRHAEGSVSMPGVTEDIERHARIIVRYQDLDGN 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Q   ADGLLA C QHE+D L+G+ +   L+RLKRD + K+  KL++
Sbjct: 118 EQFENADGLLAVCHQHEIDQLDGLFWTHRLTRLKRDRLVKRYGKLMR 164


>gi|238783197|ref|ZP_04627223.1| Peptide deformylase 2 [Yersinia bercovieri ATCC 43970]
 gi|238715993|gb|EEQ07979.1| Peptide deformylase 2 [Yersinia bercovieri ATCC 43970]
          Length = 170

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 110/160 (68%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+++ P++++N +I  ++D+M E MY+ +GIGLAA Q+ V  +++VID+ ++  
Sbjct: 9   YPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGIGLAATQVDVHLQIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   +  D 
Sbjct: 67  RDQRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELETDD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +K+ K+ +L
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKMAKL 165


>gi|257091704|ref|YP_003165345.1| peptide deformylase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257044228|gb|ACV33416.1| peptide deformylase [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 167

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 101/160 (63%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ FPDP LR+V+  ++KI+  I  L  +M E MY   GIGLAA Q+ V  R++V+D  
Sbjct: 5   PILRFPDPRLRKVAARVDKIDDGIRRLARDMAETMYEAPGIGLAATQVDVHARVIVVDAS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R   +  INP+I+   D   V +EGCLS+P     V+R+  + VRY D +   Q +
Sbjct: 65  ET--RDQLLTLINPEILQ-QDGLQVCEEGCLSVPGVYDKVERAEHVVVRYQDLDGAEQTV 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A GLLA CLQHE+DHL G +F++HLS+LK+  I  K++K
Sbjct: 122 DATGLLAVCLQHEIDHLQGRVFVEHLSQLKQLRIRNKLAK 161


>gi|71279368|ref|YP_266802.1| polypeptide deformylase [Colwellia psychrerythraea 34H]
 gi|71145108|gb|AAZ25581.1| polypeptide deformylase [Colwellia psychrerythraea 34H]
          Length = 171

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR  ++P+  I      +ID+ML  MY  +G+GLAA Q+ +  R+VV+D  +   
Sbjct: 9   FPDPRLRTKAQPVTDITDATATIIDDMLATMYEENGVGLAATQVDIHQRIVVMDTSED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
              P++FINP+II  S++ S+ +EGCLS+P   A V R    TV+ +D + +   + A  
Sbjct: 67  NDQPIIFINPEIIATSNETSINEEGCLSVPGTYAKVDRHDACTVKALDRHGKEFSLNATE 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           L + C+QHELDHL G+LF+D+LS LKR  I KK+ K
Sbjct: 127 LQSICIQHELDHLKGVLFVDYLSPLKRQRIQKKLEK 162


>gi|145590257|ref|YP_001156854.1| peptide deformylase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048663|gb|ABP35290.1| peptide deformylase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 171

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 108/159 (67%), Gaps = 2/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PD  L +V++P+ ++++ I  ++ +M + MY   G+GLAA Q+ +  R+VVID+ D
Sbjct: 6   VLCYPDQRLHKVAKPVAQVDARIQKIVADMADTMYDAPGVGLAATQVDIHERIVVIDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +   MVFINP+I+  S +   ++EGCLS+P++  +V+R A I V+ ++   +   + 
Sbjct: 66  D--QNELMVFINPEIVWASPEKKSWREGCLSVPEFYDEVERPAEIRVKALNLKGEEFELE 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA CLQHELDHL G +F+++LS LK+  I++KM K
Sbjct: 124 ADGLLAVCLQHELDHLQGKVFVEYLSMLKQVRISQKMKK 162


>gi|220933382|ref|YP_002512281.1| peptide deformylase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254767610|sp|B8GU11|DEF_THISH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|219994692|gb|ACL71294.1| peptide deformylase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 178

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 114/167 (68%), Gaps = 3/167 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ FPDP LR+ + P++K++ +I  L+D+M E MY   GIGLAA Q+ V  +++V
Sbjct: 1   MAKLEILHFPDPRLRKRAVPVDKVDDEIRRLVDDMFETMYDAPGIGLAATQVNVQRQVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ ++  +  P+VFINP+I+    +  + QEGCLS+P Y   V+R+  + VR +D N +
Sbjct: 61  IDVSENNDQ--PLVFINPEILDRVGEEEM-QEGCLSVPGYFETVRRADRVRVRALDRNGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              +  DGLLA C+QHE+DHL+G LF+D+LS LKR+ I KK+ KL +
Sbjct: 118 PFELETDGLLAVCIQHEMDHLDGKLFVDYLSPLKRNRIQKKLEKLTR 164


>gi|221135272|ref|ZP_03561575.1| peptide deformylase [Glaciecola sp. HTCC2999]
          Length = 169

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 103/159 (64%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR  ++P+  IN  I  L+ +M E M +  G+GLAA Q+ V  +++V+D+ D
Sbjct: 6   VLTFPDERLRTKAKPVNDINDSIRTLVADMFETMKAERGVGLAATQVNVHQQVIVMDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +  P+VFINPK+I       + +EGCLS+P+  A V+R+ +I V  ++ + +   + 
Sbjct: 66  D--QDTPLVFINPKVIE-QRGTKINEEGCLSVPNNYAKVERAEWIKVSALNEHGEEFTME 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A+GLLA C+QHE+DHL G LF+D+LS LKR  I KK+ K
Sbjct: 123 AEGLLAVCIQHEMDHLQGKLFVDYLSSLKRQRIMKKLEK 161


>gi|157375143|ref|YP_001473743.1| peptide deformylase [Shewanella sediminis HAW-EB3]
 gi|157317517|gb|ABV36615.1| Peptide deformylase [Shewanella sediminis HAW-EB3]
          Length = 163

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 103/160 (64%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I S +   ID++L+ MY T DGIGLAA Q+G L+ ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIES-VQGFIDDLLDTMYDTEDGIGLAATQVGSLHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
               R  P V INP+II    DF V +EGCLSIP YRA V RS  + ++ +D       I
Sbjct: 65  --PERDQPQVLINPEIIEAEGDF-VGEEGCLSIPGYRAKVTRSEKVKIKALDRTGTPFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  +QHE++HL G++F DHLS+LK+ +  KK+SK
Sbjct: 122 ETDTFLAIVIQHEMEHLQGVVFTDHLSKLKQQIALKKVSK 161


>gi|124265476|ref|YP_001019480.1| peptide deformylase [Methylibium petroleiphilum PM1]
 gi|124258251|gb|ABM93245.1| peptide deformylase [Methylibium petroleiphilum PM1]
          Length = 170

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 101/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L  V++P+++++  +  L+D+MLE MY   G+GLAA Q+ V  R++VID+ D   
Sbjct: 9   YPDPRLHTVAKPVKEVDERVRQLVDDMLETMYDAQGVGLAATQVDVHERVIVIDVSDD-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P V INP+++  SD+  V  EGCLS+P     V R A +TVR +  + Q     A+ 
Sbjct: 67  RNEPRVLINPELLQVSDEMVVGDEGCLSVPQIYDKVPRHAKVTVRALGRDGQAYQFDAEE 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LL+ C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 127 LLSVCVQHEMDHLMGKVFVEYLSPLKRNRIKSKMLK 162


>gi|146313352|ref|YP_001178426.1| peptide deformylase [Enterobacter sp. 638]
 gi|167012063|sp|A4WF95|DEF_ENT38 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|145320228|gb|ABP62375.1| peptide deformylase [Enterobacter sp. 638]
          Length = 169

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 112/161 (69%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRIVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHKRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R+  +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + AD 
Sbjct: 67  REERLVLINPELLEQSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKSFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL ++R
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRMR 166


>gi|73666676|ref|YP_302692.1| peptide deformylase [Ehrlichia canis str. Jake]
 gi|72393817|gb|AAZ68094.1| peptide deformylase [Ehrlichia canis str. Jake]
          Length = 185

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 102/175 (58%), Gaps = 14/175 (8%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L   S  + +++  +  L+D+M E M+   G+GLAAVQ+G+  R++V+D+ 
Sbjct: 5   PIVTVPDKRLSLCSEEVREVDQSVKKLVDDMFEAMHVNKGVGLAAVQVGIHKRVLVVDVP 64

Query: 65  DHAHRKN--------------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFI 110
           +     +              P   INPKI+  S +    +EGCLS+PDY   V R  ++
Sbjct: 65  EEFRETDDITSQIEGYELCGGPYCIINPKIVDASQEKVTLREGCLSVPDYFDYVVRPQYV 124

Query: 111 TVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           TV+Y+D N    II A G LA CL+HE+DHLNGI+F+ +LS+ KRD    K+ K+
Sbjct: 125 TVQYLDYNGNECIIKAQGWLARCLEHEIDHLNGIVFLKYLSKFKRDFAIGKVKKM 179


>gi|225024414|ref|ZP_03713606.1| hypothetical protein EIKCOROL_01289 [Eikenella corrodens ATCC
           23834]
 gi|224942795|gb|EEG24004.1| hypothetical protein EIKCOROL_01289 [Eikenella corrodens ATCC
           23834]
          Length = 167

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/157 (44%), Positives = 99/157 (63%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L  V++P+E+++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDPRLNLVAKPVEQVDERIKQLVADMAETMYEAKGIGLAATQVDVHERVVVMDLSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    V INP II   D  ++Y+EGCLS+P     V R+  I    +D   +   I+ADG
Sbjct: 67  RDQLQVLINPVIIE-RDGETIYEEGCLSVPGVYDKVTRAESIVAEALDAEGKPYTIHADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           L A C+QHE+DHL+G +F+ +LSRLK++ I  KM KL
Sbjct: 126 LQAICIQHEIDHLDGKVFVQYLSRLKQERIKTKMKKL 162


>gi|319788404|ref|YP_004147879.1| peptide deformylase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466916|gb|ADV28648.1| peptide deformylase [Pseudoxanthomonas suwonensis 11-1]
          Length = 180

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 7/172 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++   DP+LR+ S  IE I+  + +L+ +MLE M   DG GLAAVQIG L R++V
Sbjct: 1   MAIRPILPITDPLLRQKSAEIETIDDSVRDLVSDMLETMQDADGAGLAAVQIGELRRILV 60

Query: 61  IDL---QDHAHRKNPMVFINPKIITFSDDFSVYQ-EGCLSIPDYRADVKRSAFITVRYMD 116
            D+   + HA  K   VFINP+II  SD+    + EGCLS+P+    V R+  + VR+ D
Sbjct: 61  ADIPLDEPHASHK---VFINPEIIWQSDEIQELEGEGCLSMPEIYFTVPRALEVKVRFTD 117

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            +A    ++A+G  A C QHE+DHLNGI  IDH+S LKRD    K  K +++
Sbjct: 118 LDAVTHEVHAEGFSAVCFQHEIDHLNGIRQIDHVSSLKRDKFLAKFRKYLRI 169


>gi|308272079|emb|CBX28687.1| Peptide deformylase [uncultured Desulfobacterium sp.]
          Length = 177

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 100/159 (62%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PD  L   ++P++ IN+D+  +ID+M+E MY   GIGLA++QIG    ++V D+  
Sbjct: 12  ILTYPDRFLTNTAKPVKGINADLQKIIDDMIETMYDAPGIGLASIQIGCDKSMIVYDIDQ 71

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++  V +NP II    +     EGCLS+PD R+DVKR+A + V  +D       I 
Sbjct: 72  TEHKRSIQVLLNPVIIETDGEIVSNNEGCLSVPDLRSDVKRAASVIVEALDREGNPLKIE 131

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A   LA  LQHE+DHLNG+LF+D +S LKR++  + + K
Sbjct: 132 AHDQLAVVLQHEIDHLNGVLFLDRISTLKRELYKRHVKK 170


>gi|162452083|ref|YP_001614450.1| polypeptide deformylase [Sorangium cellulosum 'So ce 56']
 gi|161162665|emb|CAN93970.1| Polypeptide deformylase [Sorangium cellulosum 'So ce 56']
          Length = 170

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++ +PDP LR+ ++P+ +I+ +I  LID+M E MY+  G+GLAA QIG  +R+ +
Sbjct: 1   MAIRTILHYPDPRLRQKAQPVGEISPEITKLIDDMAETMYAAPGVGLAATQIGEPHRVFL 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+       N +VFINP+I+      +   EGCLS P    D+KR+  +TVR    +  
Sbjct: 61  VDIAADDEPSNLLVFINPEIVRQEGQLT-GPEGCLSFPGISEDIKRAERVTVRARGRDGA 119

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              I ADGLLA  +QHELDHL+G+L ID +  LK+ ++ +KM K
Sbjct: 120 TFEIAADGLLAVAIQHELDHLDGVLMIDRMGTLKKRIVQRKMQK 163


>gi|322434765|ref|YP_004216977.1| peptide deformylase [Acidobacterium sp. MP5ACTX9]
 gi|321162492|gb|ADW68197.1| peptide deformylase [Acidobacterium sp. MP5ACTX9]
          Length = 188

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 97/157 (61%), Gaps = 1/157 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP+L +    +   +  +  L+D M E MY   GIGLAA QIG+  R+ VID+    +
Sbjct: 27  WPDPVLAKKGVEVTAFDDRLKTLVDEMFESMYEAQGIGLAAPQIGISERITVIDVSFKKN 86

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            K+ +  INP II  ++   V +EGCLS+PD R  V R+ ++ V+  D       +  D 
Sbjct: 87  PKDRLALINPVIIE-AEGKQVEEEGCLSLPDIREKVSRAGWVKVKAQDVTGTWFEVEGDE 145

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA  LQHE+DHL+G+LFID +SRLKR+++ +K+ K+
Sbjct: 146 LLARALQHEIDHLDGVLFIDRISRLKRELVLRKIKKM 182


>gi|255020222|ref|ZP_05292291.1| Peptide deformylase [Acidithiobacillus caldus ATCC 51756]
 gi|254970364|gb|EET27857.1| Peptide deformylase [Acidithiobacillus caldus ATCC 51756]
          Length = 168

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 105/159 (66%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +PD  L++ + PI +I+ DI  L D+M E MY+  GIGLAA+Q+    RL+V+D+ +
Sbjct: 6   IVEYPDVRLKQEAAPIARIDRDIEALADDMAETMYAAPGIGLAAIQVAAPQRLIVVDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R   +  +NP+II  S +  + QEGCLS+P     V+R+  + VR +D   +   + 
Sbjct: 66  A--RNELLTLVNPEIIESSGEEEM-QEGCLSVPGVLETVRRAERVKVRALDLRGKTLELE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA CLQHE+DHLNG LF+DHLSRLK+++I +K  K
Sbjct: 123 ADGLLAVCLQHEIDHLNGTLFVDHLSRLKQNLIRRKAEK 161


>gi|269214256|ref|ZP_06158455.1| peptide deformylase [Neisseria lactamica ATCC 23970]
 gi|269210257|gb|EEZ76712.1| peptide deformylase [Neisseria lactamica ATCC 23970]
          Length = 181

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL ++  
Sbjct: 23  YPDERLHTVAKPVEQVDGRIQKLVADMFETMYEARGIGLAATQVDVHERVVVMDLSEN-- 80

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 81  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 139

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 140 LLAICVQHELDHLMGIVFVERLSQLKQSRIKTKLKK 175


>gi|91774543|ref|YP_544299.1| peptide deformylase [Methylobacillus flagellatus KT]
 gi|91708530|gb|ABE48458.1| peptide deformylase [Methylobacillus flagellatus KT]
          Length = 167

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 104/159 (65%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PDP L +V+ P+E++N DI  L+ +M E MY+  GIGLAA Q+ V  +++VIDL +
Sbjct: 6   ILTYPDPRLHKVAAPVEEVNDDIRQLVRDMAETMYAAPGIGLAATQVDVHKQVIVIDLSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +    VFINPKI++       Y+EGCLS+P     V R+A +TV  +D + +   + 
Sbjct: 66  D--KSALQVFINPKIVSQCGSQE-YEEGCLSVPGIYEPVTRAAEVTVEALDEHGKPFTLK 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHL G +F+++LS LK+  I  K+ K
Sbjct: 123 ADGLLAVCIQHEIDHLLGKVFVEYLSSLKQTRIKNKLKK 161


>gi|319778670|ref|YP_004129583.1| Peptide deformylase [Taylorella equigenitalis MCE9]
 gi|317108694|gb|ADU91440.1| Peptide deformylase [Taylorella equigenitalis MCE9]
          Length = 169

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 109/160 (68%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L+++++ ++ ++  I  ++++M E MY+ +G+GLAA Q+ +  R+VVID+ 
Sbjct: 5   PILKYPDPRLKKIAKDVDVVDESIKKIVEDMAETMYAANGVGLAATQVDIHKRIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R + +V INP+II  S++  +++EGCLS+P    +V+R + + V+ +D N      
Sbjct: 65  EE--RNDLLVLINPEIIGISEEKVIHEEGCLSVPTIYDNVERFSEVRVKALDQNGNAFEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G +F++ LS LK++ I  K+ K
Sbjct: 123 KADGLLAICVQHELDHLMGKVFVEKLSALKQNRIKTKLKK 162


>gi|171909540|ref|ZP_02925010.1| peptide deformylase [Verrucomicrobium spinosum DSM 4136]
          Length = 192

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 110/177 (62%), Gaps = 16/177 (9%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+VI+ DP+LR   +PI ++  +I  L  +M+E M++  G+GLAA Q+G+  +L VI++ 
Sbjct: 4   PIVIYGDPVLRVKCKPITEVTEEIRKLSQDMIETMHNARGVGLAAPQVGIALQLAVIEVP 63

Query: 65  DHAH-----RKN----------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAF 109
                    R N          P++F+NPK+     + ++ +EGCLSIPD R++V+RSA 
Sbjct: 64  PDDESVTYVRLNGEDTPLAEAMPLIFLNPKL-DHGKEKAMGEEGCLSIPDLRSEVRRSAG 122

Query: 110 ITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV 166
           + V Y   + + + I ADGLLA  LQHE+DHLNGILFID LS   +  + +K+ +L+
Sbjct: 123 VKVEYQTLDGETRTIEADGLLARALQHEIDHLNGILFIDRLSAAAKLGVRRKLKRLM 179


>gi|328952875|ref|YP_004370209.1| Peptide deformylase [Desulfobacca acetoxidans DSM 11109]
 gi|328453199|gb|AEB09028.1| Peptide deformylase [Desulfobacca acetoxidans DSM 11109]
          Length = 167

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 97/149 (65%), Gaps = 1/149 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +P+ +L+  + P+ +I  DI  LID+M   MY+  GIGLAA Q+G L R+++ D+     
Sbjct: 9   YPESVLKEKALPVTEITEDIQRLIDDMAATMYNAPGIGLAANQVGALQRVIIFDITPKNE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            +   V INP+II  ++   VYQE CLS+ DY ADV+R A +    +D N +   I A+ 
Sbjct: 69  GRKLNVLINPEIIA-AEGAQVYQEACLSVLDYAADVRRKARVLATGLDRNGKEVRIEAED 127

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDM 157
           LLA  LQHE+DHL+GILFID +SRLKR++
Sbjct: 128 LLAVVLQHEIDHLDGILFIDRISRLKRNL 156


>gi|225874677|ref|YP_002756136.1| peptide deformylase [Acidobacterium capsulatum ATCC 51196]
 gi|254767569|sp|C1F541|DEF_ACIC5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|225792384|gb|ACO32474.1| peptide deformylase [Acidobacterium capsulatum ATCC 51196]
          Length = 170

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M+ +P+V +PDP+L++ + P+ + N ++  L+D+M E MY   GIGLAA QIG+  RL V
Sbjct: 1   MMIRPIVKYPDPVLQQPAEPVTEFNEELRALVDDMFESMYEAKGIGLAAPQIGISKRLTV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           IDL    +    +V INP+II   +     +EGCLS+PD R  V R+  +TVR  + + +
Sbjct: 61  IDLSFKENPDEKIVLINPEII-HREGRQYEEEGCLSLPDIREKVVRAEKVTVRAQNLDGE 119

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              +  + LL+   QHE+DHL+G+LFI  +S LKRD++ +++ K+
Sbjct: 120 WFEMDGEELLSRAFQHEIDHLDGVLFIFRISALKRDLVLRRIRKM 164


>gi|293602354|ref|ZP_06684800.1| peptide deformylase [Achromobacter piechaudii ATCC 43553]
 gi|292819116|gb|EFF78151.1| peptide deformylase [Achromobacter piechaudii ATCC 43553]
          Length = 170

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 105/160 (65%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L + ++P+ +++  I  L+ +M E MY   G+GLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRYPDPRLHKKAKPVAEVDDRIRQLVRDMAETMYDAPGVGLAATQVDVHERVVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           + ++    +  INP+I   SDD  +Y+EGCLS+P    +V+R++ I  + +D + +    
Sbjct: 65  EDSN--ELLALINPEITWRSDDHKIYEEGCLSVPGIYDEVERASRIRCKALDIDGKPFEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G +F+++LS LK++ I  K+ K
Sbjct: 123 EADGLLAVCVQHELDHLEGKVFVEYLSNLKQNRIKTKLKK 162


>gi|113460190|ref|YP_718247.1| peptide deformylase [Haemophilus somnus 129PT]
 gi|123131908|sp|Q0I181|DEF_HAES1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|112822233|gb|ABI24322.1| peptide deformylase [Haemophilus somnus 129PT]
          Length = 170

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 103/160 (64%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V+ P+   + ++   IDNM E MY  +GIGLAA Q+ V  R++ ID++ 
Sbjct: 6   VLIYPDERLKTVAEPVSVFDEELQTFIDNMFETMYHEEGIGLAATQVNVHKRIITIDIE- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++N +V INP+I+    +  + +EGCLS+P  R  V R   + V+  +   +  ++ 
Sbjct: 65  -GTKENQIVLINPEILESFGETGI-EEGCLSLPGLRGFVPRKETVKVKAQNRQGEDFMLD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHE+DHLNGI+F DHLS LKR  + +K+ KL
Sbjct: 123 ADGLLAICIQHEIDHLNGIVFADHLSPLKRQRMKEKLLKL 162


>gi|126209175|ref|YP_001054400.1| peptide deformylase [Actinobacillus pleuropneumoniae L20]
 gi|165977146|ref|YP_001652739.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|126097967|gb|ABN74795.1| Peptide deformylase [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
 gi|165877247|gb|ABY70295.1| peptide deformylase [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
          Length = 154

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (66%), Gaps = 3/147 (2%)

Query: 19  RPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINP 78
            P+ +++ ++   ID+M + MY  +GIGLAA Q+GVL R++ ID++    + N +V INP
Sbjct: 3   EPVAQVDDELNQFIDDMFDTMYEHEGIGLAAPQVGVLKRVITIDIE--GDKTNQVVLINP 60

Query: 79  KIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHEL 138
           +I+    +  + +EGCLSIP +RA V R   + V+ ++   +  I  ADGL A C+QHE+
Sbjct: 61  EILESCGETGI-EEGCLSIPGHRALVPRKEKVKVKALNRKGEEVIYEADGLFAICIQHEI 119

Query: 139 DHLNGILFIDHLSRLKRDMITKKMSKL 165
           DHLNG+LF+DH+S LKR  I +KM KL
Sbjct: 120 DHLNGVLFVDHISALKRQRIKEKMQKL 146


>gi|158522244|ref|YP_001530114.1| peptide deformylase [Desulfococcus oleovorans Hxd3]
 gi|238686886|sp|A8ZUK5|DEF_DESOH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|158511070|gb|ABW68037.1| peptide deformylase [Desulfococcus oleovorans Hxd3]
          Length = 173

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 102/162 (62%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +P  +L+  + P+  I+  +  LID+M + MY+  G+GLAAVQ+    RLV+ D+ D
Sbjct: 6   IVTYPADVLKDGALPVANIDGKLQQLIDDMAQTMYAHQGVGLAAVQVDSGLRLVIYDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++   V INP+++    +    QEGCLS+P+ R DVKR+A + V  +D   +  +I 
Sbjct: 66  QREKQQFRVVINPEVVAVDGECVSEQEGCLSVPELRTDVKRAATVRVEGVDREGRPLVID 125

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           A+GL A  LQHE+DHLNG L +D  SRLKR++  +K+ K ++
Sbjct: 126 AEGLEAIVLQHEIDHLNGTLILDRASRLKRELYKRKVQKRIK 167


>gi|304388911|ref|ZP_07370958.1| peptide deformylase [Neisseria meningitidis ATCC 13091]
 gi|304337045|gb|EFM03232.1| peptide deformylase [Neisseria meningitidis ATCC 13091]
 gi|316985956|gb|EFV64895.1| peptide deformylase [Neisseria meningitidis H44/76]
          Length = 181

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  LI +M E MY + GIGLAA Q+ V  R+VV+DL +   
Sbjct: 23  YPDERLHTVAKPVEQVDERIRKLIADMFETMYESRGIGLAATQVDVHERVVVMDLTED-- 80

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 81  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 139

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 140 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 175


>gi|85060224|ref|YP_455926.1| peptide deformylase [Sodalis glossinidius str. 'morsitans']
 gi|123738923|sp|Q2NQQ4|DEF_SODGM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|84780744|dbj|BAE75521.1| polypeptide deformylase [Sodalis glossinidius str. 'morsitans']
          Length = 171

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 105/160 (65%), Gaps = 3/160 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR+V++P+  +N  I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   YPDERLRKVAKPVVDVNDAIRRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  +  EGCLSIPD R  V R+  + V+ +D +     + AD 
Sbjct: 67  RDQRLVMINPELLEKSGETGI-DEGCLSIPDQRGFVPRAEKVKVQALDRDGNSFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           LLA C+QHE+DHL G LF+D+LS LKR  I +KM KL ++
Sbjct: 126 LLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKMEKLARM 165


>gi|94987209|ref|YP_595142.1| N-formylmethionyl-tRNA deformylase [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731458|emb|CAJ54821.1| N-formylmethionyl-tRNA deformylase [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 171

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 101/157 (64%), Gaps = 1/157 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L+++S  ++ I  DI NL   M++ MY  +GIGLAA Q+G L RL+V+D+     
Sbjct: 8   YPDISLQKISLEVQDITQDIHNLAKQMVQTMYDANGIGLAAPQVGYLLRLIVVDVSGPEQ 67

Query: 69  RKNPMVFINPKIITFSDD-FSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
           + + +V INPKI    D  F   +EGCLS+PDYR+ VKR A + +  +D ++      A+
Sbjct: 68  KSSLLVLINPKITPVIDSGFIEGEEGCLSVPDYRSKVKRHAKVLLDAIDLDSNPVSFEAE 127

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           GLL+ CLQHE+DHL+G LFID +S LKR +   ++ K
Sbjct: 128 GLLSVCLQHEIDHLDGKLFIDRVSYLKRKLYDGRLKK 164


>gi|319940733|ref|ZP_08015075.1| peptide deformylase [Sutterella wadsworthensis 3_1_45B]
 gi|319805884|gb|EFW02651.1| peptide deformylase [Sutterella wadsworthensis 3_1_45B]
          Length = 179

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 100/165 (60%), Gaps = 2/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K P++ +P P L   + P+   N  I  L+++M E MY+  G+GLAA Q+G+L R+VV
Sbjct: 1   MAKLPILQYPHPKLAAKAEPVADFNDAIKTLVNDMAETMYAAPGVGLAANQVGILKRIVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ D     + +VFINP+II    D   ++EGCLS+      VKR   + V   +   +
Sbjct: 61  IDITDD--NSDLLVFINPEIIETKGDLVDHEEGCLSLKGLYEHVKRPGQVRVHAQNIEGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              +   GLLA C+QHE+DHLNGI+FIDHLS+LK+     K+ KL
Sbjct: 119 PFELECTGLLAVCIQHEVDHLNGIVFIDHLSQLKKQRACTKLRKL 163


>gi|213855562|ref|ZP_03383802.1| peptide deformylase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
          Length = 148

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 101/143 (70%), Gaps = 3/143 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D N     + ADG
Sbjct: 67  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRNGNPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLS 151
           LLA C+QHE+DHL G LFID+LS
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLS 148


>gi|183598657|ref|ZP_02960150.1| hypothetical protein PROSTU_02064 [Providencia stuartii ATCC 25827]
 gi|188020843|gb|EDU58883.1| hypothetical protein PROSTU_02064 [Providencia stuartii ATCC 25827]
          Length = 167

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 111/170 (65%), Gaps = 5/170 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLV 59
           M  + ++  PD  LR    P+  I +    LID++L+ MYSTD GIGLAA QIG    ++
Sbjct: 1   MAVRAIIEIPDERLRVKCDPVTDIAA-AQPLIDDLLDTMYSTDNGIGLAATQIGATLSVM 59

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           VID+ ++  R  PMVF+NP+II  S+  + YQEGCLS+P+  ADV R   + V+ +D + 
Sbjct: 60  VIDISEN--RDQPMVFVNPEIIE-SEGETSYQEGCLSVPEIYADVARFKRVKVKALDRDG 116

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           +  I  +D  LA  +QHE+DHL+G +F+DHLS LKR+M+ KK+ K  +LR
Sbjct: 117 KAFITDSDEFLAIVMQHEIDHLHGKVFLDHLSTLKRNMLLKKLKKQQRLR 166


>gi|299136398|ref|ZP_07029581.1| peptide deformylase [Acidobacterium sp. MP5ACTX8]
 gi|298600913|gb|EFI57068.1| peptide deformylase [Acidobacterium sp. MP5ACTX8]
          Length = 185

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 102/160 (63%), Gaps = 1/160 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +PDP+L +    + +   ++  L+D M E MY+  GIGLAA QIG+  ++ VID+  
Sbjct: 21  VVKYPDPVLSKPGEKVTEFTPELAQLVDEMFESMYAAQGIGLAAPQIGISKQITVIDVSF 80

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
               ++ +  INP+II   +   V +EGCLS+P+ R  V R+A + VR  +   +   + 
Sbjct: 81  KERPEDKLALINPEIIE-REGKQVEEEGCLSLPEIREKVSRAARVKVRAQNVKGEFFEVE 139

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            + LLA  LQHE+DHL+GILFI+HLSRLKRD++ +++ KL
Sbjct: 140 GEELLARALQHEIDHLHGILFIEHLSRLKRDLVHRRIRKL 179


>gi|294338535|emb|CAZ86864.1| Peptide deformylase (PDF) (Polypeptide deformylase) [Thiomonas sp.
           3As]
          Length = 168

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 100/159 (62%), Gaps = 2/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PDP L  V++P+  ++  +  L+  M E MY+++G+GLAA Q+ V  R++V+D  +
Sbjct: 6   IIQYPDPRLYTVAKPVAAVDERVRALVAAMFETMYASNGVGLAATQVDVHERIIVMDTSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  P+  INP+I+  S +   ++EGCLS+P     V R A + VR +D   Q   + 
Sbjct: 66  E--RNQPLALINPEIVRHSAEDKEWEEGCLSVPGIYDKVTRPATVRVRALDAQGQPFEMD 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGL A C+QHE+DHL G +F+D+LS LKR+ I  KM K
Sbjct: 124 ADGLTAVCIQHEMDHLLGKVFVDYLSPLKRNRIKTKMLK 162


>gi|15676038|ref|NP_273168.1| peptide deformylase [Neisseria meningitidis MC58]
 gi|121633988|ref|YP_974233.1| peptide deformylase [Neisseria meningitidis FAM18]
 gi|161870945|ref|YP_001600125.1| peptide deformylase [Neisseria meningitidis 053442]
 gi|218767202|ref|YP_002341714.1| peptide deformylase [Neisseria meningitidis Z2491]
 gi|254805844|ref|YP_003084065.1| peptide deformylase [Neisseria meningitidis alpha14]
 gi|54036954|sp|P63916|DEF_NEIMB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|54040742|sp|P63915|DEF_NEIMA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|158512959|sp|A1KRE5|DEF_NEIMF RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189083074|sp|A9M464|DEF_NEIM0 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|7225325|gb|AAF40569.1| peptide deformylase [Neisseria meningitidis MC58]
 gi|120865694|emb|CAM09421.1| polypeptide deformylase [Neisseria meningitidis FAM18]
 gi|121051210|emb|CAM07481.1| polypeptide deformylase [Neisseria meningitidis Z2491]
 gi|161596498|gb|ABX74158.1| polypeptide deformylase [Neisseria meningitidis 053442]
 gi|254669386|emb|CBA08535.1| peptide deformylase [Neisseria meningitidis alpha14]
 gi|254671149|emb|CBA08206.1| polypeptide deformylase [Neisseria meningitidis alpha153]
 gi|254672814|emb|CBA06953.1| polypeptide deformylase [Neisseria meningitidis alpha275]
 gi|261391648|emb|CAX49096.1| peptide deformylase (PDF; polypeptide deformylase) [Neisseria
           meningitidis 8013]
 gi|308388328|gb|ADO30648.1| polypeptide deformylase [Neisseria meningitidis alpha710]
 gi|319411407|emb|CBY91818.1| peptide deformylase (PDF; polypeptide deformylase) [Neisseria
           meningitidis WUE 2594]
 gi|325129146|gb|EGC51994.1| peptide deformylase [Neisseria meningitidis N1568]
 gi|325131145|gb|EGC53866.1| peptide deformylase [Neisseria meningitidis OX99.30304]
 gi|325133177|gb|EGC55848.1| peptide deformylase [Neisseria meningitidis M6190]
 gi|325135219|gb|EGC57844.1| peptide deformylase [Neisseria meningitidis M13399]
 gi|325137169|gb|EGC59764.1| peptide deformylase [Neisseria meningitidis M0579]
 gi|325138789|gb|EGC61341.1| peptide deformylase [Neisseria meningitidis ES14902]
 gi|325141255|gb|EGC63754.1| peptide deformylase [Neisseria meningitidis CU385]
 gi|325143271|gb|EGC65609.1| peptide deformylase [Neisseria meningitidis 961-5945]
 gi|325145432|gb|EGC67708.1| peptide deformylase [Neisseria meningitidis M01-240013]
 gi|325197399|gb|ADY92855.1| peptide deformylase [Neisseria meningitidis G2136]
 gi|325199324|gb|ADY94779.1| peptide deformylase [Neisseria meningitidis H44/76]
 gi|325203055|gb|ADY98509.1| peptide deformylase [Neisseria meningitidis M01-240149]
 gi|325203229|gb|ADY98682.1| peptide deformylase [Neisseria meningitidis M01-240355]
 gi|325205203|gb|ADZ00656.1| peptide deformylase [Neisseria meningitidis M04-240196]
 gi|325207147|gb|ADZ02599.1| peptide deformylase [Neisseria meningitidis NZ-05/33]
          Length = 167

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  LI +M E MY + GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEQVDERIRKLIADMFETMYESRGIGLAATQVDVHERVVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 161


>gi|288575787|ref|ZP_05977581.2| peptide deformylase [Neisseria mucosa ATCC 25996]
 gi|288566988|gb|EFC88548.1| peptide deformylase [Neisseria mucosa ATCC 25996]
          Length = 193

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 98/156 (62%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+EK++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 35  YPDERLHTVAKPVEKVDERIQKLVADMFETMYEARGIGLAATQVDVHERVVVMDLTED-- 92

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VF+NP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 93  RSEPRVFVNP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 151

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 152 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 187


>gi|119503586|ref|ZP_01625669.1| peptide deformylase [marine gamma proteobacterium HTCC2080]
 gi|119460648|gb|EAW41740.1| peptide deformylase [marine gamma proteobacterium HTCC2080]
          Length = 168

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 97/162 (59%), Gaps = 2/162 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR ++ P+  +++ +  L D+MLE MY   GIGLAA Q+ V  R++VID+ ++  
Sbjct: 9   FPDPRLRTIAVPVTHVDARVQRLTDDMLETMYDAPGIGLAATQVDVHERVIVIDISEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P +FINP +         Y EGCLS+P +   ++R   I V   D + +      DG
Sbjct: 67  KDQPQIFINPVVEALDQTLGEYDEGCLSVPGFYETIRRPERIRVTAKDRDGELFSRELDG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           LLA CLQHE+DHL G LF+D+LS LKR  I  K+ K  + RD
Sbjct: 127 LLAICLQHEIDHLEGKLFVDYLSPLKRQRIRGKLEKAQRQRD 168


>gi|87121016|ref|ZP_01076908.1| peptide deformylase [Marinomonas sp. MED121]
 gi|86163854|gb|EAQ65127.1| peptide deformylase [Marinomonas sp. MED121]
          Length = 169

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (61%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP LR V++P+   N  +   ID+MLE MY  +G+GLAA Q+    RLVV+D  
Sbjct: 5   PVLEYPDPRLRTVAKPVTDFNDALQVKIDDMLETMYDQNGLGLAATQVDFHQRLVVMDFS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   + +PMVFINP+     D  +  QEGCLS+P +   + R+A + V  +D N      
Sbjct: 65  EE--KNDPMVFINPRFEVLDDAANEEQEGCLSVPGFYEHIYRAARVKVIALDRNGNEFEK 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              GLLA C+QHE+DHL+G L +D+LS LKR+ I  K+ K
Sbjct: 123 KVAGLLAVCVQHEIDHLDGKLMVDYLSPLKRNRIKTKLVK 162


>gi|309378546|emb|CBX22818.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 167

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 98/156 (62%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEQVDERIQKLVADMFETMYEARGIGLAATQVDVHERIVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 161


>gi|261823200|ref|YP_003261306.1| peptide deformylase [Pectobacterium wasabiae WPP163]
 gi|261607213|gb|ACX89699.1| peptide deformylase [Pectobacterium wasabiae WPP163]
          Length = 170

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 105/159 (66%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR  ++ ++++N+DI  ++D+M + MY  +GIGLAA Q+ +  R++VID+ +   
Sbjct: 9   FPDERLRITAQSVKEVNADIQRIVDDMFDTMYEEEGIGLAATQVDIHQRIIVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP++I  S +  + +EGCLSIP+ RA V R+  + VR +D   +   + A  
Sbjct: 67  RDQRLVLINPELIEKSGETGI-EEGCLSIPETRALVPRAEHVKVRALDREGKVFELEASE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G LFID+LS LKR  I +K+ KL +
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKRQRIRQKLEKLAK 164


>gi|295096931|emb|CBK86021.1| peptide deformylase [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 169

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 110/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRIVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHKRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D +     + AD 
Sbjct: 67  RDERLVLINPEMLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGNPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRLR 166


>gi|288550484|ref|ZP_05970614.2| peptide deformylase [Enterobacter cancerogenus ATCC 35316]
 gi|288314935|gb|EFC53873.1| peptide deformylase [Enterobacter cancerogenus ATCC 35316]
          Length = 164

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 110/161 (68%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 4   IPDERLRIVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHKRIIVIDVSEN-- 61

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D   +   + AD 
Sbjct: 62  RDGRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDREGKPFELEADD 120

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL ++R
Sbjct: 121 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRMR 161


>gi|149925345|ref|ZP_01913609.1| peptide deformylase [Limnobacter sp. MED105]
 gi|149825462|gb|EDM84670.1| peptide deformylase [Limnobacter sp. MED105]
          Length = 169

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 103/165 (62%), Gaps = 2/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L+ V+ P+ + +  ++ L  +M E MY   G+GLAA Q+ V  R++VID+ 
Sbjct: 5   PILRYPDPRLKTVATPVTQFDDALVKLTQDMAETMYDAPGVGLAATQVNVHKRIIVIDVT 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D   +    VFINP+II  S +  VY+EGCLS+P     V+R   + VR  +   +   I
Sbjct: 65  DD--KSGLTVFINPEIIDASKECKVYEEGCLSVPGIYEKVERPDTVKVRAQNVKGEWFEI 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             D LLA C+QHE+DHLNG +F+++LS+LK+  I  KM K  +L+
Sbjct: 123 DCDELLAVCIQHEIDHLNGKVFVEYLSQLKQTRIKTKMKKQDKLQ 167


>gi|296104994|ref|YP_003615140.1| peptide deformylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059453|gb|ADF64191.1| peptide deformylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 169

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 109/161 (67%), Gaps = 3/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR V+ P++++N++I  ++D+M + MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 9   IPDERLRIVAEPVKEVNAEIQRIVDDMFDTMYAEEGIGLAATQVDIHKRIIVIDVSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D       + AD 
Sbjct: 67  RDGRLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDREGNPFELEADD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G LFID+LS LK+  I +K+ KL +LR
Sbjct: 126 LLAICIQHEMDHLVGKLFIDYLSPLKQQRIRQKVEKLDRLR 166


>gi|152977798|ref|YP_001343427.1| peptide deformylase [Actinobacillus succinogenes 130Z]
 gi|150839521|gb|ABR73492.1| peptide deformylase [Actinobacillus succinogenes 130Z]
          Length = 183

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 105/159 (66%), Gaps = 3/159 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ V+ P+ + N ++   ID+M + MY  +GIGLAA Q+ V  R++ ID+  
Sbjct: 18  VLIYPDERLKTVAAPVTEFNDELQTFIDDMFDTMYQEEGIGLAATQVDVHKRVITIDIS- 76

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +   +V INP+++  S+  +  +EGCLS+P +R  V R   ITV+ ++   +   ++
Sbjct: 77  -GEKNEQLVLINPELLD-SEGETGIEEGCLSLPGFRGFVPRKEKITVKALNRYGEEFTLH 134

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           ADGLLA C+QHE+DHLNGI+F D+LS LKR+ + +K+ K
Sbjct: 135 ADGLLAICIQHEMDHLNGIVFADYLSPLKRNRMKEKLVK 173


>gi|194099884|ref|YP_002003021.1| peptide deformylase [Neisseria gonorrhoeae NCCP11945]
 gi|291042744|ref|ZP_06568485.1| peptide deformylase [Neisseria gonorrhoeae DGI2]
 gi|293398236|ref|ZP_06642441.1| polypeptide deformylase [Neisseria gonorrhoeae F62]
 gi|193935174|gb|ACF30998.1| peptide deformylase [Neisseria gonorrhoeae NCCP11945]
 gi|291013178|gb|EFE05144.1| peptide deformylase [Neisseria gonorrhoeae DGI2]
 gi|291611499|gb|EFF40569.1| polypeptide deformylase [Neisseria gonorrhoeae F62]
 gi|317165346|gb|ADV08887.1| peptide deformylase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 181

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY + GIGLAA Q+ V  R+VV+DL +   
Sbjct: 23  YPDERLHTVAKPVEQVDERIRKLVADMFETMYESRGIGLAATQVDVHERVVVMDLTED-- 80

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 81  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDAVTRAERVKVEALNEKGEKFTLEADG 139

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 140 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 175


>gi|270157753|ref|ZP_06186410.1| peptide deformylase [Legionella longbeachae D-4968]
 gi|289163978|ref|YP_003454116.1| polypeptide deformylase [Legionella longbeachae NSW150]
 gi|269989778|gb|EEZ96032.1| peptide deformylase [Legionella longbeachae D-4968]
 gi|288857151|emb|CBJ10967.1| putative polypeptide deformylase [Legionella longbeachae NSW150]
          Length = 170

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++  PD  LR V++P+   +  +  LI++M E MY+  G+GLAA QIG+  RL VID+  
Sbjct: 6   ILYLPDARLREVAKPVVHFDDKLQTLIEDMFETMYAAHGVGLAAPQIGIGLRLSVIDIA- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +KN +V INP+II  S+    ++EGCLS+P     V R+  + V+ +D   +   I 
Sbjct: 65  -GDKKNQLVIINPEIIA-SEGEKKFEEGCLSVPGAYDTVIRAEKVIVKALDRTGKPFEIQ 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA CLQHE+DH+NG LFID LS LK+ M  KK+ K 
Sbjct: 123 ADGLLAECLQHEIDHMNGKLFIDLLSPLKKAMARKKLEKF 162


>gi|296134589|ref|YP_003641831.1| peptide deformylase [Thiomonas intermedia K12]
 gi|295794711|gb|ADG29501.1| peptide deformylase [Thiomonas intermedia K12]
          Length = 168

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 98/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L  V++P+  ++  +  L+  M E MY+++G+GLAA Q+ V  R++V+D  +   
Sbjct: 9   YPDPRLYIVAKPVAAVDERVRALVAAMFETMYASNGVGLAATQVDVHERIIVMDTSEQ-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P+  INP+I+  S +   ++EGCLS+P     V R A + VR +D   Q   + ADG
Sbjct: 67  RNQPLALINPEIVRHSAEDKEWEEGCLSVPGIYDKVTRPATVRVRALDAQGQPFEMDADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           L A C+QHE+DHL G +F+D+LS LKR+ I  KM K
Sbjct: 127 LTAVCIQHEMDHLMGKVFVDYLSPLKRNRIKTKMLK 162


>gi|313667406|ref|YP_004047690.1| polypeptide deformylase [Neisseria lactamica ST-640]
 gi|313004868|emb|CBN86294.1| polypeptide deformylase [Neisseria lactamica 020-06]
          Length = 167

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 98/156 (62%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEQVDGRIQKLVADMFETMYEARGIGLAATQVDVHERVVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 161


>gi|53803080|ref|YP_115237.1| polypeptide deformylase [Methylococcus capsulatus str. Bath]
 gi|53756841|gb|AAU91132.1| polypeptide deformylase [Methylococcus capsulatus str. Bath]
          Length = 178

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 101/162 (62%), Gaps = 3/162 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+ + P+E  +  +   +D+M E MY+  G+GLAA Q+ V  R++VID+ +   
Sbjct: 9   FPDERLRKKAAPVEVFDDTLRRTVDDMFETMYAAPGVGLAATQVNVHKRILVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P+  INP+++    +  + +EGCLS+P     V R+  + VR  D N +   + A+G
Sbjct: 67  KDAPLCLINPELLEKQGNGEM-EEGCLSVPGIFEKVPRAESVRVRAQDRNGEFFEMSAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           LLA C+QHE+DHL G LF+DHLS LKR M  KK+ K  +LR+
Sbjct: 126 LLAVCIQHEMDHLEGKLFLDHLSTLKRQMARKKLQKERRLRE 167


>gi|59802191|ref|YP_208903.1| peptide deformylase [Neisseria gonorrhoeae FA 1090]
 gi|239997891|ref|ZP_04717815.1| peptide deformylase [Neisseria gonorrhoeae 35/02]
 gi|240015128|ref|ZP_04722041.1| peptide deformylase [Neisseria gonorrhoeae DGI18]
 gi|240017578|ref|ZP_04724118.1| peptide deformylase [Neisseria gonorrhoeae FA6140]
 gi|240081720|ref|ZP_04726263.1| peptide deformylase [Neisseria gonorrhoeae FA19]
 gi|240116732|ref|ZP_04730794.1| peptide deformylase [Neisseria gonorrhoeae PID18]
 gi|240118954|ref|ZP_04733016.1| peptide deformylase [Neisseria gonorrhoeae PID1]
 gi|240124492|ref|ZP_04737448.1| peptide deformylase [Neisseria gonorrhoeae PID332]
 gi|240129167|ref|ZP_04741828.1| peptide deformylase [Neisseria gonorrhoeae SK-93-1035]
 gi|260439507|ref|ZP_05793323.1| peptide deformylase [Neisseria gonorrhoeae DGI2]
 gi|268593743|ref|ZP_06127910.1| peptide deformylase [Neisseria gonorrhoeae 35/02]
 gi|268597818|ref|ZP_06131985.1| peptide deformylase [Neisseria gonorrhoeae FA19]
 gi|268602403|ref|ZP_06136570.1| peptide deformylase [Neisseria gonorrhoeae PID18]
 gi|268604665|ref|ZP_06138832.1| polypeptide deformylase [Neisseria gonorrhoeae PID1]
 gi|268683123|ref|ZP_06149985.1| polypeptide deformylase [Neisseria gonorrhoeae PID332]
 gi|268687550|ref|ZP_06154412.1| polypeptide deformylase [Neisseria gonorrhoeae SK-93-1035]
 gi|75507292|sp|Q5F5P6|DEF_NEIG1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|59719086|gb|AAW90491.1| putative polypeptide deformylase [Neisseria gonorrhoeae FA 1090]
 gi|268547132|gb|EEZ42550.1| peptide deformylase [Neisseria gonorrhoeae 35/02]
 gi|268551606|gb|EEZ46625.1| peptide deformylase [Neisseria gonorrhoeae FA19]
 gi|268586534|gb|EEZ51210.1| peptide deformylase [Neisseria gonorrhoeae PID18]
 gi|268588796|gb|EEZ53472.1| polypeptide deformylase [Neisseria gonorrhoeae PID1]
 gi|268623407|gb|EEZ55807.1| polypeptide deformylase [Neisseria gonorrhoeae PID332]
 gi|268627834|gb|EEZ60234.1| polypeptide deformylase [Neisseria gonorrhoeae SK-93-1035]
          Length = 167

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY + GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKPVEQVDERIRKLVADMFETMYESRGIGLAATQVDVHERVVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDAVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 161


>gi|240113996|ref|ZP_04728486.1| peptide deformylase [Neisseria gonorrhoeae MS11]
 gi|240122199|ref|ZP_04735161.1| peptide deformylase [Neisseria gonorrhoeae PID24-1]
 gi|240124639|ref|ZP_04737525.1| peptide deformylase [Neisseria gonorrhoeae SK-92-679]
 gi|254494753|ref|ZP_05107924.1| polypeptide deformylase [Neisseria gonorrhoeae 1291]
 gi|268600061|ref|ZP_06134228.1| polypeptide deformylase [Neisseria gonorrhoeae MS11]
 gi|268683213|ref|ZP_06150075.1| polypeptide deformylase [Neisseria gonorrhoeae SK-92-679]
 gi|226513793|gb|EEH63138.1| polypeptide deformylase [Neisseria gonorrhoeae 1291]
 gi|268584192|gb|EEZ48868.1| polypeptide deformylase [Neisseria gonorrhoeae MS11]
 gi|268623497|gb|EEZ55897.1| polypeptide deformylase [Neisseria gonorrhoeae SK-92-679]
          Length = 161

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY + GIGLAA Q+ V  R+VV+DL +   
Sbjct: 3   YPDERLHTVAKPVEQVDERIRKLVADMFETMYESRGIGLAATQVDVHERVVVMDLTED-- 60

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 61  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDAVTRAERVKVEALNEKGEKFTLEADG 119

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 120 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 155


>gi|170726943|ref|YP_001760969.1| peptide deformylase [Shewanella woodyi ATCC 51908]
 gi|169812290|gb|ACA86874.1| peptide deformylase [Shewanella woodyi ATCC 51908]
          Length = 163

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 102/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P+  I++ +   ID++LE MY TD GIGLAA Q+G  + ++VIDL 
Sbjct: 6   ILTIPDERLKRKAKPVTDISA-VQGFIDDLLETMYHTDDGIGLAATQVGSEHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
               R  P V INP+I+    +F V +EGCLSIP YRA V R+  + V  +D       I
Sbjct: 65  --PERDQPQVLINPEIVAAEGEF-VGEEGCLSIPGYRAKVARNEKVKVTALDREGTPFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHLNG++F DHLS+LK+ +  +K+SK
Sbjct: 122 ETDTFLAIVLQHEMDHLNGVVFTDHLSKLKQQIALRKVSK 161


>gi|59713150|ref|YP_205926.1| peptide deformylase [Vibrio fischeri ES114]
 gi|197334102|ref|YP_002157326.1| peptide deformylase [Vibrio fischeri MJ11]
 gi|75506885|sp|Q5E1Q8|DEF_VIBF1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|238690282|sp|B5FCW6|DEF_VIBFM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|59481251|gb|AAW87038.1| peptide deformylase [Vibrio fischeri ES114]
 gi|197315592|gb|ACH65039.1| peptide deformylase [Vibrio fischeri MJ11]
          Length = 170

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 97/150 (64%), Gaps = 3/150 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P+E +  +I   +D+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVEAVTPEIQKFVDDMIETMYDEEGIGLAATQVDFHQRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP I   S D  + +EGCLS+P  +  V RSA ++V  +D +       
Sbjct: 66  T--RDEPMVLINPVITQKSGDDGI-EEGCLSVPGAKGLVPRSAEVSVSALDRDGNEFSFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKR 155
           AD LLA C+QHELDHL+G LF+D+LS LKR
Sbjct: 123 ADDLLAICVQHELDHLDGKLFVDYLSPLKR 152


>gi|255067832|ref|ZP_05319687.1| peptide deformylase [Neisseria sicca ATCC 29256]
 gi|255047923|gb|EET43387.1| peptide deformylase [Neisseria sicca ATCC 29256]
          Length = 193

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 98/156 (62%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 35  YPDERLHTVAKPVEQVDERIQKLVADMFETMYEARGIGLAATQVDVHERVVVMDLTED-- 92

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 93  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 151

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 152 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 187


>gi|323493448|ref|ZP_08098570.1| peptide deformylase [Vibrio brasiliensis LMG 20546]
 gi|323312271|gb|EGA65413.1| peptide deformylase [Vibrio brasiliensis LMG 20546]
          Length = 167

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 108/159 (67%), Gaps = 5/159 (3%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQDHAH 68
           PDP L+  +  ++ ++S +  LID+ML+ +Y+TD GIGLAA+Q+G    +V+IDL ++  
Sbjct: 10  PDPRLKVTAEKVQDVSS-VQTLIDDMLDTLYATDNGIGLAAIQVGRKEAVVIIDLSEN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P++ +NP++++ SD  ++ QEGCLS+PDY ADV+R   + V  +D       + +D 
Sbjct: 67  RDEPLILVNPEVVSGSDK-AMGQEGCLSVPDYYADVERFTSVVVSALDREGNQITLESDD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            LA  +QHE+DHL+G LFID+LS LKR M  KK+ K ++
Sbjct: 126 FLAIVMQHEIDHLSGNLFIDYLSPLKRQMAMKKVKKYLK 164


>gi|119896391|ref|YP_931604.1| peptide deformylase [Azoarcus sp. BH72]
 gi|119668804|emb|CAL92717.1| probable peptide deformylase [Azoarcus sp. BH72]
          Length = 167

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 102/160 (63%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L R + P++ ++ D+  LID+M E MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRYPDPRLHRRAAPVDTVDDDVRKLIDDMAETMYEAPGIGLAATQVDVHRRVVVIDIS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +   M  INP+I+   D   V +EGCLS+P     V R+  +TVR +D N     +
Sbjct: 65  ED--KSGLMALINPQILE-RDGEQVCEEGCLSVPGVYEKVTRAERVTVRALDRNGHPFEV 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL+G +F+++LS LK   I  K++K
Sbjct: 122 AAEGLLAVCIQHEIDHLDGKVFVEYLSPLKLGRIKSKLAK 161


>gi|297250811|ref|ZP_06934289.1| peptide deformylase [Neisseria polysaccharea ATCC 43768]
 gi|296837967|gb|EFH21905.1| peptide deformylase [Neisseria polysaccharea ATCC 43768]
          Length = 181

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 98/156 (62%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E+++  +  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 23  YPDERLHTVAKPVEQVDGRVRKLVADMFETMYEARGIGLAATQVDVHERVVVMDLTED-- 80

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 81  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 139

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 140 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 175


>gi|329894842|ref|ZP_08270642.1| Peptide deformylase [gamma proteobacterium IMCC3088]
 gi|328922736|gb|EGG30070.1| Peptide deformylase [gamma proteobacterium IMCC3088]
          Length = 178

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 95/156 (60%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR +++P+ ++      LI +M E MY   GIGLAA Q+ V  R++VID+ +   
Sbjct: 19  FPDPRLRTIAKPVAEVTDQHRALIKDMFETMYQAPGIGLAATQVNVHERILVIDVSE--D 76

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P VFINP++     +   Y EGCLS+P +   V R   I VR ++   +       G
Sbjct: 77  KSEPRVFINPEVEVLDPELGEYDEGCLSVPGFYDTVCRPQRIKVRALNEQGEAYEEELGG 136

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA CLQHE+DHL+G LF+D+LS LKR+ I KK+ K
Sbjct: 137 LLAICLQHEIDHLDGKLFVDYLSPLKRNRIRKKLEK 172


>gi|212695671|ref|ZP_03303799.1| hypothetical protein ANHYDRO_00188 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677344|gb|EEB36951.1| hypothetical protein ANHYDRO_00188 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 162

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 97/139 (69%), Gaps = 4/139 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ S+ ++++N  I  L+D+M E MY  DG+GLAA Q+G+L R++V+D++D     
Sbjct: 20  DPILRKTSKEVKEVNDRIKILLDDMAETMYKADGVGLAAPQVGLLKRVIVVDIRDE---D 76

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP+II   D   V  EGCLS+P++ A+VKR A + V+Y+D N + + I A+GL 
Sbjct: 77  GLIKLVNPEIIE-KDGEQVGVEGCLSVPNFNANVKRPAHVIVKYLDENGEEKKIEAEGLK 135

Query: 131 ATCLQHELDHLNGILFIDH 149
           A  L HE+DHLNG+LFID+
Sbjct: 136 AVALCHEIDHLNGVLFIDN 154


>gi|291285975|ref|YP_003502791.1| peptide deformylase [Denitrovibrio acetiphilus DSM 12809]
 gi|290883135|gb|ADD66835.1| peptide deformylase [Denitrovibrio acetiphilus DSM 12809]
          Length = 175

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 100/158 (63%), Gaps = 1/158 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD +LR  + P++ I+  I  L+DNM+E M++  G+GLAA Q+G+  RL+VID     +
Sbjct: 8   FPDKVLRIKAEPVDSIDESITELLDNMVETMHARSGVGLAAPQVGISKRLIVIDTSAGEN 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               +  INP+II+ ++   V +EGCLSIP     V+R+  +TV+ MD N +   + A+G
Sbjct: 68  EGMLLRVINPEIIS-AEGEQVGEEGCLSIPGEYEPVRRAEKVTVKAMDENGKPYTMEAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV 166
            LA   QHE+DHL+G+LFID L   K+D + K + + +
Sbjct: 127 FLARAFQHEIDHLDGVLFIDRLPSYKKDTLKKTIKRRI 164


>gi|90415408|ref|ZP_01223342.1| polypeptide deformylase [marine gamma proteobacterium HTCC2207]
 gi|90332731|gb|EAS47901.1| polypeptide deformylase [marine gamma proteobacterium HTCC2207]
          Length = 168

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR V++P+ +++  I  LI +M + M    GIGLAA QI V  R++V++L +   
Sbjct: 9   FPDPRLRTVAKPVAEVDETIKRLIADMFDTMKDAQGIGLAATQIDVHLRVIVMNLGEDD- 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
              P VFINP+I    +    Y+EGCLS+P +   V R A + +R +D   +     A G
Sbjct: 68  -IGPRVFINPEIEPLDESVDPYEEGCLSVPGFYEKVDRPAHVVIRALDGEGKAFKEEARG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G LF+D+LS  KR  I KK+ K+
Sbjct: 127 LLAVCIQHEIDHLEGKLFVDYLSPFKRQRIRKKLEKI 163


>gi|218778408|ref|YP_002429726.1| peptide deformylase [Desulfatibacillum alkenivorans AK-01]
 gi|254767578|sp|B8FHH0|DEF_DESAA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|218759792|gb|ACL02258.1| peptide deformylase [Desulfatibacillum alkenivorans AK-01]
          Length = 172

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 106/164 (64%), Gaps = 2/164 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +P PIL +  + IE I+ D++ L+++M E +Y   G+GLAAVQ+GV   ++V D+ +
Sbjct: 6   IVTYPAPILGKPCKLIEDIDEDLVCLVEDMTETLYDAPGLGLAAVQVGVDKAMLVYDVAE 65

Query: 66  HAHRKNP--MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
             + ++    V INPKI+      +   EGCLS+P++RADV R A +TV  +D   +   
Sbjct: 66  DENSESTGLKVLINPKIVHTEGKVTSENEGCLSVPEFRADVPRFACVTVEGVDHEGKPVK 125

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           I A+GLLA  LQHE+DHL G LFID +S LKR M  ++++K ++
Sbjct: 126 IDAEGLLAIVLQHEIDHLEGKLFIDRISSLKRSMYKRRVAKALK 169


>gi|157964561|ref|YP_001499385.1| polypeptide deformylase [Rickettsia massiliae MTU5]
 gi|157844337|gb|ABV84838.1| Polypeptide deformylase [Rickettsia massiliae MTU5]
          Length = 189

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++ +  I+ ++ +I  ++D ML+ ++    +GL A  +G+L R+ V+DL +
Sbjct: 16  IVYAPNDIFKKQAEYIDIVDDNIRTIVDKMLQNLHIERAVGLGANMVGILKRIAVVDLHE 75

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ +P+VFINP I  FS++   + EG LS P   A + RS  I V+Y+D N   Q + 
Sbjct: 76  N-NKSSPIVFINPDITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELA 134

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A+G LAT +QHE+D+LNG +F+D+LS+LKRD + KKM K ++L
Sbjct: 135 AEGFLATVIQHEIDYLNGKIFLDYLSKLKRDTLLKKMLKHIKL 177


>gi|91790468|ref|YP_551420.1| peptide deformylase [Polaromonas sp. JS666]
 gi|91699693|gb|ABE46522.1| peptide deformylase [Polaromonas sp. JS666]
          Length = 173

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 105/164 (64%), Gaps = 2/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ +PDP L  +++P+  +++ +  L  +M + MY   GIGLAA Q+ V  RL+V
Sbjct: 1   MTQLTILRYPDPRLHTIAKPVGAVDARLRQLASDMFDTMYEAAGIGLAATQVDVHERLIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R  P+V INP+I+  S +  V  EGCLS+P     V+RS  + V+ +D + +
Sbjct: 61  IDVSED--RDQPLVLINPEILWASPETRVGDEGCLSVPGIYDGVERSVAVKVQALDLDGK 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q+  A+G+LA C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 119 LQVHAAEGMLAVCIQHEMDHLMGKVFVEYLSPLKRNRIKTKMIK 162


>gi|114777061|ref|ZP_01452081.1| Formylmethionine deformylase [Mariprofundus ferrooxydans PV-1]
 gi|114552582|gb|EAU55042.1| Formylmethionine deformylase [Mariprofundus ferrooxydans PV-1]
          Length = 180

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (60%), Gaps = 14/180 (7%)

Query: 1   MVKKPLVIFPDPILRRVSRPIE-KINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLV 59
           M  + ++I PD  L +VSRP+E  ++ ++  LI +M + MY   G+GLAA Q+G L R+ 
Sbjct: 1   MAVREILIHPDDRLVQVSRPVEFPLSDEVKELIRDMADTMYDAPGVGLAAPQVGELLRIA 60

Query: 60  VID--LQDHAHRKNP---------MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSA 108
           V D   +D   R +           V+INP+ +  SD+   ++EGCLS+P+   DV R A
Sbjct: 61  VTDTVWRDKEVRHDGDLPGGHRELKVWINPEFLWKSDEMETWEEGCLSVPETWGDVSRPA 120

Query: 109 FITVRYMDCNA-QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            + +R+ D +  QH+  + DG  A  LQHE DHL+G LFID+LS LKR MITKKM KL +
Sbjct: 121 ALRLRWFDEHGVQHEQDF-DGFQAVALQHEFDHLDGKLFIDYLSPLKRRMITKKMKKLYK 179


>gi|212635128|ref|YP_002311653.1| peptide deformylase [Shewanella piezotolerans WP3]
 gi|212556612|gb|ACJ29066.1| Formylmethionine deformylase [Shewanella piezotolerans WP3]
          Length = 163

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 101/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R + P++ I++ +   ID+++E MY TD GIGLAA Q+G L+ ++VIDL 
Sbjct: 6   ILTIPDVRLKRKAEPVKDIDA-VQGFIDDLIETMYDTDDGIGLAATQVGSLHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PMV INP+I+    +F   +EGCLSIP YRA V R   + V  +D   Q   I
Sbjct: 65  EE--RDQPMVLINPEIVETRGEFQ-GEEGCLSIPGYRAKVNRHEGVKVTALDRTGQAFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL GI+F DHLS LK+ +  KK+ K
Sbjct: 122 DTDEFLAIVLQHEMDHLKGIVFTDHLSMLKQQIALKKVKK 161


>gi|187476716|ref|YP_784740.1| peptide deformylase [Bordetella avium 197N]
 gi|115421302|emb|CAJ47807.1| peptide deformylase [Bordetella avium 197N]
          Length = 170

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 105/160 (65%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+  ++  I  L+ +M E MY   G+GLAA Q+ V  R++VID+ 
Sbjct: 5   PILRYPDPRLHKVAKPVAVVDDRIRQLVKDMAETMYDAPGVGLAATQVDVHERVIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +  +    +  INP+I   S++  VY+EGCLS+P    +VKR+A I  + +D + +    
Sbjct: 65  EDGNELRAL--INPEITWMSEELQVYEEGCLSVPGIYDEVKRAARIRCKALDTDGKVFEF 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL+G +F+++LS LK++ I  ++ K
Sbjct: 123 EAEGLLAVCVQHEIDHLDGKVFVEYLSVLKQNRIKTRLKK 162


>gi|238650243|ref|YP_002916094.1| polypeptide deformylase [Rickettsia peacockii str. Rustic]
 gi|238624341|gb|ACR47047.1| polypeptide deformylase [Rickettsia peacockii str. Rustic]
          Length = 183

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++ +  I+ ++ +I  ++D ML+ ++    +GL A  +G+L R+ V+DL +
Sbjct: 10  IVYTPNDIFKKQAEYIDIVDDNIRTIVDKMLQNLHIARAVGLGANMVGILKRIAVVDLHE 69

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ +P+VFINP I  FS++   + EG LS P   A + RS  I V+Y+D N   Q + 
Sbjct: 70  N-NKSSPIVFINPDITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELS 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A+G LAT +QHE+D+LNG  F+D+LS+LKRD++ KKM K ++L
Sbjct: 129 AEGFLATVIQHEIDYLNGKTFLDYLSKLKRDILLKKMLKHIKL 171


>gi|325849091|ref|ZP_08170583.1| peptide deformylase [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325480336|gb|EGC83399.1| peptide deformylase [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 153

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 97/139 (69%), Gaps = 4/139 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ S+ ++++N  I  L+D+M E MY  DG+GLAA Q+G+L R++V+D++D     
Sbjct: 11  DPILRKTSKEVKEVNDRIKILLDDMAETMYKADGVGLAAPQVGLLKRVIVVDIRDE---D 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP+II   D   V  EGCLS+P++ A+VKR A + V+Y+D N + + I A+GL 
Sbjct: 68  GLIKLVNPEIIE-KDGEQVGVEGCLSVPNFNANVKRPAHVIVKYLDENGEEKKIEAEGLK 126

Query: 131 ATCLQHELDHLNGILFIDH 149
           A  L HE+DHLNG+LFID+
Sbjct: 127 AVALCHEIDHLNGVLFIDN 145


>gi|3023625|sp|P94601|DEF_FREDI RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|1772503|emb|CAA71353.1| polypeptide deformylase [Tolypothrix sp. PCC 7601]
          Length = 187

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 93/140 (66%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++ ++  LI +ML+ MYS DGIGLAA Q+G+  +L+VIDL+      
Sbjct: 24  DRVLRQPAKRIAKVDDELRQLIRDMLQTMYSKDGIGLAAPQVGIHKQLIVIDLEPDNPAN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP I   S +  V QEGCLSIP+   DVKR   + + Y D N + + + A  LL
Sbjct: 84  PPLVLINPTIKQVSKEICVAQEGCLSIPNVYMDVKRPEVVEIAYKDENGRPKTLKATDLL 143

Query: 131 ATCLQHELDHLNGILFIDHL 150
           A C+QHE+DHLNG++F+D +
Sbjct: 144 ARCIQHEMDHLNGVVFVDRV 163


>gi|116747597|ref|YP_844284.1| peptide deformylase [Syntrophobacter fumaroxidans MPOB]
 gi|158512342|sp|A0LEJ7|DEF_SYNFM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|116696661|gb|ABK15849.1| peptide deformylase [Syntrophobacter fumaroxidans MPOB]
          Length = 170

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 95/149 (63%), Gaps = 1/149 (0%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDPILR+ +  +E I+  ++ LID+M E MY   GIGLAA Q+G    L+V+DLQ    
Sbjct: 9   YPDPILRQKAASVENIDEALIKLIDDMTETMYEAPGIGLAANQVGRSLSLIVVDLQRQDE 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               +V INP+I+    + + ++EGCLS+P+Y + VKR A + VR    + +   I A G
Sbjct: 69  EHGLIVLINPQIVATQGEIT-WEEGCLSVPEYFSAVKRHAEVVVRGYGRDGKEMEIQAGG 127

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDM 157
           LLA  LQHE+DHL G LFID L+ + RD+
Sbjct: 128 LLAVALQHEIDHLEGRLFIDRLNPITRDI 156


>gi|300871518|ref|YP_003786391.1| peptide deformylase [Brachyspira pilosicoli 95/1000]
 gi|300689219|gb|ADK31890.1| peptide deformylase [Brachyspira pilosicoli 95/1000]
          Length = 177

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 101/165 (61%), Gaps = 9/165 (5%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M++K LVI+ D  L+  S  +E ++ +I+ LID+M E MY  +G+GLAAVQ+GVL R++V
Sbjct: 1   MIRK-LVIYGDDRLKEKSSYVENVDEEILTLIDDMFETMYKANGVGLAAVQVGVLKRVIV 59

Query: 61  IDLQDHAHRKNP---MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDC 117
           I + D      P   +  INP+II   +D  + +EGCLS P    +V R   I V+Y+D 
Sbjct: 60  ISVPDFDDETKPDFKLALINPEIIWHGEDTEILEEGCLSFPKISDEVARYKEIKVKYIDT 119

Query: 118 NAQHQIIYADGLLATCLQHELDHLNGILFIDHLS-----RLKRDM 157
             + QI+ A   +A  LQHE+DH NGI FID L      RLK+D+
Sbjct: 120 ENKEQILDAKDYIAKVLQHEIDHTNGITFIDRLESYQKRRLKKDL 164


>gi|34580422|ref|ZP_00141902.1| polypeptide deformylase [Rickettsia sibirica 246]
 gi|229586763|ref|YP_002845264.1| Polypeptide deformylase [Rickettsia africae ESF-5]
 gi|28261807|gb|EAA25311.1| polypeptide deformylase [Rickettsia sibirica 246]
 gi|228021813|gb|ACP53521.1| Polypeptide deformylase [Rickettsia africae ESF-5]
          Length = 183

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++ +  I+ ++ +I  ++D ML+ ++    +GL A  +G+L R+ V+DL +
Sbjct: 10  IVYAPNDIFKKQAEYIDIVDDNIRTIVDKMLQNLHIERAVGLGANMVGILKRIAVVDLHE 69

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ +P+VFINP I  FS++   + EG LS P   A + RS  I V+Y+D N   Q + 
Sbjct: 70  N-NKSSPIVFINPNITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELA 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A+G LAT +QHE+D+LNG  F+D+LS+LKRD + KKM K ++L
Sbjct: 129 AEGFLATVIQHEIDYLNGKTFLDYLSKLKRDTLLKKMLKHIKL 171


>gi|157834784|pdb|2DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr,
           20 Structures
          Length = 147

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 102/143 (71%), Gaps = 3/143 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 8   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 66  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 124

Query: 129 LLATCLQHELDHLNGILFIDHLS 151
           LLA C+QHE+DHL G LF+D+LS
Sbjct: 125 LLAICIQHEMDHLVGKLFMDYLS 147


>gi|256830603|ref|YP_003159331.1| peptide deformylase [Desulfomicrobium baculatum DSM 4028]
 gi|256579779|gb|ACU90915.1| peptide deformylase [Desulfomicrobium baculatum DSM 4028]
          Length = 170

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 105/167 (62%), Gaps = 1/167 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + +V +P+P+L + + P+ +I  +I  L   MLE+MY+  GIGLAA Q+    RL+ +DL
Sbjct: 3   RTIVTYPNPVLAKKAAPVVEITEEIRALAAEMLEIMYADKGIGLAAPQVAESIRLITVDL 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                R++P VF+NP +     +    +EGCLS+  YR  VKR+  + +   D + +   
Sbjct: 63  SGPDKREDPHVFVNPVLSNLEGEVE-SEEGCLSVVGYRTTVKRAERLHLSATDLDGKPVE 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           + AD L+A CLQHE+DHL+G+LFID +S+LKR +  +K+ K ++ ++
Sbjct: 122 MDADDLMAICLQHEVDHLDGVLFIDKISKLKRTLYERKLKKWLKEKN 168


>gi|157830807|pdb|1DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr,
           9 Structures
 gi|256599481|pdb|2KMN|A Chain A, Solution Structure Of Peptide Deformylase Complexed With
           Actinonin
          Length = 147

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 102/143 (71%), Gaps = 3/143 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
            PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VID+ ++  
Sbjct: 8   IPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSEN-- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V INP+++  S +  + +EGCLSIP+ RA V R+  + +R +D + +   + ADG
Sbjct: 66  RDERLVLINPELLEKSGETGI-EEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADG 124

Query: 129 LLATCLQHELDHLNGILFIDHLS 151
           LLA C+QHE+DHL G LF+D+LS
Sbjct: 125 LLAICIQHEMDHLVGKLFMDYLS 147


>gi|258622314|ref|ZP_05717340.1| peptide deformylase [Vibrio mimicus VM573]
 gi|258624834|ref|ZP_05719762.1| peptide deformylase [Vibrio mimicus VM603]
 gi|262164774|ref|ZP_06032512.1| peptide deformylase [Vibrio mimicus VM223]
 gi|262173015|ref|ZP_06040692.1| peptide deformylase [Vibrio mimicus MB-451]
 gi|258582832|gb|EEW07653.1| peptide deformylase [Vibrio mimicus VM603]
 gi|258585638|gb|EEW10361.1| peptide deformylase [Vibrio mimicus VM573]
 gi|261890373|gb|EEY36360.1| peptide deformylase [Vibrio mimicus MB-451]
 gi|262027154|gb|EEY45821.1| peptide deformylase [Vibrio mimicus VM223]
          Length = 168

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 109/165 (66%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRVQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  PMV INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D + +   I
Sbjct: 65  DN--RDEPMVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDRDGKPLKI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            +   LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ESSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|152981416|ref|YP_001353370.1| formylmethionine deformylase [Janthinobacterium sp. Marseille]
 gi|151281493|gb|ABR89903.1| formylmethionine deformylase [Janthinobacterium sp. Marseille]
          Length = 173

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 105/164 (64%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M +  ++ +PDP L  V+ P+++I  DI  L+ +M + MY+ DGIGLAA Q+ V  +++V
Sbjct: 1   MTRLSVLQYPDPRLYTVAEPVQQITQDIRRLVADMTQTMYALDGIGLAATQVDVHLQVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +  +R    V INP I+      + Y+EGCLS+PD    V+R+A+I VR +D + +
Sbjct: 61  IDVSEKQNRLQ--VLINPTIVKMGGK-AEYEEGCLSVPDVFESVRRAAWIHVRALDLDGK 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              + A+GL A C+QHE+DHL G++F++HLS   +  I   +SK
Sbjct: 118 TIDVQAEGLKAMCIQHEMDHLQGMVFVEHLSPTNQRRILNSLSK 161


>gi|189499854|ref|YP_001959324.1| peptide deformylase [Chlorobium phaeobacteroides BS1]
 gi|238692288|sp|B3EPG5|DEF_CHLPB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189495295|gb|ACE03843.1| peptide deformylase [Chlorobium phaeobacteroides BS1]
          Length = 185

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 103/163 (63%), Gaps = 3/163 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+  + D +LRR ++P+++ ++ +  LI NMLE M + +GIGLAA Q+GV  RL+V+DL 
Sbjct: 4   PINTYSDEVLRRKAKPLKESDAQLEELISNMLESMRNAEGIGLAAPQVGVSLRLIVVDLS 63

Query: 65  --DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
             +     +PMV INP I++    F+  +EGCLSIPD R DV R + I ++Y D N +  
Sbjct: 64  LAEGYEAASPMVVINPHILSVKS-FNSMEEGCLSIPDVRGDVVRPSAIQLKYRDRNFEEC 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           I   D L A  +QHE+DHL+G LF+D + R  R  I K++  L
Sbjct: 123 IGEFDRLAARVIQHEIDHLDGTLFVDRMQRRDRRKIQKELDAL 165


>gi|254251081|ref|ZP_04944399.1| N-formylmethionyl-tRNA deformylase [Burkholderia dolosa AUO158]
 gi|124893690|gb|EAY67570.1| N-formylmethionyl-tRNA deformylase [Burkholderia dolosa AUO158]
          Length = 167

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 104/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+I+  SD   VY+EGCLS+P    +V+R   + VR ++ N +   +  +
Sbjct: 67  -KNELRAFINPEIVWSSDAKQVYEEGCLSVPGIYDEVERPDRVRVRALNENGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLMGRVFVEYLSPLKQSRIKTKMKKL 163


>gi|209693699|ref|YP_002261627.1| peptide deformylase [Aliivibrio salmonicida LFI1238]
 gi|238058218|sp|B6EP21|DEF_ALISL RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|208007650|emb|CAQ77760.1| peptide deformylase (polypeptide deformylase) [Aliivibrio
           salmonicida LFI1238]
          Length = 169

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 96/150 (64%), Gaps = 3/150 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ FPD  LR V++P++ +  +I   ID+M+E MY  +GIGLAA Q+    R+VVID+ +
Sbjct: 6   VLTFPDDRLRTVAKPVKTVTPEIQTFIDDMIETMYDEEGIGLAATQVDFHQRIVVIDVSE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R  PMV INP I   S D  + +EGCLS+P  +  V RSA ++V  +D +       
Sbjct: 66  T--RDEPMVLINPVITQKSGDDGI-EEGCLSVPGAKGMVPRSAEVSVTALDRDGNEFSFD 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKR 155
           AD LLA C+QHELDHL G LF+D+LS LKR
Sbjct: 123 ADDLLAICVQHELDHLEGKLFVDYLSPLKR 152


>gi|256544906|ref|ZP_05472277.1| peptide deformylase [Anaerococcus vaginalis ATCC 51170]
 gi|256399405|gb|EEU13011.1| peptide deformylase [Anaerococcus vaginalis ATCC 51170]
          Length = 154

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 96/139 (69%), Gaps = 4/139 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ S+ ++++N  I  L+D+M E MY  DG+GLAA Q+G+L R++V+D++D     
Sbjct: 11  DPILRKTSKEVKEVNDRIKILLDDMAETMYKADGVGLAAPQVGLLKRVIVVDVRDE---D 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP+II   D   V  EGCLS+P++ A+VKR A + V+Y+D N   + I A+GL 
Sbjct: 68  GLIKLVNPEIIE-KDGEQVGVEGCLSVPNFNANVKRPAHVVVKYLDENGDEKKIEAEGLK 126

Query: 131 ATCLQHELDHLNGILFIDH 149
           A  L HE+DHLNGILFID+
Sbjct: 127 AVALCHEIDHLNGILFIDN 145


>gi|226310454|ref|YP_002770348.1| peptide deformylase [Brevibacillus brevis NBRC 100599]
 gi|226093402|dbj|BAH41844.1| peptide deformylase [Brevibacillus brevis NBRC 100599]
          Length = 171

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 7/153 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDG-IGLAAVQIGVLYRLV 59
           M  K ++ F DPILR+V++P+E++N     L+D M E +Y+ DG  GLAA QIG+L R+V
Sbjct: 1   MAVKQILPFGDPILRKVAKPVEELNEKTFKLLDEMAETLYAADGRAGLAAPQIGILRRVV 60

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           V+D  D       +  INP+II  S +  +  E CLS P Y  +VKR+  + V+ ++   
Sbjct: 61  VMDCGD-----GLIELINPEIIERSGE-QIGMEACLSFPGYYGNVKRAEHVKVKTLNRQG 114

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSR 152
           +  I+  DG LA C+QHE+DHL+GILF+DH+  
Sbjct: 115 EEMILAGDGFLAVCMQHEIDHLDGILFVDHVQE 147


>gi|261252741|ref|ZP_05945314.1| peptide deformylase [Vibrio orientalis CIP 102891]
 gi|260936132|gb|EEX92121.1| peptide deformylase [Vibrio orientalis CIP 102891]
          Length = 167

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 106/159 (66%), Gaps = 5/159 (3%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQDHAH 68
           PDP L+  +  ++ + S +  LID+MLE +Y+TD GIGLA+ Q+G    +V+IDL +   
Sbjct: 10  PDPRLKVKAEKVQDL-STVQTLIDDMLETLYATDNGIGLASTQVGRKEAVVIIDLSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P++ +NP++++ SD  ++ QEGCLS+PDY ADV+R   + V  +D   +   I +D 
Sbjct: 67  RDEPLILVNPEVVSGSDK-ALGQEGCLSVPDYYADVERFTSVVVSALDREGKPITIESDE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            LA  +QHE+DHL+G LFID+LS LKR M  KK+ K V+
Sbjct: 126 FLAIVMQHEIDHLSGNLFIDYLSPLKRKMAMKKVKKYVK 164


>gi|171319440|ref|ZP_02908545.1| peptide deformylase [Burkholderia ambifaria MEX-5]
 gi|171095332|gb|EDT40313.1| peptide deformylase [Burkholderia ambifaria MEX-5]
          Length = 167

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 104/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDISEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD+  VY+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIIWSSDEKQVYEEGCLSVPGIYDEVERPDHVRVRALNEQGEAFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|254796760|ref|YP_003081596.1| peptide deformylase [Neorickettsia risticii str. Illinois]
 gi|254590005|gb|ACT69367.1| peptide deformylase [Neorickettsia risticii str. Illinois]
          Length = 205

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 104/165 (63%), Gaps = 13/165 (7%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL-- 63
           LVI PDPIL +VS  +  ++ +    +D+MLE MY   GIGLAAVQ+GVL R++V+D+  
Sbjct: 26  LVIEPDPILHKVSGNVVGVSDEKREFLDDMLETMYHYTGIGLAAVQVGVLERIIVVDVPP 85

Query: 64  --QDHAHRKN---------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
             + H+   N         P   +NP+II FS +     EGCLS+P+   ++ R   + V
Sbjct: 86  DKEWHSSPLNHVGYESSGGPYYLVNPEIIEFSRNLVSADEGCLSLPEQNYEIVRPDAVVV 145

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
           +Y++ N +  ++ A+G LA C+QHE+DHL+G L++ HLS+LK D+
Sbjct: 146 KYLNYNGEECLLKANGWLARCIQHEVDHLDGKLYVSHLSKLKYDL 190


>gi|186474806|ref|YP_001856276.1| peptide deformylase [Burkholderia phymatum STM815]
 gi|184191265|gb|ACC69230.1| peptide deformylase [Burkholderia phymatum STM815]
          Length = 167

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 103/159 (64%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+EK++  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ D   
Sbjct: 9   YPDKRLHKVAKPVEKVDDRIRKLVADMAETMYAAPGVGLAATQVDVHERVIVIDVSDT-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            +    FINP+I+  SD+  +++EGCLS+P    +V+R+  + VR M+   +   +  +G
Sbjct: 67  HEELRAFINPEILWSSDERKIHEEGCLSVPGIYDNVERAEKVRVRAMNEKGETFELDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQTRIKSKMKKLAH 165


>gi|220907940|ref|YP_002483251.1| peptide deformylase [Cyanothece sp. PCC 7425]
 gi|219864551|gb|ACL44890.1| peptide deformylase [Cyanothece sp. PCC 7425]
          Length = 188

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 95/153 (62%), Gaps = 2/153 (1%)

Query: 3   KKPLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           + PL I    D +LR+  + I ++N++   L   ML+ MYS DGIGLAA Q+GV  +L+V
Sbjct: 14  EPPLTIHYLGDRVLRQPCKRISQVNNETRELARTMLQTMYSADGIGLAAPQVGVNKQLIV 73

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+        P++ +NP I  FS + S+ QEGCLSIP    DVKR   I V Y D   +
Sbjct: 74  VDIHPDEAANPPLILVNPVIREFSPEVSLGQEGCLSIPGVYLDVKRPEMIEVAYKDEQGR 133

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRL 153
            Q++YA GLL+  +QHE+DHL G++F+D +  +
Sbjct: 134 PQVLYASGLLSRAIQHEIDHLGGVMFVDRVENM 166


>gi|226942060|ref|YP_002797134.1| Def [Laribacter hongkongensis HLHK9]
 gi|226716987|gb|ACO76125.1| Def [Laribacter hongkongensis HLHK9]
          Length = 167

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 101/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V+RP++ ++  +  LID+M E MY+  GIGLAA QI    RLVVIDL +   
Sbjct: 9   YPDERLHTVARPVDVVDDALRRLIDDMAETMYAAHGIGLAATQIDYHRRLVVIDLSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               +V INP +IT     +VY+EGCLS+P     V R+  +TV  +D N Q   + A+G
Sbjct: 67  HDGLLVLINP-VITRKAGETVYEEGCLSVPGIYDKVTRAETVTVEALDRNGQPFSLDAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL+G +F++HLS++K+  I +K+ K
Sbjct: 126 LLAICIQHEIDHLDGKVFVEHLSQMKQSRIKQKLKK 161


>gi|34499720|ref|NP_903935.1| peptide deformylase [Chromobacterium violaceum ATCC 12472]
 gi|39930829|sp|Q7NQ75|DEF_CHRVO RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|34105571|gb|AAQ61925.1| Polypeptide deformylase [Chromobacterium violaceum ATCC 12472]
          Length = 167

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E  ++ +   ID+M E MY   GIGLAA Q+    RLVV+D+ +   
Sbjct: 9   YPDERLHTVAKPVEVFDAALQQQIDDMFETMYEAKGIGLAATQVDYHRRLVVMDISEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+   D  +VY+EGCLS+P     V R+  + V+  D + +   + ADG
Sbjct: 67  RDERRVFINPEIVE-KDGETVYEEGCLSVPGIYDKVTRAERVKVKAQDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHLNG++F++ LS++K+  I  K+ K
Sbjct: 126 LLAICIQHELDHLNGVVFVERLSQMKQQRIKTKLKK 161


>gi|78484538|ref|YP_390463.1| peptide deformylase [Thiomicrospira crunogena XCL-2]
 gi|123755296|sp|Q31J84|DEF_THICR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|78362824|gb|ABB40789.1| peptide deformylase [Thiomicrospira crunogena XCL-2]
          Length = 169

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 101/164 (61%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  +V++PD  LR V +P+ ++  ++  LID M   MY   GIGLAA Q+ V  RL+V
Sbjct: 1   MDKLDIVLYPDEGLREVCKPVPEMTDELDKLIDEMFYTMYDAPGIGLAAPQVAVQQRLIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ +   +  P+  +NP+II  +   + ++EGCLSIP   A V R + I VR MD + +
Sbjct: 61  VDISET--KDEPIALLNPEIIKTAGKIT-WEEGCLSIPGIYAKVDRPSDILVRGMDRDGK 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
                A+ LLA C+QHE+DHLNG LFIDHLS LKR    +K  K
Sbjct: 118 TIEFEANELLAVCIQHEIDHLNGKLFIDHLSGLKRTRAIQKFKK 161


>gi|67459122|ref|YP_246746.1| polypeptide deformylase [Rickettsia felis URRWXCal2]
 gi|67004655|gb|AAY61581.1| Polypeptide deformylase [Rickettsia felis URRWXCal2]
          Length = 183

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++ +  I+ ++ +I  ++D ML+ +     +GL A  +G+L R+ V+DL +
Sbjct: 10  IVYAPNDIFKKQAEYIDIVDDNIRTIVDKMLQTLNIERAVGLGANMVGILKRIAVVDLHE 69

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ +P+VFINP+I  FS++   + EG LS P   A + RS  I V+Y+D N   Q + 
Sbjct: 70  N-NKSSPIVFINPEITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELE 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A+G LAT +QHE+D+LNG  F+D++S+LKRD + KKM K ++L
Sbjct: 129 AEGFLATVIQHEIDYLNGKTFLDYVSKLKRDTLLKKMLKHIKL 171


>gi|163756828|ref|ZP_02163937.1| peptide deformylase [Kordia algicida OT-1]
 gi|161323217|gb|EDP94557.1| peptide deformylase [Kordia algicida OT-1]
          Length = 196

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 103/177 (58%), Gaps = 12/177 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V F DP+LR+V++ I     ++  L++NM E MY+  G+GLAA Q+G+  RL +ID  
Sbjct: 4   PIVAFGDPVLRKVAKDITPDYPNLDTLLENMFETMYNAYGVGLAAPQVGLPIRLFMIDAT 63

Query: 65  --------DHAHRKN----PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
                   D   RK       VFIN KII  + +  V+ EGCLSIPD R DV R   I +
Sbjct: 64  GFAEDEELDEEQRKQLEGMKKVFINAKIIERNGEPWVFNEGCLSIPDIREDVFRPESIKI 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            YMD N +  +   DGL A  +QHE DH+ GILF D LS LKR ++  +++ + + R
Sbjct: 124 EYMDENFEKHVEEYDGLAARVIQHEYDHIEGILFTDKLSALKRRLLKGRLTNISRGR 180


>gi|124007536|ref|ZP_01692241.1| peptide deformylase [Microscilla marina ATCC 23134]
 gi|123987019|gb|EAY26775.1| peptide deformylase [Microscilla marina ATCC 23134]
          Length = 183

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 99/165 (60%), Gaps = 3/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V + DP+L++ +  I    +D+  L++NM E MY   G+GLAA QIG   RL VID +
Sbjct: 4   PIVAYGDPVLKKKAEEIAP-GTDVSELVENMFETMYEAHGVGLAAPQIGKSLRLFVIDPE 62

Query: 65  --DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
             D A +   M FINP I+       V++EGCLSIPD R +V R   I ++Y D N +  
Sbjct: 63  PMDEALQNMKMTFINPVILEEEGTEWVFEEGCLSIPDIRENVSRQPKIRIKYFDLNWKEH 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
               DG+ A  +QHE DH+ G+LF D+LS  K+ ++  +++K+ +
Sbjct: 123 EAEYDGMAARVIQHEYDHIEGVLFTDYLSGFKKRLLKSRLTKISK 167


>gi|167834978|ref|ZP_02461861.1| peptide deformylase [Burkholderia thailandensis MSMB43]
          Length = 167

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+++  SD   VY+EGCLS+P    +V+R   + VR +D   +   I  +
Sbjct: 67  -KNELRVFINPELVWTSDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDEKGETFEIDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLIGRVFVQYLSPLKQTRIKTKMKKL 163


>gi|170697716|ref|ZP_02888803.1| peptide deformylase [Burkholderia ambifaria IOP40-10]
 gi|170137331|gb|EDT05572.1| peptide deformylase [Burkholderia ambifaria IOP40-10]
          Length = 167

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 104/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDISEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD+  +Y+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIIWSSDEKQIYEEGCLSVPGIYDEVERPDHVRVRALNEQGESFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|37676994|ref|NP_937390.1| peptide deformylase [Vibrio vulnificus YJ016]
 gi|39930924|sp|Q7MCQ2|DEF1_VIBVY RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|37201538|dbj|BAC97360.1| N-formylmethionyl-tRNA deformylase [Vibrio vulnificus YJ016]
          Length = 168

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + + +  LID++LE +Y TD G+GLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRVQSKEVTDVAA-VQTLIDDLLETLYETDNGVGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  R  P+V +NPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D N +   I
Sbjct: 65  EN--RDEPLVLVNPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDRNGKELRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K  +LR
Sbjct: 122 ETSEFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHNKLR 166


>gi|157803421|ref|YP_001491970.1| peptide deformylase [Rickettsia canadensis str. McKiel]
 gi|166198522|sp|A8EXV2|DEF_RICCK RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|157784684|gb|ABV73185.1| peptide deformylase [Rickettsia canadensis str. McKiel]
          Length = 175

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 102/166 (61%), Gaps = 5/166 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V  PD  L++ S  + ++       +D+ML+ MY  D  GLAAVQ+G+L R++VID++
Sbjct: 5   PIVTAPDERLKQKSHRVLEVTDQTRKFMDDMLKTMYHEDAAGLAAVQVGILKRILVIDIK 64

Query: 65  DHAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           DH   + P  F     +NP II  S++     EGC+S+P  R +V R   I ++Y+D + 
Sbjct: 65  DHDPVERPKDFYPLFIVNPDIIDKSEELVTANEGCISVPRQRVEVARPESIKIKYLDYHN 124

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           + Q + A+  LA  +QHE DHL G L ID+LS LKRD++ +K+ KL
Sbjct: 125 KQQELEANDWLARVIQHEYDHLEGKLMIDYLSSLKRDVVLRKLKKL 170


>gi|332974243|gb|EGK11176.1| peptide deformylase [Kingella kingae ATCC 23330]
          Length = 167

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 102/160 (63%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  P+  L  V++P+ +++  I  L+ +M E MY+  GIGLAA Q+ V  R+VVIDL 
Sbjct: 5   PILTHPNERLHIVAQPVVQVDDRIRTLVQDMAETMYAARGIGLAATQVDVHERVVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +  ++   +  INP +IT  D  + Y+EGCLS+P     V R+  ITV ++D     Q +
Sbjct: 65  EEHNQL--LALINP-VITKKDGETTYEEGCLSVPGIYDTVTRAKTITVEFLDTQGNKQSL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G LF+++LS LK++ I  K+ K
Sbjct: 122 DADGLLAICIQHELDHLAGKLFVEYLSPLKQNRIKTKLKK 161


>gi|262403341|ref|ZP_06079901.1| peptide deformylase [Vibrio sp. RC586]
 gi|262350840|gb|EEY99973.1| peptide deformylase [Vibrio sp. RC586]
          Length = 168

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 108/165 (65%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRVQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  PMV INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D + +   I
Sbjct: 65  DN--RDEPMVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDRDGKPLRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|330818688|ref|YP_004362393.1| Polypeptide deformylase [Burkholderia gladioli BSR3]
 gi|327371081|gb|AEA62437.1| Polypeptide deformylase [Burkholderia gladioli BSR3]
          Length = 167

 Score =  134 bits (338), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++ ++  I  L+D+M E MY+  GIGLAA Q+ V  R++VID  +   
Sbjct: 9   YPDKRLHKVAKPVDVVDDRIRKLVDDMAETMYAAPGIGLAATQVDVHERVIVIDTSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+  SD   VY+EGCLS+P    +V+R   + VR +  + Q   +  +
Sbjct: 67  -KNALQVFINPEIVWSSDGKQVYEEGCLSVPGVYDEVERPDHVRVRALGRDGQPFELECE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK++ I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLMGRVFVQYLSPLKQNRIKSKMKKL 163


>gi|134094837|ref|YP_001099912.1| peptide deformylase [Herminiimonas arsenicoxydans]
 gi|133738740|emb|CAL61787.1| Peptide deformylase (PDF) (Polypeptide deformylase) [Herminiimonas
           arsenicoxydans]
          Length = 177

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 106/164 (64%), Gaps = 3/164 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PD  L +V++ + ++++ I  L+++M + MY+ DGIGLAA Q+ V  R+++
Sbjct: 1   MSKLAILQYPDERLHKVAQAVTQVDAGIRRLVEDMAQTMYAADGIGLAATQVNVHLRVIL 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ +   R   +V INP++I         +EGCLS+PD    VKR+A+I +R +D N +
Sbjct: 61  VDISED--RSQLLVMINPEVIKMGGSAEC-EEGCLSVPDVYEKVKRAAWIRLRALDINGK 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              + ADGL A C+QHELDHL G++F++HLS L +  I   ++K
Sbjct: 118 PFEVQADGLKAMCIQHELDHLQGMVFVEHLSPLNQARILSTLAK 161


>gi|115353233|ref|YP_775072.1| peptide deformylase [Burkholderia ambifaria AMMD]
 gi|115283221|gb|ABI88738.1| peptide deformylase [Burkholderia ambifaria AMMD]
          Length = 167

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 104/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDISEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD+  +Y+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIIWSSDEKQIYEEGCLSVPGIYDEVERPDHVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|323524423|ref|YP_004226576.1| peptide deformylase [Burkholderia sp. CCGE1001]
 gi|323381425|gb|ADX53516.1| peptide deformylase [Burkholderia sp. CCGE1001]
          Length = 167

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 105/159 (66%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+E++N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ D AH
Sbjct: 9   YPDKRLHKVAKPVEEVNDRIRRLVADMAETMYAAPGVGLAATQVDVHERVIVIDVSD-AH 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            +  + FINP+II  SD+  + +EGCLS+P    +V+R+  + VR ++   +   +  +G
Sbjct: 68  DQ-LLAFINPEIIWSSDEKKLSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFELDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCIQHEMDHLMGRVFVEYLSPLKQTRIKSKMKKLAH 165


>gi|325267954|ref|ZP_08134603.1| peptide deformylase [Kingella denitrificans ATCC 33394]
 gi|324980640|gb|EGC16303.1| peptide deformylase [Kingella denitrificans ATCC 33394]
          Length = 167

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 101/160 (63%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  P+  L  V++P+ +++  I  L+ +M E MY+  GIGLAA Q+ V  R+VVIDL 
Sbjct: 5   PILTHPNERLHIVAKPVAQVDDRIRTLVADMAETMYAAKGIGLAATQVDVHERVVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +  ++   +  INP  IT  D  + ++EGCLS+P     V R+  +TV Y+D   + Q +
Sbjct: 65  EEHNQL--LALINP-TITKKDGETTFEEGCLSVPGIYDTVSRAETVTVEYLDTEGKPQSL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHELDHL G LF+++LS LK+  I  K+ K
Sbjct: 122 DADGLLAICIQHELDHLAGKLFVEYLSPLKQSRIKSKLKK 161


>gi|148285009|ref|YP_001249099.1| peptide deformylase [Orientia tsutsugamushi str. Boryong]
 gi|158514262|sp|A5CF65|DEF_ORITB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|146740448|emb|CAM80944.1| polypeptide deformylase [Orientia tsutsugamushi str. Boryong]
          Length = 181

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 101/169 (59%), Gaps = 9/169 (5%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           LV  PDPIL++VS P++ +N  I  LID+MLE MY   G+GLAA Q+ V  R++V+DL  
Sbjct: 6   LVTAPDPILKKVSSPVDTVNDSIRQLIDDMLETMYHNHGVGLAAPQVAVSKRIIVLDLSK 65

Query: 66  ---------HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                    ++  K P+  +NP +   S+     +EGCLS+P    +V R   I V Y+D
Sbjct: 66  VDIEEDNITNSEYKYPLFMVNPIVKAISNQTVTAKEGCLSLPKQAIEVSRYHEIQVTYLD 125

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              + + + A G LA  +QHE+DHL+GIL +D+LS LK++     +SK+
Sbjct: 126 YYNKLKTLNAAGWLARAIQHEVDHLDGILLVDYLSNLKKEATLNTLSKI 174


>gi|33591756|ref|NP_879400.1| peptide deformylase [Bordetella pertussis Tohama I]
 gi|33594959|ref|NP_882602.1| peptide deformylase [Bordetella parapertussis 12822]
 gi|33599236|ref|NP_886796.1| peptide deformylase [Bordetella bronchiseptica RB50]
 gi|39931022|sp|Q7VS88|DEF2_BORPE RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|39931030|sp|Q7W1V3|DEF1_BORPA RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|39931046|sp|Q7WQS9|DEF1_BORBR RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|33565035|emb|CAE39984.1| polypeptide deformylase [Bordetella parapertussis]
 gi|33571399|emb|CAE44880.1| polypeptide deformylase [Bordetella pertussis Tohama I]
 gi|33575282|emb|CAE30745.1| polypeptide deformylase [Bordetella bronchiseptica RB50]
 gi|332381173|gb|AEE66020.1| peptide deformylase [Bordetella pertussis CS]
          Length = 170

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 100/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L + ++P+  ++  I  L+ +M + MY   G+GLAA Q+ V  R+VVID+ +  +
Sbjct: 9   YPDPRLHKTAKPVAVVDDRIRQLVRDMADTMYDAPGVGLAATQVDVHERVVVIDVSEEGN 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
             +  V INP+I   SD+   Y+EGCLS+P    +V+R+A I  + +D   Q     ADG
Sbjct: 69  --DLRVLINPEITWKSDERQTYEEGCLSVPGIYDEVERAARIRCKALDQQGQPYEFEADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL+G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCVQHEIDHLDGKVFVEYLSNLKQNRIKTKLKK 162


>gi|194291227|ref|YP_002007134.1| peptide deformylase [Cupriavidus taiwanensis LMG 19424]
 gi|193225062|emb|CAQ71073.1| peptide deformylase [Cupriavidus taiwanensis LMG 19424]
          Length = 168

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 105/169 (62%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PDP L  V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  ++VV
Sbjct: 1   MAKLDILTYPDPRLHTVAKPVAAVDDRIRQLVKDMAETMYEAPGIGLAATQVNVHEQVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R    VFINP+I+  SD+  V++EGCLS+P+    V+R   + VR ++   +
Sbjct: 61  IDVSET--RDQLQVFINPEIVWASDNRKVWEEGCLSVPEVYDRVERPDRVRVRALNEKGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              + AD LLA C+QHE+DHL G +F+++LS LK + I  K+ K  + R
Sbjct: 119 SFELEADDLLAVCIQHEIDHLRGKVFVEYLSPLKLNRIKSKLQKRERAR 167


>gi|167579358|ref|ZP_02372232.1| peptide deformylase [Burkholderia thailandensis TXDOH]
 gi|167617459|ref|ZP_02386090.1| peptide deformylase [Burkholderia thailandensis Bt4]
 gi|257140665|ref|ZP_05588927.1| peptide deformylase [Burkholderia thailandensis E264]
          Length = 167

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRRLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+  SD   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 67  -KNELRVFINPEIVWTSDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDEQGEPFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 163


>gi|51473406|ref|YP_067163.1| peptide deformylase [Rickettsia typhi str. Wilmington]
 gi|81692314|sp|Q68XG1|DEF_RICTY RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|51459718|gb|AAU03681.1| PDF [Rickettsia typhi str. Wilmington]
          Length = 175

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 103/165 (62%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  PD  L++ S+P+ +        + +MLE MY+ +G GLAAVQ+GVL R++VID++ 
Sbjct: 6   IVTAPDERLKQKSKPVLECTDQTRKFMHDMLETMYNANGAGLAAVQVGVLQRILVIDIKA 65

Query: 66  HAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           H   + P  F     +NP+II  S +     EGC+S+P+ R +V R   + +RY+D + +
Sbjct: 66  HDPVERPKDFYPLFIVNPEIIEQSTELVTANEGCISLPEQRIEVMRPESVKIRYLDYHGK 125

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q + A+  LA  +QHE DHL G L +D+LS LKRD++ +K+ KL
Sbjct: 126 SQELKANDWLARVIQHEYDHLEGKLMVDYLSNLKRDVVLRKLKKL 170


>gi|284159413|ref|YP_440687.3| peptide deformylase [Burkholderia thailandensis E264]
 gi|83652775|gb|ABC36838.1| peptide deformylase [Burkholderia thailandensis E264]
          Length = 179

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 21  YPDKRLHKVAKPVDKVDDRIRRLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 78

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+  SD   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 79  -KNELRVFINPEIVWTSDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDEQGEPFELDCE 137

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 138 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 175


>gi|113869635|ref|YP_728124.1| peptide deformylase [Ralstonia eutropha H16]
 gi|113528411|emb|CAJ94756.1| formylmethionine deformylase [Ralstonia eutropha H16]
          Length = 168

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 105/169 (62%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PDP L  V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  ++VV
Sbjct: 1   MAKLDILTYPDPRLHTVAKPVAAVDDRIRQLVKDMAETMYEAPGIGLAATQVNVHEQVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R    VFINP+I+  SD+  V++EGCLS+P+    V+R   + VR ++   +
Sbjct: 61  IDVSET--RDQLQVFINPEIVWASDNRKVWEEGCLSVPEVYDRVERPDRVRVRALNEKGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              + AD LLA C+QHE+DHL G +F+++LS LK + I  K+ K  + R
Sbjct: 119 SFELEADDLLAVCIQHEIDHLRGKVFVEYLSPLKLNRIKSKLQKRERTR 167


>gi|305664803|ref|YP_003861090.1| peptide deformylase [Maribacter sp. HTCC2170]
 gi|88707925|gb|EAR00164.1| peptide deformylase [Maribacter sp. HTCC2170]
          Length = 196

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 103/175 (58%), Gaps = 12/175 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V + DP+LR+V + IEK    +  LI+NM E MY+  G+GLAA QIG+  RL ++D  
Sbjct: 4   PIVAYGDPVLRKVGKEIEKNLPKLDELIENMWETMYNASGVGLAAPQIGLPVRLFLVDAT 63

Query: 65  DHAH--------RKN----PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
             A         RK+      VFIN K+   + +  V+ EGCLSIP+ R DV R   IT+
Sbjct: 64  PFAEDDELSEKERKDLDGFKKVFINAKMQEETGEDWVFNEGCLSIPEIREDVTRKDTITI 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Y D N + Q    DG+LA  +QHE DH+ GILF D LS LK+ ++  +++ + +
Sbjct: 124 TYFDENFKKQTENFDGILARIIQHEYDHIEGILFTDKLSSLKKRLLKGRLANISK 178


>gi|123965312|ref|YP_001010393.1| peptide deformylase [Prochlorococcus marinus str. MIT 9515]
 gi|158512726|sp|A2BU25|DEF_PROM5 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123199678|gb|ABM71286.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           MIT 9515]
          Length = 203

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 105/168 (62%), Gaps = 3/168 (1%)

Query: 5   PLVIFP--DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL IF   + +LR  ++ I K++ D  NL  +ML+ MYS  GIGLAA Q+G+   L+VID
Sbjct: 30  PLEIFKLGNDVLRTNAKRIGKVDLDTRNLAKDMLKSMYSAKGIGLAAPQVGISKELLVID 89

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           +        P++ INP+I  F +  + Y+EGCLSIP    +V R + I +R+ D   + +
Sbjct: 90  INFEDSAAEPLILINPEITAFGNTLNSYEEGCLSIPGVYLNVVRPSTIKLRFSDEMGRPR 149

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
            + ADGLLA C+QHE+DHL G+LF+D ++  K D+ T+   +  Q++D
Sbjct: 150 KMNADGLLARCIQHEVDHLRGVLFVDRVTS-KEDLKTELKKEGFQMKD 196


>gi|157962208|ref|YP_001502242.1| peptide deformylase [Shewanella pealeana ATCC 700345]
 gi|157847208|gb|ABV87707.1| peptide deformylase [Shewanella pealeana ATCC 700345]
          Length = 163

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (62%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R + P+  I S +   ID+++E MY TD GIGLAA Q+G L+ ++VIDL 
Sbjct: 6   ILTIPDERLKRKAVPVTDIES-VQGFIDDLIETMYDTDDGIGLAATQVGSLHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PMV INP+I+    ++   +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  EE--RDQPMVLINPEIVESRGEYQ-GEEGCLSIPGYRAKVNRHEGVKVSALDRQGKAFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHLNG++F DHLS LK+ +  KK+ K
Sbjct: 122 DTDEFLAIVLQHEMDHLNGVVFTDHLSMLKQQVALKKVKK 161


>gi|152981308|ref|YP_001351833.1| polypeptide deformylase [Janthinobacterium sp. Marseille]
 gi|151281385|gb|ABR89795.1| polypeptide deformylase [Janthinobacterium sp. Marseille]
          Length = 178

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 98/157 (62%), Gaps = 4/157 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD-HA 67
           +PDP L +V++P+   +  I  L+ +M E MY   G+GLAA Q+ V  +++VID  + H 
Sbjct: 9   YPDPRLHKVAKPVSVFDERIKTLVADMAETMYDAPGVGLAASQVDVHEQVIVIDTSETHT 68

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
             +    +INP+II  S +  VY EGCLS+P     V+R A + VR  D + +   + AD
Sbjct: 69  ELR---AYINPEIIWASPEMQVYDEGCLSVPGVYDGVERHAKVKVRAFDADGKQFELEAD 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           GLLA C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 126 GLLAVCIQHEMDHLKGKVFVEYLSPLKRNRIKAKMLK 162


>gi|218887129|ref|YP_002436450.1| peptide deformylase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758083|gb|ACL08982.1| peptide deformylase [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 184

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 95/160 (59%), Gaps = 5/160 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L      I +I  +I  L  +M E MY  DGIGLAA Q+G   RL+V+D+     
Sbjct: 8   YPDPRLAVECEDITEITDEIRQLAADMAETMYRQDGIGLAAPQVGEHCRLIVVDVSGPEK 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPD-YRADVKRSAFITVRYMDCNAQHQIIYAD 127
           R+  M F+NP++   + D    +EGCLS+P  YRA V RS  + +   D +     + AD
Sbjct: 68  REALMTFVNPRL-ELTGDKVDSEEGCLSVPGGYRATVTRSDTVRLTARDLDGNEVCMDAD 126

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKR---DMITKKMSK 164
           GLLA CLQHE+DHL G LFIDH+SRLKR   D   KKM K
Sbjct: 127 GLLAVCLQHEVDHLKGTLFIDHISRLKRTLYDSRVKKMQK 166


>gi|124385914|ref|YP_001028237.1| peptide deformylase [Burkholderia mallei NCTC 10229]
 gi|254203663|ref|ZP_04910023.1| polypeptide deformylase [Burkholderia mallei FMH]
 gi|124293934|gb|ABN03203.1| peptide deformylase [Burkholderia mallei NCTC 10229]
 gi|147745175|gb|EDK52255.1| polypeptide deformylase [Burkholderia mallei FMH]
          Length = 216

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 58  YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 115

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 116 -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGESFELDCE 174

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 175 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 212


>gi|325526701|gb|EGD04225.1| peptide deformylase [Burkholderia sp. TJI49]
          Length = 167

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD   VY+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIIWSSDAKQVYEEGCLSVPGIYDEVERPDHVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQSRIKTKMKKL 163


>gi|78067947|ref|YP_370716.1| peptide deformylase [Burkholderia sp. 383]
 gi|77968692|gb|ABB10072.1| peptide deformylase [Burkholderia sp. 383]
          Length = 167

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 104/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+I+  SD+  +Y+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIVWSSDEKQIYEEGCLSVPGIYDEVERPDHVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|172062105|ref|YP_001809757.1| peptide deformylase [Burkholderia ambifaria MC40-6]
 gi|171994622|gb|ACB65541.1| peptide deformylase [Burkholderia ambifaria MC40-6]
          Length = 167

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDISEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD+  +Y+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIIWSSDEKQIYEEGCLSVPGIYDEVERPDHVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|15604081|ref|NP_220596.1| peptide deformylase [Rickettsia prowazekii str. Madrid E]
 gi|6225256|sp|Q9ZDV8|DEF_RICPR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|3860772|emb|CAA14673.1| METHIONYL-TRNA DEFORMYLASE (def) [Rickettsia prowazekii]
 gi|292571805|gb|ADE29720.1| Polypeptide deformylase [Rickettsia prowazekii Rp22]
          Length = 175

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 103/165 (62%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  PD  L++ S+P+ +        + +MLE MY+ DG GLAAVQ+G+L R++VID+++
Sbjct: 6   IVTAPDERLKQKSKPVLECTDQTRKFMHDMLETMYNADGAGLAAVQVGILLRILVIDIKE 65

Query: 66  HAHRKNPMVF-----INPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +   + P  F     +NP+II  S +     EGC+S+P  R +V R   + +RY+D + +
Sbjct: 66  YDPVERPKDFYPLFIVNPEIIEKSTELVTANEGCISLPKQRIEVTRPESVKIRYLDYHGK 125

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q + A+  LA  +QHE DHL G L +D+LS LKRD++ +K+ KL
Sbjct: 126 SQELKANDWLARVIQHEYDHLEGKLMVDYLSNLKRDVVLRKLKKL 170


>gi|319790017|ref|YP_004151650.1| peptide deformylase [Thermovibrio ammonificans HB-1]
 gi|317114519|gb|ADU97009.1| peptide deformylase [Thermovibrio ammonificans HB-1]
          Length = 177

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 106/160 (66%), Gaps = 3/160 (1%)

Query: 8   IFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ--D 65
           I+PD  L+  ++ +E+ N ++++L++ M E MY   G+GLAA Q+GVL R++++DL+   
Sbjct: 6   IYPDEALKSKAQKVEEFNQELVDLVNGMFETMYKRGGVGLAANQVGVLKRVLILDLKAGT 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
               KNP+V +NP+I+  S+   V +EGCLS+P     VKR+ ++ V+  + + +   I 
Sbjct: 66  EEQGKNPIVLVNPEIVA-SEGEVVKEEGCLSLPGLYRKVKRAQWVKVKAQNLDGEEIEIE 124

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            +GLLA  LQHE+DHLNG++FID LS L++ +  +K  KL
Sbjct: 125 GEGLLARALQHEIDHLNGVVFIDRLSPLQKRLALEKFKKL 164


>gi|74316032|ref|YP_313772.1| peptide deformylase [Thiobacillus denitrificans ATCC 25259]
 gi|74055527|gb|AAZ95967.1| formylmethionine deformylase [Thiobacillus denitrificans ATCC
           25259]
          Length = 177

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 100/156 (64%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++P+E +++ I  L+D+M E MY+  GIGLAA Q+ V  R+VVID  +   
Sbjct: 9   YPDSRLHTVAKPVEAVDARIRKLVDDMAETMYAAPGIGLAATQVNVHERVVVIDTSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S      +EGCLS+P     V R+  +TVR +D + +   + ADG
Sbjct: 67  RDALRVFINPEIVAQSGREE-SEEGCLSVPGVFDRVTRAERVTVRALDRDGKPFELEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL G +F+D+LS LKR+ I  K+ K
Sbjct: 126 LLAVCIQHELDHLAGKVFVDYLSPLKRNRIKTKLLK 161


>gi|297537405|ref|YP_003673174.1| peptide deformylase [Methylotenera sp. 301]
 gi|297256752|gb|ADI28597.1| peptide deformylase [Methylotenera sp. 301]
          Length = 166

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 103/159 (64%), Gaps = 3/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P++++++ I  LID+M E MY   GIGLAA Q+    +L++ID  +   
Sbjct: 9   YPDPRLHKVAKPVKEVDASIRRLIDDMRETMYDAPGIGLAATQVDQHIQLLIIDTSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           + +  VFINPKII  S     Y+EGCLS+P     V R+  +TV  +D N +   + A+G
Sbjct: 67  KDHLQVFINPKIIEKSG-VQDYEEGCLSVPGVYETVTRAEKVTVEALDYNGKPFTLKAEG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LL+ C+QHE+DHL G +F+++LS LKR  I  KM KL +
Sbjct: 126 LLSICIQHEMDHLLGKVFVEYLSPLKRSRIKNKMLKLTR 164


>gi|73543090|ref|YP_297610.1| peptide deformylase [Ralstonia eutropha JMP134]
 gi|72120503|gb|AAZ62766.1| peptide deformylase [Ralstonia eutropha JMP134]
          Length = 168

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 108/169 (63%), Gaps = 2/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++ +PDP L  V++P+++++  I  L+ +M E MY   GIGLAA Q+ V  ++VV
Sbjct: 1   MAKLDILTYPDPRLHTVAKPVKEVDDRIRQLVKDMAETMYEAPGIGLAATQVNVHEQVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+ +   R    VFINP+I+  SD+  V++EGCLS+P+    V+R   + VR ++   +
Sbjct: 61  IDVSET--RDALQVFINPEIVWASDNRKVWEEGCLSVPEVYDRVERPDRVRVRALNEKGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              + AD LLA C+QHE+DHL G +F+++LS LK++ I  K+ K  + R
Sbjct: 119 TFELDADDLLAVCIQHEMDHLLGKVFVEYLSPLKQNRIKSKLHKRERAR 167


>gi|269215460|ref|ZP_06159314.1| peptide deformylase [Slackia exigua ATCC 700122]
 gi|269130947|gb|EEZ62022.1| peptide deformylase [Slackia exigua ATCC 700122]
          Length = 187

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (59%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PDP LR+V    +  +  +  L   M + MY+ +G GLAA Q+GVL RL+VID   
Sbjct: 13  VLAYPDPTLRQVCEDCDPADKSLRKLARRMAKTMYADNGCGLAAPQVGVLKRLIVIDCDQ 72

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
            +  KNP+  +NP +I       V +EGCLS+P     ++R A+  VRY D N +  II 
Sbjct: 73  DSGAKNPITLLNPTVIETRGPEVVEEEGCLSVPGITVPIRRPAYAIVRYTDLNGEDWIIE 132

Query: 126 ADGLLATCLQHELDHLNGILFIDH 149
            DGLLA CLQHE+DHLNGI   + 
Sbjct: 133 GDGLLARCLQHEIDHLNGITLFES 156


>gi|134284113|ref|ZP_01770807.1| polypeptide deformylase [Burkholderia pseudomallei 305]
 gi|76578939|gb|ABA48414.1| peptide deformylase [Burkholderia pseudomallei 1710b]
 gi|134244565|gb|EBA44669.1| polypeptide deformylase [Burkholderia pseudomallei 305]
          Length = 201

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 43  YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 100

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 101 -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGEPFELDCE 159

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 160 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 197


>gi|15892597|ref|NP_360311.1| polypeptide deformylase [Rickettsia conorii str. Malish 7]
 gi|23396566|sp|Q92HU7|DEFL_RICCN RecName: Full=Peptide deformylase-like; AltName: Full=Polypeptide
           deformylase-like
 gi|15619763|gb|AAL03212.1| polypeptide deformylase [Rickettsia conorii str. Malish 7]
          Length = 183

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++ +  I+ ++ +I  ++D ML+ ++    +GL A  +G+L R+ V+DL +
Sbjct: 10  IVYAPNDIFKKQAEYIDIVDDNIRTIVDKMLQNLHIERAVGLGANMVGILKRIAVVDLHE 69

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ +P+VFINP I  FS++   + EG LS P   A + RS  I V+Y+D N   Q + 
Sbjct: 70  N-NKSSPIVFINPNITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELA 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A+G LAT +QHE+++LNG  F+D LS+LKRD + KKM K ++L
Sbjct: 129 AEGFLATVIQHEIEYLNGKTFLDSLSKLKRDTLLKKMLKHIKL 171


>gi|160947099|ref|ZP_02094266.1| hypothetical protein PEPMIC_01031 [Parvimonas micra ATCC 33270]
 gi|158446233|gb|EDP23228.1| hypothetical protein PEPMIC_01031 [Parvimonas micra ATCC 33270]
          Length = 164

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (65%), Gaps = 4/138 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+LR+ +R +E I+  I NL+++M E MY++DG+GLA  QIG+L RLV ID+ D     
Sbjct: 11  DPVLRKKARKVEVIDDKIKNLLEDMAETMYNSDGVGLACPQIGILKRLVTIDVGDE---H 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  INP+I+  S +  V  EGCLSIPD R  VKR   +  +Y D +   QII A GLL
Sbjct: 68  GLLKMINPEILESSGE-QVGPEGCLSIPDVRGFVKRPEKVKFKYTDVDENEQIIDATGLL 126

Query: 131 ATCLQHELDHLNGILFID 148
           A C+ HE+DHLNGILF D
Sbjct: 127 AVCICHEIDHLNGILFTD 144


>gi|126449977|ref|YP_001081879.1| polypeptide deformylase [Burkholderia mallei NCTC 10247]
 gi|251767985|ref|ZP_02269083.2| peptide deformylase [Burkholderia mallei PRL-20]
 gi|254177135|ref|ZP_04883792.1| polypeptide deformylase [Burkholderia mallei ATCC 10399]
 gi|126242847|gb|ABO05940.1| peptide deformylase [Burkholderia mallei NCTC 10247]
 gi|160698176|gb|EDP88146.1| polypeptide deformylase [Burkholderia mallei ATCC 10399]
 gi|243061150|gb|EES43336.1| peptide deformylase [Burkholderia mallei PRL-20]
          Length = 179

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 21  YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 78

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 79  -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGESFELDCE 137

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 138 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 175


>gi|186684172|ref|YP_001867368.1| peptide deformylase [Nostoc punctiforme PCC 73102]
 gi|186466624|gb|ACC82425.1| peptide deformylase [Nostoc punctiforme PCC 73102]
          Length = 187

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 92/141 (65%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++ ++  ++  ML+ MYS DGIGLAA Q+G+  +L+VIDL+      
Sbjct: 24  DRVLRQAAKRISKVDDELRQMVREMLQTMYSKDGIGLAAPQVGIHKQLIVIDLEPENAAN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP I   S D SV +EGCLSIP+   DVKR   + + Y D   + + + A+ LL
Sbjct: 84  PPLVLINPTIKQVSRDISVAEEGCLSIPNVYLDVKRPEVVEIAYKDEYGRPRTLKANDLL 143

Query: 131 ATCLQHELDHLNGILFIDHLS 151
             C+QHE+DHLNG++F+D + 
Sbjct: 144 GRCIQHEMDHLNGVVFVDRVE 164


>gi|52842801|ref|YP_096600.1| peptide deformylase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54295432|ref|YP_127847.1| hypothetical protein lpl2518 [Legionella pneumophila str. Lens]
 gi|54298584|ref|YP_124953.1| hypothetical protein lpp2648 [Legionella pneumophila str. Paris]
 gi|148358671|ref|YP_001249878.1| peptide deformylase [Legionella pneumophila str. Corby]
 gi|296108239|ref|YP_003619940.1| peptide deformylase [Legionella pneumophila 2300/99 Alcoy]
 gi|52629912|gb|AAU28653.1| peptide deformylase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53752369|emb|CAH13801.1| hypothetical protein lpp2648 [Legionella pneumophila str. Paris]
 gi|53755264|emb|CAH16758.1| hypothetical protein lpl2518 [Legionella pneumophila str. Lens]
 gi|148280444|gb|ABQ54532.1| peptide deformylase [Legionella pneumophila str. Corby]
 gi|295650141|gb|ADG25988.1| peptide deformylase [Legionella pneumophila 2300/99 Alcoy]
 gi|307611474|emb|CBX01145.1| hypothetical protein LPW_28441 [Legionella pneumophila 130b]
          Length = 170

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 106/169 (62%), Gaps = 3/169 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++  PD  LR++++P+E  +  +  LI++M + MY   G+GLAA QIGV  RL V
Sbjct: 1   MAIRKILYLPDERLRKIAKPVETFDESLQTLINDMFDTMYDARGVGLAAPQIGVSLRLSV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+     +K  +V +NP+I++ S     ++EGCLS+P     V R+  +TV+ +D   +
Sbjct: 61  IDIV--GDKKEQIVIVNPEIVS-SHGEKEFEEGCLSVPGAYDTVVRAEKVTVKALDRFGK 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              I  +GLLA CLQHE+DH+NG LF+D LS LKR M  +K+ K  +L+
Sbjct: 118 PFEITGEGLLAECLQHEIDHMNGKLFVDMLSPLKRMMARRKLDKFKRLQ 166


>gi|254424040|ref|ZP_05037758.1| peptide deformylase [Synechococcus sp. PCC 7335]
 gi|196191529|gb|EDX86493.1| peptide deformylase [Synechococcus sp. PCC 7335]
          Length = 187

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 94/141 (66%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ + KI++ + +L+  ML+ MYS DGIGLAA Q+GV  +L+VID        
Sbjct: 24  DRVLRQPAKRVAKIDNALRDLVRKMLQTMYSEDGIGLAAPQVGVNKQLLVIDADPENEAA 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
           + +V +NPKII +SD+ +  QEGCLSIP    DV R A I V + D N + + + AD LL
Sbjct: 84  SALVLVNPKIIRYSDELAAGQEGCLSIPGVYLDVIRPAAIEVSFKDENGRPRKLKADDLL 143

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A  +QHE+DHLNG+LF+D + 
Sbjct: 144 ARVIQHEMDHLNGVLFVDRVE 164


>gi|238028945|ref|YP_002913176.1| polypeptide deformylase [Burkholderia glumae BGR1]
 gi|237878139|gb|ACR30472.1| Polypeptide deformylase [Burkholderia glumae BGR1]
          Length = 167

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+  ++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID  +   
Sbjct: 9   YPDKRLHKVAKPVAVVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDTSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+  SD   +Y+EGCLS+P    +V+R   + VR +D   Q   +  +
Sbjct: 67  -KNELRVFINPEIVWSSDGKQIYEEGCLSVPGVYDEVERPDHVRVRALDVQGQQFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK++ I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLLGRVFVQYLSPLKQNRIKSKMKKL 163


>gi|53724672|ref|YP_101982.1| peptide deformylase [Burkholderia mallei ATCC 23344]
 gi|67642453|ref|ZP_00441209.1| peptide deformylase [Burkholderia mallei GB8 horse 4]
 gi|121600699|ref|YP_994101.1| peptide deformylase [Burkholderia mallei SAVP1]
 gi|254208639|ref|ZP_04914987.1| polypeptide deformylase [Burkholderia mallei JHU]
 gi|254360307|ref|ZP_04976577.1| polypeptide deformylase [Burkholderia mallei 2002721280]
 gi|52428095|gb|AAU48688.1| polypeptide deformylase [Burkholderia mallei ATCC 23344]
 gi|121229509|gb|ABM52027.1| polypeptide deformylase [Burkholderia mallei SAVP1]
 gi|147750515|gb|EDK57584.1| polypeptide deformylase [Burkholderia mallei JHU]
 gi|148029547|gb|EDK87452.1| polypeptide deformylase [Burkholderia mallei 2002721280]
 gi|238523609|gb|EEP87046.1| peptide deformylase [Burkholderia mallei GB8 horse 4]
          Length = 167

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 67  -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGESFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 163


>gi|189184237|ref|YP_001938022.1| peptide deformylase [Orientia tsutsugamushi str. Ikeda]
 gi|238692021|sp|B3CTU1|DEF_ORITI RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189181008|dbj|BAG40788.1| methionyl-tRNA deformylase [Orientia tsutsugamushi str. Ikeda]
          Length = 181

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 102/169 (60%), Gaps = 9/169 (5%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           L+  PDPIL++V+ P++ +N  I  L+D+MLE MY   G+GLAA Q+ V  R++V+DL  
Sbjct: 6   LITAPDPILKKVASPVDTVNDSIRQLMDDMLETMYHNHGVGLAAPQVAVSKRIIVLDLSK 65

Query: 66  ---------HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
                    ++  K P+  +NP +   S+  +  +EGCLS+P    +V R   I V Y+D
Sbjct: 66  VDIKEDNITNSEYKYPLFMVNPIVKAISNQTATAKEGCLSLPKQAIEVSRYHEIQVTYLD 125

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
              +   + A+G LA  +QHE+DHL+GIL +D+LS LK++     +SK+
Sbjct: 126 YYNKLTTLNAEGWLARAIQHEVDHLDGILLVDYLSNLKKEAALNTLSKI 174


>gi|167561029|ref|ZP_02353945.1| peptide deformylase [Burkholderia oklahomensis EO147]
 gi|167568291|ref|ZP_02361165.1| peptide deformylase [Burkholderia oklahomensis C6786]
          Length = 167

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 102/158 (64%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRRLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR ++   +   I  +
Sbjct: 67  -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALNEQGESFEIDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVQYLSSLKQSRIKTKMKKL 163


>gi|330445859|ref|ZP_08309511.1| peptide deformylase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490050|dbj|GAA04008.1| peptide deformylase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 173

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 5/163 (3%)

Query: 10  PDPILRRVSRPIEKINSD-IMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
           P+P LR  +  +  + ++ I  LID+ML+ MY T +GIGLAA Q+G    ++VIDL +  
Sbjct: 10  PNPKLRVQAEEVTDVKAEHIQTLIDDMLQTMYETGNGIGLAAPQVGRKESIIVIDLSEE- 68

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R  P VF+NPKI+   ++  V QEGCLS+PDY ADV+R   I +  +D +     +  D
Sbjct: 69  -RNEPQVFVNPKIVR-GENPVVGQEGCLSVPDYYADVERFEKIELTALDRDGNDIHLERD 126

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
             LA  LQHE+DHL GILFID+LS LKR M  KK+ K +++++
Sbjct: 127 DFLAIALQHEIDHLKGILFIDYLSPLKRQMAMKKVKKYLKMQE 169


>gi|325983533|ref|YP_004295935.1| peptide deformylase [Nitrosomonas sp. AL212]
 gi|325533052|gb|ADZ27773.1| peptide deformylase [Nitrosomonas sp. AL212]
          Length = 167

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V+ P+ +I   I  LI++M E MY+  GIGLAA Q+ V  R++VID  +   
Sbjct: 9   YPDEKLHTVAAPVSQITDKIRTLINDMAETMYAAPGIGLAATQVDVHERVIVIDTSEA-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R + +V INP+I T S+  S Y+EGCLS+P     V+R+  + VR ++   +  ++ ADG
Sbjct: 67  RNDLLVLINPEI-TASNGISDYEEGCLSVPGIYGKVQRAESVKVRALNAQGESFVLDADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++ SRLK+     K+ K
Sbjct: 126 LLAVCIQHEMDHLAGKVFVEYWSRLKQVRTLAKLKK 161


>gi|83589748|ref|YP_429757.1| peptide deformylase [Moorella thermoacetica ATCC 39073]
 gi|123766806|sp|Q2RK25|DEF_MOOTA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|83572662|gb|ABC19214.1| peptide deformylase [Moorella thermoacetica ATCC 39073]
          Length = 155

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 97/147 (65%), Gaps = 6/147 (4%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++   DP+LR  S+P+ KI S++  L+DN+ + MY   G+GLAA QIGVL R++V+D+ +
Sbjct: 6   ILTLGDPLLREKSQPVRKITSNVWKLLDNLADTMYDAPGVGLAAPQIGVLKRVIVVDVGE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
                     INP++I  S +  V  EGCLSIP  + +V R+A +TVR +D + + + I 
Sbjct: 66  GLTE-----LINPEVIAASGE-EVGAEGCLSIPGAQGEVPRAAVVTVRGLDRHGRVREIR 119

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSR 152
           A+GL A  LQHE+DHL+GILFID + R
Sbjct: 120 AEGLYARALQHEIDHLDGILFIDKVVR 146


>gi|229514651|ref|ZP_04404112.1| peptide deformylase [Vibrio cholerae TMA 21]
 gi|229348631|gb|EEO13589.1| peptide deformylase [Vibrio cholerae TMA 21]
          Length = 168

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRLQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P+V INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D   +   I
Sbjct: 65  DN--RDQPLVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLCI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|161526293|ref|YP_001581305.1| peptide deformylase [Burkholderia multivorans ATCC 17616]
 gi|160343722|gb|ABX16808.1| peptide deformylase [Burkholderia multivorans ATCC 17616]
          Length = 181

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 23  YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 80

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD   VY+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 81  -KNELRAFINPEIIWSSDGKQVYEEGCLSVPGIYDEVERPDRVRVRALNEQGETFELDCE 139

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 140 GLLAVCIQHEMDHLMGRVFVEYLSPLKQSRIKTKMKKL 177


>gi|126441948|ref|YP_001057204.1| polypeptide deformylase [Burkholderia pseudomallei 668]
 gi|126453149|ref|YP_001064443.1| polypeptide deformylase [Burkholderia pseudomallei 1106a]
 gi|217424946|ref|ZP_03456442.1| peptide deformylase [Burkholderia pseudomallei 576]
 gi|226194603|ref|ZP_03790198.1| peptide deformylase [Burkholderia pseudomallei Pakistan 9]
 gi|237810338|ref|YP_002894789.1| peptide deformylase [Burkholderia pseudomallei MSHR346]
 gi|242315752|ref|ZP_04814768.1| peptide deformylase [Burkholderia pseudomallei 1106b]
 gi|254182253|ref|ZP_04888850.1| polypeptide deformylase [Burkholderia pseudomallei 1655]
 gi|254197101|ref|ZP_04903524.1| polypeptide deformylase [Burkholderia pseudomallei S13]
 gi|126221441|gb|ABN84947.1| peptide deformylase [Burkholderia pseudomallei 668]
 gi|126226791|gb|ABN90331.1| peptide deformylase [Burkholderia pseudomallei 1106a]
 gi|169653843|gb|EDS86536.1| polypeptide deformylase [Burkholderia pseudomallei S13]
 gi|184212791|gb|EDU09834.1| polypeptide deformylase [Burkholderia pseudomallei 1655]
 gi|217391966|gb|EEC31992.1| peptide deformylase [Burkholderia pseudomallei 576]
 gi|225933304|gb|EEH29296.1| peptide deformylase [Burkholderia pseudomallei Pakistan 9]
 gi|237506162|gb|ACQ98480.1| peptide deformylase [Burkholderia pseudomallei MSHR346]
 gi|242138991|gb|EES25393.1| peptide deformylase [Burkholderia pseudomallei 1106b]
          Length = 179

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 21  YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 78

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 79  -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGEPFELDCE 137

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 138 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 175


>gi|221201858|ref|ZP_03574895.1| peptide deformylase [Burkholderia multivorans CGD2M]
 gi|221207636|ref|ZP_03580644.1| peptide deformylase [Burkholderia multivorans CGD2]
 gi|221214668|ref|ZP_03587638.1| peptide deformylase [Burkholderia multivorans CGD1]
 gi|221165558|gb|EED98034.1| peptide deformylase [Burkholderia multivorans CGD1]
 gi|221172482|gb|EEE04921.1| peptide deformylase [Burkholderia multivorans CGD2]
 gi|221178278|gb|EEE10688.1| peptide deformylase [Burkholderia multivorans CGD2M]
          Length = 181

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 23  YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 80

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD   VY+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 81  -KNELRAFINPEIIWSSDGKQVYEEGCLSVPGIYDEVERPDRVRVRALNEQGETFELDCE 139

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 140 GLLAVCIQHEMDHLMGRVFVEYLSPLKQSRIKTKMKKL 177


>gi|167623826|ref|YP_001674120.1| peptide deformylase [Shewanella halifaxensis HAW-EB4]
 gi|167353848|gb|ABZ76461.1| peptide deformylase [Shewanella halifaxensis HAW-EB4]
          Length = 163

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (62%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R + P+  I S +   ID+++E MY TD GIGLAA Q+G L+ ++VIDL 
Sbjct: 6   ILTIPDERLKRKAVPVTDIES-VQGFIDDLIETMYDTDDGIGLAATQVGSLHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D   R  PMV INP+ +    ++   +EGCLSIP YRA V R   + V  +D + +   I
Sbjct: 65  DE--RDQPMVLINPEFLESRGEYQ-GEEGCLSIPGYRAKVNRHQGVKVTALDRHGKAFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHLNG++F DHLS LK+ +  KK+ K
Sbjct: 122 DTDEFLAIVLQHEMDHLNGVVFTDHLSMLKQQVALKKVKK 161


>gi|303233917|ref|ZP_07320566.1| peptide deformylase [Finegoldia magna BVS033A4]
 gi|302494842|gb|EFL54599.1| peptide deformylase [Finegoldia magna BVS033A4]
          Length = 162

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 91/150 (60%), Gaps = 3/150 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ SR +EKI++ I  + ++M E MY   GIGLA VQ+G+L R+VVID+QD   + 
Sbjct: 11  DPILRKKSREVEKIDNRIKQIAEDMFETMYENKGIGLACVQVGMLKRIVVIDMQDEDGK- 69

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             MV INPKII  S+D  +  EGCLS+P     V+R   + V Y D N   Q +      
Sbjct: 70  --MVLINPKIIEKSEDKQINIEGCLSVPGKNGYVERPKTVVVEYTDLNGNTQRVTGTDYK 127

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITK 160
           A C  HELDHL+G+L+ D +  L  + + +
Sbjct: 128 AHCFCHELDHLDGVLYTDKVLNLSEEEVER 157


>gi|296161362|ref|ZP_06844169.1| peptide deformylase [Burkholderia sp. Ch1-1]
 gi|295888348|gb|EFG68159.1| peptide deformylase [Burkholderia sp. Ch1-1]
          Length = 167

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 103/162 (63%), Gaps = 2/162 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PD  L ++++P+E +N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ D
Sbjct: 6   IINYPDKRLHKIAKPVEAVNDRIRRLVKDMAETMYAAPGVGLAATQVDVHERVIVIDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
                  + FINP+II  SD+  + +EGCLS+P    +V+R+  + VR ++   +   + 
Sbjct: 66  D--HNELLAFINPEIIWSSDERKLSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFEMD 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 124 CEGLLAVCIQHEMDHLMGRVFVEYLSSLKQTRIKSKMKKLAH 165


>gi|167585076|ref|ZP_02377464.1| peptide deformylase [Burkholderia ubonensis Bu]
          Length = 167

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 101/157 (64%), Gaps = 2/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDISED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +     FINP+++  SD   VY+EGCLS+P    +V+R   + VR +D   +   +  +G
Sbjct: 67  KSELRAFINPELVWSSDAKQVYEEGCLSVPGVYDEVERPDRVRVRALDEKGETFELDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 127 LLAVCIQHEMDHLMGRVFVEYLSPLKQSRIKSKMKKL 163


>gi|189348993|ref|YP_001944621.1| polypeptide deformylase [Burkholderia multivorans ATCC 17616]
 gi|189333015|dbj|BAG42085.1| polypeptide deformylase [Burkholderia multivorans ATCC 17616]
          Length = 167

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+II  SD   VY+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIIWSSDGKQVYEEGCLSVPGIYDEVERPDRVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLMGRVFVEYLSPLKQSRIKTKMKKL 163


>gi|91781430|ref|YP_556636.1| peptide deformylase [Burkholderia xenovorans LB400]
 gi|91685384|gb|ABE28584.1| peptide deformylase [Burkholderia xenovorans LB400]
          Length = 167

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 103/162 (63%), Gaps = 2/162 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +PD  L ++++P+E +N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ D
Sbjct: 6   IINYPDKRLHKIAKPVEAVNDRIRRLVKDMAETMYAAPGVGLAATQVDVHERVIVIDVSD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
                  + FINP+II  SD+  + +EGCLS+P    +V+R+  + VR ++   +   + 
Sbjct: 66  D--HNELLTFINPEIIWSSDERKLSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFEMD 123

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 124 CEGLLAVCIQHEMDHLMGRVFVEYLSSLKQTRIKSKMKKLAH 165


>gi|325534093|pdb|3QU1|A Chain A, Peptide Deformylase From Vibrio Cholerae
 gi|325534094|pdb|3QU1|B Chain B, Peptide Deformylase From Vibrio Cholerae
          Length = 171

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 9   ILTAPDPRLRVQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 67

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P+V INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D   +   I
Sbjct: 68  DN--RDQPLVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLRI 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 125 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 169


>gi|163859048|ref|YP_001633346.1| peptide deformylase [Bordetella petrii DSM 12804]
 gi|163262776|emb|CAP45079.1| polypeptide deformylase [Bordetella petrii]
          Length = 170

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L + ++P+  ++  I  L+ +M + MY   G+GLAA Q+ V  R+VVID+ +  +
Sbjct: 9   YPDPRLHKKAKPVAVVDDRIRKLVRDMADTMYDAPGVGLAATQVDVHERVVVIDVSEEGN 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
                V INP+I   SD+   Y+EGCLS+P    +V+R+A I  R +D +       A+G
Sbjct: 69  ELR--VLINPEITWKSDERQTYEEGCLSVPGIYDEVERAARIRYRALDADGNPYEAEAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL+G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCVQHELDHLDGKVFVEYLSSLKQNRIKTKLKK 162


>gi|53717762|ref|YP_106748.1| peptide deformylase [Burkholderia pseudomallei K96243]
 gi|162210090|ref|YP_331761.2| peptide deformylase [Burkholderia pseudomallei 1710b]
 gi|167717517|ref|ZP_02400753.1| polypeptide deformylase [Burkholderia pseudomallei DM98]
 gi|167736559|ref|ZP_02409333.1| polypeptide deformylase [Burkholderia pseudomallei 14]
 gi|167813633|ref|ZP_02445313.1| polypeptide deformylase [Burkholderia pseudomallei 91]
 gi|167822177|ref|ZP_02453648.1| polypeptide deformylase [Burkholderia pseudomallei 9]
 gi|167843768|ref|ZP_02469276.1| polypeptide deformylase [Burkholderia pseudomallei B7210]
 gi|167892270|ref|ZP_02479672.1| polypeptide deformylase [Burkholderia pseudomallei 7894]
 gi|167900763|ref|ZP_02487968.1| polypeptide deformylase [Burkholderia pseudomallei NCTC 13177]
 gi|167908987|ref|ZP_02496078.1| polypeptide deformylase [Burkholderia pseudomallei 112]
 gi|167917029|ref|ZP_02504120.1| polypeptide deformylase [Burkholderia pseudomallei BCC215]
 gi|254188218|ref|ZP_04894730.1| polypeptide deformylase [Burkholderia pseudomallei Pasteur 52237]
 gi|254258214|ref|ZP_04949268.1| peptide deformylase [Burkholderia pseudomallei 1710a]
 gi|52208176|emb|CAH34107.1| peptide deformylase [Burkholderia pseudomallei K96243]
 gi|157935898|gb|EDO91568.1| polypeptide deformylase [Burkholderia pseudomallei Pasteur 52237]
 gi|254216903|gb|EET06287.1| peptide deformylase [Burkholderia pseudomallei 1710a]
          Length = 167

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 67  -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGEPFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 126 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 163


>gi|153802627|ref|ZP_01957213.1| polypeptide deformylase [Vibrio cholerae MZO-3]
 gi|124121843|gb|EAY40586.1| polypeptide deformylase [Vibrio cholerae MZO-3]
          Length = 168

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRLQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P+V INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D   +   I
Sbjct: 65  DN--RDQPLVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|254295706|ref|ZP_04963163.1| polypeptide deformylase [Burkholderia pseudomallei 406e]
 gi|157805961|gb|EDO83131.1| polypeptide deformylase [Burkholderia pseudomallei 406e]
          Length = 165

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 7   YPDKRLHKVAKPVAKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSED-- 64

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP+I+   D   VY+EGCLS+P    +V+R   + VR +D   +   +  +
Sbjct: 65  -KNELRVFINPEIVWTGDGKQVYEEGCLSVPGVYDEVERPDRVRVRALDGQGEPFELDCE 123

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+ +LS LK+  I  KM KL
Sbjct: 124 GLLAVCIQHEMDHLMGRVFVQYLSPLKQTRIKTKMKKL 161


>gi|15600920|ref|NP_232550.1| peptide deformylase [Vibrio cholerae O1 biovar eltor str. N16961]
 gi|121587986|ref|ZP_01677739.1| polypeptide deformylase [Vibrio cholerae 2740-80]
 gi|121729670|ref|ZP_01682131.1| polypeptide deformylase [Vibrio cholerae V52]
 gi|147672038|ref|YP_001215964.1| peptide deformylase [Vibrio cholerae O395]
 gi|153819711|ref|ZP_01972378.1| polypeptide deformylase [Vibrio cholerae NCTC 8457]
 gi|153822662|ref|ZP_01975329.1| polypeptide deformylase [Vibrio cholerae B33]
 gi|153825061|ref|ZP_01977728.1| peptide deformylase [Vibrio cholerae MZO-2]
 gi|153830707|ref|ZP_01983374.1| polypeptide deformylase [Vibrio cholerae 623-39]
 gi|227811776|ref|YP_002811786.1| polypeptide deformylase [Vibrio cholerae M66-2]
 gi|229506685|ref|ZP_04396194.1| peptide deformylase [Vibrio cholerae BX 330286]
 gi|229510520|ref|ZP_04400000.1| peptide deformylase [Vibrio cholerae B33]
 gi|229517348|ref|ZP_04406793.1| peptide deformylase [Vibrio cholerae RC9]
 gi|229527868|ref|ZP_04417259.1| peptide deformylase [Vibrio cholerae 12129(1)]
 gi|229605159|ref|YP_002875863.1| peptide deformylase [Vibrio cholerae MJ-1236]
 gi|254850416|ref|ZP_05239766.1| peptide deformylase 2 [Vibrio cholerae MO10]
 gi|297579720|ref|ZP_06941647.1| polypeptide deformylase [Vibrio cholerae RC385]
 gi|298500007|ref|ZP_07009813.1| peptide deformylase [Vibrio cholerae MAK 757]
 gi|23396575|sp|Q9KN16|DEF2_VIBCH RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|9657539|gb|AAF96063.1| polypeptide deformylase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547784|gb|EAX57873.1| polypeptide deformylase [Vibrio cholerae 2740-80]
 gi|121628568|gb|EAX61048.1| polypeptide deformylase [Vibrio cholerae V52]
 gi|126509754|gb|EAZ72348.1| polypeptide deformylase [Vibrio cholerae NCTC 8457]
 gi|126519819|gb|EAZ77042.1| polypeptide deformylase [Vibrio cholerae B33]
 gi|146314421|gb|ABQ18961.1| polypeptide deformylase [Vibrio cholerae O395]
 gi|148873804|gb|EDL71939.1| polypeptide deformylase [Vibrio cholerae 623-39]
 gi|149741386|gb|EDM55420.1| peptide deformylase [Vibrio cholerae MZO-2]
 gi|227010918|gb|ACP07129.1| polypeptide deformylase [Vibrio cholerae M66-2]
 gi|227014777|gb|ACP10986.1| polypeptide deformylase [Vibrio cholerae O395]
 gi|229334230|gb|EEN99715.1| peptide deformylase [Vibrio cholerae 12129(1)]
 gi|229345384|gb|EEO10357.1| peptide deformylase [Vibrio cholerae RC9]
 gi|229352965|gb|EEO17905.1| peptide deformylase [Vibrio cholerae B33]
 gi|229357036|gb|EEO21954.1| peptide deformylase [Vibrio cholerae BX 330286]
 gi|229371645|gb|ACQ62067.1| peptide deformylase [Vibrio cholerae MJ-1236]
 gi|254846121|gb|EET24535.1| peptide deformylase 2 [Vibrio cholerae MO10]
 gi|297535366|gb|EFH74200.1| polypeptide deformylase [Vibrio cholerae RC385]
 gi|297541988|gb|EFH78039.1| peptide deformylase [Vibrio cholerae MAK 757]
          Length = 168

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRVQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P+V INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D   +   I
Sbjct: 65  DN--RDQPLVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|312797602|ref|YP_004030524.1| peptide deformylase [Burkholderia rhizoxinica HKI 454]
 gi|312169377|emb|CBW76380.1| Peptide deformylase (EC 3.5.1.88) [Burkholderia rhizoxinica HKI
           454]
          Length = 169

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 103/161 (63%), Gaps = 2/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+E+++  I  L+ +M E MY+  G+GLAA Q+ V  R+VVID+ D   
Sbjct: 11  YPDKRLHKVAKPVERVDERIRKLVADMAETMYAASGVGLAATQVDVHERVVVIDVSDT-- 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  SD+  + +EGCLS+P     V+R+  + VR ++ N +   +  +G
Sbjct: 69  RDALRVFINPEIVWSSDERDINEEGCLSVPRICDSVERAERVRVRALNENGESFELECEG 128

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHL G +F+++LS LK+  I   M K  + R
Sbjct: 129 LLAICIQHEMDHLLGKVFVEYLSPLKQMRIKTTMKKFERAR 169


>gi|134297376|ref|YP_001121111.1| peptide deformylase [Burkholderia vietnamiensis G4]
 gi|134140533|gb|ABO56276.1| peptide deformylase [Burkholderia vietnamiensis G4]
          Length = 167

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+I+  SD   VY+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIVWSSDAKQVYEEGCLSVPGIYDEVERPDHVRVRALNERGEPFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|170734476|ref|YP_001766423.1| peptide deformylase [Burkholderia cenocepacia MC0-3]
 gi|254246863|ref|ZP_04940184.1| N-formylmethionyl-tRNA deformylase [Burkholderia cenocepacia PC184]
 gi|124871639|gb|EAY63355.1| N-formylmethionyl-tRNA deformylase [Burkholderia cenocepacia PC184]
 gi|169817718|gb|ACA92301.1| peptide deformylase [Burkholderia cenocepacia MC0-3]
          Length = 167

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 103/158 (65%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+I+  SD   +Y+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIVWSSDAKQIYEEGCLSVPGIYDEVERPDHVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|307822764|ref|ZP_07652995.1| peptide deformylase [Methylobacter tundripaludum SV96]
 gi|307736368|gb|EFO07214.1| peptide deformylase [Methylobacter tundripaludum SV96]
          Length = 168

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/157 (42%), Positives = 100/157 (63%), Gaps = 3/157 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPD  LR+ +  ++ ++  I  L+D+MLE MY + G+GLAA Q+ V  R+VVID+ +   
Sbjct: 9   FPDERLRKKAAIVKTVDDKIKKLVDDMLETMYESHGVGLAATQVNVHQRVVVIDVSEE-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P+  INP+II   D     +EGCLS+P +   V+R+  I V+ +D   +   + A  
Sbjct: 67  KDAPLCLINPEIIE-KDGVKESEEGCLSVPGFFEKVERAEHIIVKALDREGEPFELSARD 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           LLA C+QHELDHL+G LF+D++S LKR  I KK+ K+
Sbjct: 126 LLAVCVQHELDHLDGKLFVDYISPLKRQRIKKKLEKI 162


>gi|300692919|ref|YP_003753914.1| peptide deformylase [Ralstonia solanacearum PSI07]
 gi|299079979|emb|CBJ52656.1| peptide deformylase [Ralstonia solanacearum PSI07]
          Length = 169

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 100/156 (64%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+ +++  I  L+ +M E MY   GIGLAA Q+ V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAEVDGRIRKLVADMAETMYDAPGIGLAATQVDVHERVITIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S +  V+ EGCLS+PD    V+R   + VR ++   +   + ADG
Sbjct: 67  RDELRVFINPEILWASKERKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGETFELEADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 162


>gi|298370618|ref|ZP_06981933.1| peptide deformylase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281228|gb|EFI22718.1| peptide deformylase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 167

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 96/156 (61%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V++ + K++  I  L+ +M E MY   GIGLAA Q+ V  R+VV+DL +   
Sbjct: 9   YPDERLHTVAKSVGKVDERIQKLVADMFETMYEARGIGLAATQVDVHERVVVMDLTED-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R  P VFINP +I   D  + Y+EGCLS+P     V R+  + V  ++   +   + ADG
Sbjct: 67  RSEPRVFINP-VIVEKDGETTYEEGCLSVPGIYDTVTRAERVKVEALNEKGEKFTLEADG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHELDHL GI+F++ LS+LK+  I  K+ K
Sbjct: 126 LLAICVQHELDHLMGIVFVERLSQLKQGRIKTKLKK 161


>gi|261344111|ref|ZP_05971755.1| peptide deformylase [Providencia rustigianii DSM 4541]
 gi|282567702|gb|EFB73237.1| peptide deformylase [Providencia rustigianii DSM 4541]
          Length = 168

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/158 (46%), Positives = 100/158 (63%), Gaps = 5/158 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLV 59
           M  + ++  PD  LR    P+    + +  LID+++E MYSTD GIGLAA QI     ++
Sbjct: 1   MAVREIIEIPDERLRIKCAPVTDFAA-VQTLIDDLIETMYSTDTGIGLAAPQIAETKAIM 59

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           VID+ +   R  PMVFINP+II  S+  + YQEGCLS+PD  ADV R   + V+  D + 
Sbjct: 60  VIDISEE--RNQPMVFINPEIIE-SEGETSYQEGCLSVPDVYADVPRFQRVKVKAFDRDG 116

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
              I+ +D  LA  +QHE+DHLNG +FIDHLS LKR+M
Sbjct: 117 NEFIVDSDEFLAIVMQHEIDHLNGKVFIDHLSTLKRNM 154


>gi|212709522|ref|ZP_03317650.1| hypothetical protein PROVALCAL_00564 [Providencia alcalifaciens DSM
           30120]
 gi|212687860|gb|EEB47388.1| hypothetical protein PROVALCAL_00564 [Providencia alcalifaciens DSM
           30120]
          Length = 168

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 100/158 (63%), Gaps = 5/158 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLV 59
           M  + ++  PD  LR    P+    + +  L+D+++E MYSTD GIGLAA QI     ++
Sbjct: 1   MAVREIIEIPDERLRIQCSPVTDFAA-VQTLVDDLIETMYSTDNGIGLAATQIAETKAIM 59

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           VID+ +   R  PMVFINP+II  S+  + YQEGCLS+PD  ADV R   + V+  D + 
Sbjct: 60  VIDISEE--RNEPMVFINPEIIE-SEGETSYQEGCLSVPDVYADVPRFLRVKVKAFDRDG 116

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDM 157
              ++ +D  LA  +QHE+DHLNG +FIDHLS LKR+M
Sbjct: 117 NEFVVDSDEFLAIVMQHEIDHLNGKVFIDHLSTLKRNM 154


>gi|302380585|ref|ZP_07269050.1| peptide deformylase [Finegoldia magna ACS-171-V-Col3]
 gi|302311528|gb|EFK93544.1| peptide deformylase [Finegoldia magna ACS-171-V-Col3]
          Length = 162

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 90/150 (60%), Gaps = 3/150 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ SR +EKI+  I  + ++M E MY   GIGLA VQ+G+L R+VVID+QD   + 
Sbjct: 11  DPILRKKSREVEKIDDRIKQIAEDMFETMYENKGIGLACVQVGMLKRIVVIDMQDEDGK- 69

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             MV INPKII  S+D  +  EGCLS+P     V+R   + V Y D N   Q +      
Sbjct: 70  --MVLINPKIIEKSEDKQINIEGCLSVPGKNGYVERPKTVVVEYTDLNGNTQRVTGTDYK 127

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITK 160
           A C  HELDHL+G+L+ D +  L  + + +
Sbjct: 128 AHCFCHELDHLDGVLYTDKVLNLSEEEVER 157


>gi|307728142|ref|YP_003905366.1| peptide deformylase [Burkholderia sp. CCGE1003]
 gi|307582677|gb|ADN56075.1| peptide deformylase [Burkholderia sp. CCGE1003]
          Length = 167

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 105/159 (66%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+E++N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ D AH
Sbjct: 9   YPDKRLHKVAKPVEEVNDRIRRLVADMAETMYAAPGVGLAATQVDVHERVIVIDVSD-AH 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            +  + FINP+I+  S++  + +EGCLS+P    +V+R+  + VR ++   +   +  +G
Sbjct: 68  DQ-LLAFINPEIVWSSNEKKLSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFEMDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCIQHEMDHLMGRVFVEYLSPLKQTRIKSKMKKLAH 165


>gi|169824358|ref|YP_001691969.1| polypeptide deformylase [Finegoldia magna ATCC 29328]
 gi|238687734|sp|B0S139|DEF_FINM2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|167831163|dbj|BAG08079.1| polypeptide deformylase [Finegoldia magna ATCC 29328]
          Length = 162

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (60%), Gaps = 3/150 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ SR +EKI+  I  ++++M E MY   GIGLA VQ+G+L R+VVID+QD   + 
Sbjct: 11  DPILRKKSREVEKIDDRIKQIVEDMFETMYENKGIGLACVQVGMLKRIVVIDMQDEDGK- 69

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             MV INPKII  S++  +  EGCLS+P     V+R   + V Y D N   Q +      
Sbjct: 70  --MVLINPKIIEKSEEKQINIEGCLSVPGKNGYVERPKTVVVEYTDLNGNTQRVMGTDYK 127

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITK 160
           A C  HELDHL+G+L+ D +  L  + + +
Sbjct: 128 AHCFCHELDHLDGVLYTDKVLNLSEEEVER 157


>gi|94971313|ref|YP_593361.1| peptide deformylase [Candidatus Koribacter versatilis Ellin345]
 gi|94553363|gb|ABF43287.1| peptide deformylase [Candidatus Koribacter versatilis Ellin345]
          Length = 170

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 97/163 (59%), Gaps = 1/163 (0%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V   DP+L R +  + + +  +  L+++M E MY   G+GLAA QIG+  R+ V+D+ 
Sbjct: 4   PIVKLGDPVLERPAAAVTEFDDGLKKLVEDMFESMYDAHGVGLAAPQIGIGKRIAVVDVT 63

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
                   +V INP+II  +D     QEGCLSIPD+R  V R+  +TV+  D   +    
Sbjct: 64  FKEDPNAKLVLINPEII-LTDGRQTSQEGCLSIPDFREKVTRARRVTVKAQDLTGKWFEH 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             + LLA    HE DHLNG L+I H+S LKRD+I +K+ KL++
Sbjct: 123 TGEDLLARAFLHETDHLNGKLYISHVSALKRDLIKRKVKKLIK 165


>gi|94676503|ref|YP_588858.1| peptide deformylase [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|123384127|sp|Q1LT56|DEF_BAUCH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|94219653|gb|ABF13812.1| peptide deformylase [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 167

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 107/163 (65%), Gaps = 3/163 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PD  LR++S+P+ KIN+ I  ++ +M + MY  +GIGLAA Q+ +   ++VID+ 
Sbjct: 5   PILYYPDHRLRQISKPVNKINNSIYRIVYDMFDTMYHKNGIGLAAPQVNINLNIIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  ++  +V INP+++  S +  ++ EGCLSIP+    V R+  I VR +D N     +
Sbjct: 65  ENKEQR--LVLINPELLAKSGETGIH-EGCLSIPEQHGFVPRAKNIKVRALDLNGNSFNL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             + L A C+QHE+DHL G LFID+LS LKR  + KKM +L++
Sbjct: 122 ETNDLQAICIQHEMDHLVGKLFIDYLSPLKRQRLLKKMKQLIR 164


>gi|300705526|ref|YP_003747129.1| peptide deformylase [Ralstonia solanacearum CFBP2957]
 gi|299073190|emb|CBJ44548.1| peptide deformylase [Ralstonia solanacearum CFBP2957]
          Length = 169

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   G+GLAA QI V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAAVDDRIRKLVADMAETMYDAPGVGLAATQIDVHERVITIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S +  V+ EGCLS+PD    V+R   + VR ++   +   + ADG
Sbjct: 67  RDELRVFINPEIVWASQERKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGESFELEADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 162


>gi|241664932|ref|YP_002983292.1| peptide deformylase [Ralstonia pickettii 12D]
 gi|309780262|ref|ZP_07675013.1| peptide deformylase [Ralstonia sp. 5_7_47FAA]
 gi|240866959|gb|ACS64620.1| peptide deformylase [Ralstonia pickettii 12D]
 gi|308920965|gb|EFP66611.1| peptide deformylase [Ralstonia sp. 5_7_47FAA]
          Length = 171

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 98/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   G+GLAA Q+ V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAVVDDRIRKLVADMAETMYEAPGVGLAATQVDVHERVITIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  SD+  V+ EGCLS+PD    V R A + VR ++   +   + AD 
Sbjct: 67  RDELRVFINPEILWASDEHKVWDEGCLSVPDIYDKVDRPARVRVRALNEKGETFELEADD 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK+  I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQTRIRSKLKK 162


>gi|238926274|ref|ZP_04658034.1| peptide deformylase [Selenomonas flueggei ATCC 43531]
 gi|238885954|gb|EEQ49592.1| peptide deformylase [Selenomonas flueggei ATCC 43531]
          Length = 160

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 93/146 (63%), Gaps = 4/146 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+L++ + PIE++      L+D+M E MY+ DG+GLAA Q+G   R+VVID+QD     
Sbjct: 15  DPVLKQTAEPIERLTKRHRQLLDDMAETMYAADGVGLAAPQVGKSLRIVVIDVQDE---H 71

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP +IT  +      EGCLS+P    DV+R+  +TV Y D  ++ + + A+GLL
Sbjct: 72  GLLELVNP-VITMREGSVTESEGCLSVPKVYGDVERAERVTVEYTDRRSRRRTLTAEGLL 130

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRD 156
           A C+QHE DHL G LFID   RL+++
Sbjct: 131 ARCIQHECDHLEGRLFIDIAVRLRKE 156


>gi|157363555|ref|YP_001470322.1| peptide deformylase [Thermotoga lettingae TMO]
 gi|167012066|sp|A8F524|DEF_THELT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|157314159|gb|ABV33258.1| peptide deformylase [Thermotoga lettingae TMO]
          Length = 171

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 110/168 (65%), Gaps = 9/168 (5%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           MVKK + +  DP+LR+ S+ +E+++   ++LI ++ E MY+TDGIGLAA QIGV  R+ V
Sbjct: 1   MVKK-IRLLGDPVLRKKSKNVERVDETTISLIKDLFETMYATDGIGLAAPQIGVSLRIFV 59

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D         P VFINP+II  S++  + +EGCLS+P+   DV+RS  +TVRYM+ + +
Sbjct: 60  MD------DGKPRVFINPEIIYKSEEKEIAEEGCLSVPEVFEDVERSKEVTVRYMNEHGE 113

Query: 121 H-QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             +  + D   A  +QHE DHL G+LFID +   +R  I KK+ ++V+
Sbjct: 114 EVEESFVD-YSARVVQHEYDHLQGVLFIDLIPSSRRFAIRKKLIEIVR 160


>gi|322384330|ref|ZP_08058028.1| peptide deformylase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321150832|gb|EFX44269.1| peptide deformylase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 160

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 98/156 (62%), Gaps = 4/156 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V+ PDP+LR  ++P+ K NS +  L+D+M + MY  +G+GLAA Q+G+L R +V+D+ D
Sbjct: 6   IVMDPDPVLREKAKPVTKFNSSLHKLLDDMADTMYENEGVGLAAPQVGILKRAIVMDVGD 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
                  +  +NP+I+  S +  +  EGCLSIPD + DV+R   +TV+  D N    I+ 
Sbjct: 66  E---HGLIELVNPEIVATSGE-QIGPEGCLSIPDLQGDVRRPMNVTVKGQDRNGNEVIVE 121

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK 161
              LLA C+ HE+DHLNGILF D   +L R+ + + 
Sbjct: 122 GTELLARCIMHEVDHLNGILFTDLALKLYRNELEEN 157


>gi|170694015|ref|ZP_02885171.1| peptide deformylase [Burkholderia graminis C4D1M]
 gi|170141087|gb|EDT09259.1| peptide deformylase [Burkholderia graminis C4D1M]
          Length = 167

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 105/159 (66%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+E++N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ D AH
Sbjct: 9   YPDKRLHKVAKPVEEVNDRIRRLVADMAETMYAAPGVGLAATQVDVHERVIVIDVSD-AH 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
            +  + FINP+I+  S++  + +EGCLS+P    +V+R+  + VR ++   +   +  +G
Sbjct: 68  DQ-LLAFINPEIVWSSNEKKLSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFEMDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCIQHEMDHLMGHVFVEYLSPLKQTRIKSKMKKLAH 165


>gi|319945035|ref|ZP_08019297.1| peptide deformylase [Lautropia mirabilis ATCC 51599]
 gi|319741605|gb|EFV94030.1| peptide deformylase [Lautropia mirabilis ATCC 51599]
          Length = 170

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 98/161 (60%), Gaps = 2/161 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L  V+  +  ++  I  L+ +M E MY+  GIGLAA Q+ V  R+VVID+ +   
Sbjct: 9   YPDARLHTVAERVPVVDDRIRKLVADMAETMYAAPGIGLAATQVNVHERVVVIDITET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
                VFINP+I   SD    Y+EGCLSIP     V+R   +TV  +  + +   + ADG
Sbjct: 67  HDQLQVFINPEITWSSDTLQSYEEGCLSIPGIYDKVERPDAVTVTALGLDGKPFTLEADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           LLA C+QHE+DHLNG LF  HLSRLK++ I +K+ K+ + R
Sbjct: 127 LLAVCIQHEIDHLNGKLFTQHLSRLKQNRIRQKVLKMERER 167


>gi|107024058|ref|YP_622385.1| peptide deformylase [Burkholderia cenocepacia AU 1054]
 gi|116691145|ref|YP_836768.1| peptide deformylase [Burkholderia cenocepacia HI2424]
 gi|206558867|ref|YP_002229627.1| peptide deformylase [Burkholderia cenocepacia J2315]
 gi|105894247|gb|ABF77412.1| peptide deformylase [Burkholderia cenocepacia AU 1054]
 gi|116649234|gb|ABK09875.1| peptide deformylase [Burkholderia cenocepacia HI2424]
 gi|198034904|emb|CAR50776.1| peptide deformylase [Burkholderia cenocepacia J2315]
          Length = 167

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 4/158 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P++K++  I  L+ +M E MY+  GIGLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVDKVDDRIRKLVADMAETMYAAPGIGLAATQVDVHERVIVIDVSEE-- 66

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN +  FINP+I+  SD    Y+EGCLS+P    +V+R   + VR ++   +   +  +
Sbjct: 67  -KNELRAFINPEIVWSSDAKQTYEEGCLSVPGIYDEVERPDHVRVRALNEQGETFELDCE 125

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           GLLA C+QHE+DHL G +F+++LS LK+  I  KM KL
Sbjct: 126 GLLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKTKMKKL 163


>gi|88811384|ref|ZP_01126639.1| polypeptide deformylase [Nitrococcus mobilis Nb-231]
 gi|88791273|gb|EAR22385.1| polypeptide deformylase [Nitrococcus mobilis Nb-231]
          Length = 177

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 95/143 (66%), Gaps = 3/143 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LR  ++P+EK+  ++  L+D++ E MY   GIGLAA Q+ + +R++V+D+ +   
Sbjct: 9   YPDPQLRIRAQPVEKVTDEVRRLVDDLFETMYDAPGIGLAATQVNIHWRVLVVDITEA-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P+ FINP+I+    +  + QEGCLS+P Y   V+R+ ++ V   D + +   +  DG
Sbjct: 67  KNEPLAFINPQILERKGEEEM-QEGCLSVPGYFDTVRRAEWVKVHAQDRSGEPFELETDG 125

Query: 129 LLATCLQHELDHLNGILFIDHLS 151
           LLA C+QHE+DHL G LF+D+LS
Sbjct: 126 LLAVCIQHEIDHLEGKLFVDYLS 148


>gi|158337779|ref|YP_001518955.1| peptide deformylase [Acaryochloris marina MBIC11017]
 gi|158308020|gb|ABW29637.1| peptide deformylase [Acaryochloris marina MBIC11017]
          Length = 189

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 3/157 (1%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ + K++ +I  L   ML+ MYS DGIGLAA Q+ V  +L+V+D        
Sbjct: 24  DRVLRQSAKRVSKVDDEIRELARQMLQTMYSADGIGLAAPQVAVGKQLIVVDTDPEEPAN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ +NPKI   SDD ++ QEGCLSIP    DV+R A I V Y D   + Q+I A  LL
Sbjct: 84  QPIILLNPKIRRHSDDLALGQEGCLSIPGVYLDVRRPAQIEVAYKDEQGRPQVIVATDLL 143

Query: 131 ATCLQHELDHLNGILFIDHLSR---LKRDMITKKMSK 164
           A  +QHE+DHL G++F+D +     L +++  +  SK
Sbjct: 144 ARVIQHEMDHLTGVMFVDRVENSLLLNQELTKQGFSK 180


>gi|40063276|gb|AAR38094.1| polypeptide deformylase [uncultured marine bacterium 578]
          Length = 165

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 94/143 (65%), Gaps = 3/143 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  LR +++P+  +NSDI   + +M E MY   GIGLAA Q+    R++VID+ +  +
Sbjct: 8   YPDKRLRTIAKPVVSVNSDIKKQVKDMFETMYDAPGIGLAATQVNFHQRIIVIDISEDCN 67

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P   INP+II  S +   ++EGCLS+PDY  +VKR+  I V  ++ +     I A+ 
Sbjct: 68  Q--PFCLINPEIIEKSGEIE-WEEGCLSVPDYYENVKRANKIKVCALNEHGNTFDIEANE 124

Query: 129 LLATCLQHELDHLNGILFIDHLS 151
           +LA C+QHE+DHLNGILF+DHLS
Sbjct: 125 MLAICIQHEMDHLNGILFVDHLS 147


>gi|229526222|ref|ZP_04415626.1| peptide deformylase [Vibrio cholerae bv. albensis VL426]
 gi|254286639|ref|ZP_04961594.1| polypeptide deformylase [Vibrio cholerae AM-19226]
 gi|150423223|gb|EDN15169.1| polypeptide deformylase [Vibrio cholerae AM-19226]
 gi|229336380|gb|EEO01398.1| peptide deformylase [Vibrio cholerae bv. albensis VL426]
          Length = 168

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/165 (44%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRVQSKQVTDVAS-VQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P+V INPK+++  ++  + QEGCLS+PDY ADV+R   + V  +D   +   I
Sbjct: 65  DN--RDQPLVLINPKVVS-GNNKEMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|187922316|ref|YP_001893958.1| peptide deformylase [Burkholderia phytofirmans PsJN]
 gi|187713510|gb|ACD14734.1| peptide deformylase [Burkholderia phytofirmans PsJN]
          Length = 167

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 100/159 (62%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L ++++P+E +N  I  L+ +M E MY+  G+GLAA Q+ V  R++ ID+ D   
Sbjct: 9   YPDKRLHKIAKPVEAVNDRIRRLVKDMAETMYAAPGVGLAATQVDVHERVITIDVSDD-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               + FINP+II  SD+  + +EGCLS+P    +V+R+  + VR ++   +   +  +G
Sbjct: 67  HNELLAFINPEIIWSSDERKLSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFEMDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCIQHEMDHLMGRVFVEYLSSLKQTRIKSKMKKLAH 165


>gi|329913547|ref|ZP_08275972.1| Peptide deformylase [Oxalobacteraceae bacterium IMCC9480]
 gi|327545311|gb|EGF30553.1| Peptide deformylase [Oxalobacteraceae bacterium IMCC9480]
          Length = 177

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 98/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +++RP+   +  +  L+ +M E MY   G+GLA+ Q+ V  +L+++D+ D+  
Sbjct: 9   YPDPRLHKIARPVTVFDDRLKQLVADMAETMYDAPGVGLASSQVDVHEQLIIVDISDN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +    V INP+I   S +  +Y EGCLS+P     V+R A I VR +D + +     ADG
Sbjct: 67  QSELRVLINPEITWASTEMQLYDEGCLSVPGVYDGVERHARIKVRALDVDGKEFDTTADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 127 LLAVCIQHEMDHLKGKVFVEYLSPLKRNRIKAKMLK 162


>gi|120599034|ref|YP_963608.1| peptide deformylase [Shewanella sp. W3-18-1]
 gi|146292895|ref|YP_001183319.1| peptide deformylase [Shewanella putrefaciens CN-32]
 gi|120559127|gb|ABM25054.1| peptide deformylase [Shewanella sp. W3-18-1]
 gi|145564585|gb|ABP75520.1| peptide deformylase [Shewanella putrefaciens CN-32]
 gi|319426575|gb|ADV54649.1| peptide deformylase [Shewanella putrefaciens 200]
          Length = 163

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 102/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I + +   ID+++E MY TD GIGLAA Q+G    ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIEA-VQGFIDDLIETMYHTDDGIGLAATQVGSTDAIIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D   R  P+V INP+I+  S +F V +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  DG--RDQPLVLINPEIVEKSGEF-VGEEGCLSIPGYRAKVSRFEKVKVTALDRTGKAIEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ETDEFLAIVLQHEIDHLHGKVFIEHLSMLKQQIALKKVRK 161


>gi|27367269|ref|NP_762796.1| peptide deformylase [Vibrio vulnificus CMCP6]
 gi|320159078|ref|YP_004191456.1| peptide deformylase [Vibrio vulnificus MO6-24/O]
 gi|31076649|sp|Q8D5P5|DEF2_VIBVU RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|27358838|gb|AAO07786.1| peptide deformylase [Vibrio vulnificus CMCP6]
 gi|319934390|gb|ADV89253.1| peptide deformylase [Vibrio vulnificus MO6-24/O]
          Length = 168

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 107/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + + +  LID++LE +Y TD G+GLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRVQSKEVTDVAA-VQTLIDDLLETLYETDNGVGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  R  P+V +NPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D + +   I
Sbjct: 65  EN--RDEPLVLVNPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDRDGKPLRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K  +LR
Sbjct: 122 ETSEFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHNKLR 166


>gi|83748633|ref|ZP_00945651.1| Peptide deformylase [Ralstonia solanacearum UW551]
 gi|83724677|gb|EAP71837.1| Peptide deformylase [Ralstonia solanacearum UW551]
          Length = 169

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAAVDDRIRKLVADMAETMYDAPGIGLAATQVDVHERVITIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S +  V+ EGCLS+PD    V+R   + VR ++   +   + ADG
Sbjct: 67  RDELRVFINPEIVWASQERKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGESFELDADG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 162


>gi|224419234|ref|ZP_03657240.1| peptide deformylase [Helicobacter canadensis MIT 98-5491]
 gi|253826952|ref|ZP_04869837.1| peptide deformylase [Helicobacter canadensis MIT 98-5491]
 gi|313142736|ref|ZP_07804929.1| peptide deformylase [Helicobacter canadensis MIT 98-5491]
 gi|253510358|gb|EES89017.1| peptide deformylase [Helicobacter canadensis MIT 98-5491]
 gi|313131767|gb|EFR49384.1| peptide deformylase [Helicobacter canadensis MIT 98-5491]
          Length = 168

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 105/162 (64%), Gaps = 4/162 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI---D 62
           ++ +P+PILR++S+PIE  N  +  L+D+M EVM   +G+G++A+Q+    R ++I   D
Sbjct: 4   VITYPNPILRQISQPIEVFNESLHELLDSMYEVMLQKNGVGISAIQVAKPIRALLICLPD 63

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
            + + H+++ +  INP+I+   D   ++ EGCLS+P++  +VKR++ + V Y D     +
Sbjct: 64  EEGNQHKEDLLEIINPQILE-KDGEIIFNEGCLSVPEFYEEVKRASSLKVAYQDRYGNPK 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            + A   LA  LQHE+DHLNGILFID LS LKR    K++ +
Sbjct: 123 EMEAKDYLAVALQHEIDHLNGILFIDKLSILKRKKFEKELKQ 164


>gi|304437066|ref|ZP_07397029.1| peptide deformylase [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370017|gb|EFM23679.1| peptide deformylase [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 160

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 4/145 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+L++ + PIE++      L+D+M E MY+ DG+GLAA Q+G   R+VVID+QD     
Sbjct: 15  DPVLKQTAEPIERLTKRHRQLLDDMAETMYAADGVGLAAPQVGKSLRIVVIDVQDE---H 71

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP +IT  +      EGCLS+P    DV+R+  +TV Y D  ++ + + A+GLL
Sbjct: 72  GLLELVNP-VITMREGSVTESEGCLSVPKVYGDVERAERVTVEYTDRRSRRRTLTAEGLL 130

Query: 131 ATCLQHELDHLNGILFIDHLSRLKR 155
           A C+QHE DHL G LFID   RL++
Sbjct: 131 ARCIQHECDHLEGRLFIDIAVRLRK 155


>gi|306440704|pdb|3OCA|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia
           Chaffeensis
 gi|306440705|pdb|3OCA|B Chain B, Crystal Structure Of Peptide Deformylase From Ehrlichia
           Chaffeensis
          Length = 209

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 100/176 (56%), Gaps = 17/176 (9%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI---- 61
           +V  PD  L   S  +EK++  I  L+D+M E M++  G+GLAAVQ+GV  R++V+    
Sbjct: 27  IVTVPDKRLSLCSEEVEKVDQSIRKLVDDMFETMHANQGLGLAAVQVGVHKRILVMNVPE 86

Query: 62  DLQDHAHRKN-------------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSA 108
           + +D    +N             P   INPKI+  S +    +EGCLS+P Y   + R  
Sbjct: 87  EFEDSEDIENVEDKIEGYELYGGPYCIINPKIVDISQEKVKLKEGCLSVPGYFDYIVRPQ 146

Query: 109 FITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            I V+Y+D N    II A G LA CLQHE+DHLNG +F+ +LS+ KRD   +K+ K
Sbjct: 147 RIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSKFKRDFAIEKVKK 202


>gi|261856667|ref|YP_003263950.1| peptide deformylase [Halothiobacillus neapolitanus c2]
 gi|261837136|gb|ACX96903.1| peptide deformylase [Halothiobacillus neapolitanus c2]
          Length = 171

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/165 (41%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +++FPD  LRRV+  +++ ++ +  L + MLE MY   G+GLAA QI V  R+ V D  +
Sbjct: 6   VLLFPDERLRRVAAEVKQFDARVQRLSEQMLETMYDARGVGLAATQIDVHERMFVADCAE 65

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
                 P+VFINP I+  S      +EGCLSIP     V R+  + VR  +   +     
Sbjct: 66  DGCAPEPLVFINPVILDRSGSVE-SEEGCLSIPGVTDKVMRAEAVRVRAQNAFGESFERE 124

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
           A GLLA C+QHE+DHL+G LFID+LS LKR  I KK+ K ++ ++
Sbjct: 125 AGGLLAICIQHEIDHLDGRLFIDYLSPLKRQRIRKKLEKALRQKE 169


>gi|207727558|ref|YP_002255952.1| peptide deformylase 1 (pdf 1) (polypeptide deformylase1) protein
           [Ralstonia solanacearum MolK2]
 gi|206590795|emb|CAQ56407.1| peptide deformylase 1 (pdf 1) (polypeptide deformylase1) protein
           [Ralstonia solanacearum MolK2]
          Length = 174

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  R++ ID+ +   
Sbjct: 14  YPDPRLHKVAKPVAAVDDRIRKLVADMAETMYDAPGIGLAATQVDVHERVITIDVSES-- 71

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S +  V+ EGCLS+PD    V+R   + VR ++   +   + ADG
Sbjct: 72  RDELRVFINPEIVWASQERKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGESFELDADG 131

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 132 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 167


>gi|207741949|ref|YP_002258341.1| peptide deformylase 1 (pdf 1) (polypeptide deformylase1) protein
           [Ralstonia solanacearum IPO1609]
 gi|206593335|emb|CAQ60262.1| peptide deformylase 1 (pdf 1) (polypeptide deformylase1) protein
           [Ralstonia solanacearum IPO1609]
          Length = 174

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  R++ ID+ +   
Sbjct: 14  YPDPRLHKVAKPVAAVDDRIRKLVADMAETMYDAPGIGLAATQVDVHERVITIDVSES-- 71

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S +  V+ EGCLS+PD    V+R   + VR ++   +   + ADG
Sbjct: 72  RDELRVFINPEIVWASQERKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGESFELDADG 131

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 132 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 167


>gi|113474637|ref|YP_720698.1| peptide deformylase [Trichodesmium erythraeum IMS101]
 gi|110165685|gb|ABG50225.1| peptide deformylase [Trichodesmium erythraeum IMS101]
          Length = 187

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 95/149 (63%), Gaps = 2/149 (1%)

Query: 5   PLVIF--PDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I+   D  LR+ ++ + K++SD+  L+  ML+ MY+ DGIGLAA Q+ V  +++VID
Sbjct: 16  PLEIYYLGDRSLRQSAKRVAKVDSDMRKLVREMLQTMYTADGIGLAAPQVNVQKQVIVID 75

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
            +       P+V INP I  +S+D  ++QEGCLSIP    DV+R + I V Y D N + Q
Sbjct: 76  CEPTNSATPPLVLINPTIKKYSNDICLFQEGCLSIPGVYLDVQRPSEIEVAYKDENGRPQ 135

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLS 151
            + A  LL+  +QHE+DHL GILF+D + 
Sbjct: 136 TLQAQELLSRAIQHEMDHLQGILFVDRVE 164


>gi|269102516|ref|ZP_06155213.1| peptide deformylase [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268162414|gb|EEZ40910.1| peptide deformylase [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 171

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (63%), Gaps = 5/157 (3%)

Query: 10  PDPILRRVSRPIEKINSD-IMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
           P+P LR  +  +  + ++ I  L+D+ML+ MY T +GIGLAA Q+G    ++VIDL +  
Sbjct: 10  PNPKLRVQAEDVVDVKAEHIQTLVDDMLQTMYETGNGIGLAAPQVGRKEAIIVIDLSEE- 68

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R  P VFINPKI+   ++  V QEGCLS+PDY ADV+R   I +  +D +     +  D
Sbjct: 69  -RNEPQVFINPKIVR-GENPVVGQEGCLSVPDYYADVERFEKIAITALDRDGNEINMERD 126

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             LA  LQHE+DHL GILFID+LS LKR M  KK+ K
Sbjct: 127 DFLAIALQHEIDHLKGILFIDYLSPLKRQMAMKKVKK 163


>gi|39995240|ref|NP_951191.1| polypeptide deformylase [Geobacter sulfurreducens PCA]
 gi|39982002|gb|AAR33464.1| polypeptide deformylase [Geobacter sulfurreducens PCA]
          Length = 182

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++ +PDP+L++ + P+  IN     L+ +M E MY   G+GLAA QIGV  R++VID+
Sbjct: 18  RTILTYPDPVLKKKAVPVTIINDATRELVRDMAETMYDAQGVGLAAPQIGVSQRVIVIDV 77

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                R   +V INP +I   +  S  +EGCLS+P Y A+V R   + V+ ++   +  +
Sbjct: 78  SQRDERPELIVCINP-VIIHGEGESYEEEGCLSVPKYSANVHRHERVVVKSLNLEGEEVV 136

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             A+GLLA   QHE+DHL+G+LF+DHLS LK++M  KK  ++ +
Sbjct: 137 HRAEGLLAIAFQHEIDHLDGVLFVDHLSALKKEMFKKKYRRMTE 180


>gi|284040267|ref|YP_003390197.1| peptide deformylase [Spirosoma linguale DSM 74]
 gi|283819560|gb|ADB41398.1| peptide deformylase [Spirosoma linguale DSM 74]
          Length = 190

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 100/176 (56%), Gaps = 11/176 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ + DP+LR+ ++ IE  + D+  L  NM E MY+  GIGLAA QIG   R+ V+D +
Sbjct: 4   PIIAYGDPVLRKRAKDIEPGSLDVKTLSQNMFETMYAASGIGLAAPQIGQSVRMFVVDGE 63

Query: 65  -----------DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVR 113
                      D +      VFINP+II  + D   ++EGCLSIP  R +V R   I +R
Sbjct: 64  PLNEDEPEEDIDQSLVGFKKVFINPEIIEEAGDDWGFEEGCLSIPGIRGEVFRPEIIVIR 123

Query: 114 YMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           Y D +        DG+ A  +QHE DHL+G LF D+L  L+R +I KK+S + + +
Sbjct: 124 YFDVDWNEHEEEYDGMAARIIQHEYDHLDGKLFTDYLPSLRRTLIKKKLSDISKGK 179


>gi|220931832|ref|YP_002508740.1| peptide deformylase [Halothermothrix orenii H 168]
 gi|254767591|sp|B8CWS6|DEF_HALOH RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|219993142|gb|ACL69745.1| peptide deformylase [Halothermothrix orenii H 168]
          Length = 154

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 96/148 (64%), Gaps = 4/148 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+LR  ++P+ +I    ++LIDNM+E MY  +G+GLAA Q+GV  R++V+D  +    +
Sbjct: 11  DPVLRSKAKPVTEITKKTLSLIDNMVETMYQAEGVGLAAPQVGVSKRIIVVDTGEG---Q 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  INP+II  ++   + +EGCLS+P     V R++ +TV+ ++   +   I A+G L
Sbjct: 68  GLIELINPEIIE-TEGKDIMEEGCLSVPGQTGKVIRASKVTVKGLNRGGKEVRIRAEGFL 126

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMI 158
           A   QHE+DHLNGILFID + R+  +MI
Sbjct: 127 ARAFQHEIDHLNGILFIDKVVRIGEEMI 154


>gi|332885374|gb|EGK05623.1| polypeptide deformylase [Dysgonomonas mossii DSM 22836]
          Length = 187

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 104/171 (60%), Gaps = 7/171 (4%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+ ++  P+LR+V   I K   ++  LIDNM E MY+ DGIGLAA QIG+  RL VIDL+
Sbjct: 4   PIYLYGHPVLRKVGEDITKDYPNLGTLIDNMFETMYNADGIGLAAPQIGLAIRLFVIDLE 63

Query: 65  DHAHRKNPM-----VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN- 118
             A  +        VFINP+I+  S +    +EGCLSIP     V+R   I ++Y+D N 
Sbjct: 64  PLAEDEPKYAGFKKVFINPRIVEESGEPVKLEEGCLSIPGINEMVERKERIRIQYLDENF 123

Query: 119 AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             H  +Y D   A C+QHE DH+ G+LF+D +S +++ +I  K++ L++ R
Sbjct: 124 VAHDEVYED-FFARCIQHEYDHIEGVLFVDLISGIRKQLIKSKLNNLLKGR 173


>gi|68171578|ref|ZP_00544952.1| Formylmethionine deformylase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658603|ref|YP_506903.1| peptide deformylase [Ehrlichia chaffeensis str. Arkansas]
 gi|67999004|gb|EAM85681.1| Formylmethionine deformylase [Ehrlichia chaffeensis str. Sapulpa]
 gi|88600060|gb|ABD45529.1| peptide deformylase [Ehrlichia chaffeensis str. Arkansas]
          Length = 188

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 100/176 (56%), Gaps = 17/176 (9%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI---- 61
           +V  PD  L   S  +EK++  I  L+D+M E M++  G+GLAAVQ+GV  R++V+    
Sbjct: 6   IVTVPDKRLSLCSEEVEKVDQSIRKLVDDMFETMHANQGLGLAAVQVGVHKRILVMNVPE 65

Query: 62  DLQDHAHRKN-------------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSA 108
           + +D    +N             P   INPKI+  S +    +EGCLS+P Y   + R  
Sbjct: 66  EFEDSEDIENVEDKIEGYELYGGPYCIINPKIVDISQEKVKLKEGCLSVPGYFDYIVRPQ 125

Query: 109 FITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            I V+Y+D N    II A G LA CLQHE+DHLNG +F+ +LS+ KRD   +K+ K
Sbjct: 126 RIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSKFKRDFAIEKVKK 181


>gi|323496228|ref|ZP_08101286.1| peptide deformylase [Vibrio sinaloensis DSM 21326]
 gi|323318505|gb|EGA71458.1| peptide deformylase [Vibrio sinaloensis DSM 21326]
          Length = 167

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 106/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP L+  +  +E  +S I  LID+ML+ +Y TD GIGLA+ Q+G    +V+IDL 
Sbjct: 6   ILTAPDPKLKTQAHKVEDFSS-IQTLIDDMLDTLYDTDNGIGLASTQVGRSEAVVIIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P++ +NP++++ S   ++ QEGCLS+PDY A+V+R   + V   D +     I
Sbjct: 65  DN--RDEPLILVNPEVVSGSHK-ALGQEGCLSVPDYYAEVERYTSVVVSAQDRHGNSITI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            +D  LA  +QHE+DHL G LFID+LS LKR M  KK+ K ++ R
Sbjct: 122 ESDDFLAIVMQHEIDHLAGNLFIDYLSPLKRQMAMKKVKKHLKSR 166


>gi|17230571|ref|NP_487119.1| peptide deformylase [Nostoc sp. PCC 7120]
 gi|23396564|sp|Q8YSK6|DEF1_ANASP RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|17132173|dbj|BAB74778.1| polypeptide deformylase [Nostoc sp. PCC 7120]
          Length = 187

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (63%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++ +   LI +ML+ MYS+DGIGLAA Q+G+  +L+VID +      
Sbjct: 24  DRVLRQPAKRITKVDDETRQLIRDMLQTMYSSDGIGLAAPQVGINKQLIVIDCEPDNPAN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP I   S +    QEGCLSIP    DVKR   + V Y D N + Q + A  LL
Sbjct: 84  PPLILINPTIKQVSREICSAQEGCLSIPGVYMDVKRPEVVEVAYKDENGRPQTLKATDLL 143

Query: 131 ATCLQHELDHLNGILFIDHL 150
             C+QHE+DHLNG++F+D +
Sbjct: 144 GRCIQHEMDHLNGVVFVDRV 163


>gi|189485012|ref|YP_001955953.1| peptide deformylase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|238058216|sp|B1GZ10|DEF_UNCTG RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|170286971|dbj|BAG13492.1| peptide deformylase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 168

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 94/158 (59%), Gaps = 3/158 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  +  + DP LR+ +  + +IN  I  L  +MLE MYS  G+GLAA Q+G+L R  V
Sbjct: 1   MAKLKIKKYGDPALRKRAEAVSEINEIIKELASDMLETMYSASGVGLAAPQVGILLRFCV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+    ++K+P+V INP+II+  +  +  +EGCLS P +  +V R   I   Y D N  
Sbjct: 61  IDVD--PNKKSPIVMINPEIISGENKITA-EEGCLSFPGFYGNVNRFENIIAGYTDLNGN 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
            Q I A   LA  LQHE+DHL+  LFID+L   KR+ I
Sbjct: 118 RQEIKAQNFLAKALQHEIDHLDAKLFIDYLPDWKRESI 155


>gi|257063703|ref|YP_003143375.1| peptide deformylase [Slackia heliotrinireducens DSM 20476]
 gi|256791356|gb|ACV22026.1| peptide deformylase [Slackia heliotrinireducens DSM 20476]
          Length = 180

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 83/144 (57%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V +PDP LR V  P +  +  +  L   M   MY+ +G GLAA Q+GV  R++VID  
Sbjct: 7   PVVTYPDPTLREVCVPCDPSDKSLKKLARQMANTMYANNGCGLAAPQVGVNKRIIVIDCD 66

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
             +  +NP+  +NP+II       +  EGCLS P    +++R  +  V+Y D N +  II
Sbjct: 67  QDSGTRNPITLLNPEIIETRGPEELDGEGCLSCPGITVEIRRPTYAIVKYTDLNGEDWII 126

Query: 125 YADGLLATCLQHELDHLNGILFID 148
             DGLL  CLQHE+DHLNGI   +
Sbjct: 127 EGDGLLGRCLQHEIDHLNGITLFE 150


>gi|187930742|ref|YP_001901229.1| peptide deformylase [Ralstonia pickettii 12J]
 gi|187727632|gb|ACD28797.1| peptide deformylase [Ralstonia pickettii 12J]
          Length = 171

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 97/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   G+GLAA Q+ V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAVVDDRIRKLVADMAETMYEAPGVGLAATQVDVHERVITIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  SD+  V+ EGCLS+PD    V R A + VR ++       + AD 
Sbjct: 67  RDELRVFINPEILWASDEHKVWDEGCLSVPDIYDKVDRPARVRVRALNEKGDTFELEADD 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK+  I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQTRIRSKLKK 162


>gi|242277625|ref|YP_002989754.1| peptide deformylase [Desulfovibrio salexigens DSM 2638]
 gi|242120519|gb|ACS78215.1| peptide deformylase [Desulfovibrio salexigens DSM 2638]
          Length = 170

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 95/162 (58%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++ +P+  L+ V   +E++  ++  +IDNM+E MY  DG+GLAA Q+GV  RL+VID   
Sbjct: 5   ILAYPEESLKEVCSRVEEVTPELKEIIDNMIETMYEDDGVGLAAPQVGVQKRLIVIDPSG 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              R +  V INP+I+  S      +E CLS P ++  +KR   +TV   D       I 
Sbjct: 65  PKERTDLQVIINPEIVEKSSQKVDSEEACLSCPGFKCVIKRHETVTVTGTDPEGNDVRIE 124

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           AD  LA  LQHE+DHL+G L +D + RLKR M  KK+ K ++
Sbjct: 125 ADDFLAIVLQHEIDHLDGTLIVDRVGRLKRAMYDKKVKKWLK 166


>gi|126174517|ref|YP_001050666.1| peptide deformylase [Shewanella baltica OS155]
 gi|153000548|ref|YP_001366229.1| peptide deformylase [Shewanella baltica OS185]
 gi|160875185|ref|YP_001554501.1| peptide deformylase [Shewanella baltica OS195]
 gi|217973486|ref|YP_002358237.1| peptide deformylase [Shewanella baltica OS223]
 gi|304408620|ref|ZP_07390241.1| peptide deformylase [Shewanella baltica OS183]
 gi|307305448|ref|ZP_07585196.1| peptide deformylase [Shewanella baltica BA175]
 gi|125997722|gb|ABN61797.1| peptide deformylase [Shewanella baltica OS155]
 gi|151365166|gb|ABS08166.1| peptide deformylase [Shewanella baltica OS185]
 gi|160860707|gb|ABX49241.1| peptide deformylase [Shewanella baltica OS195]
 gi|217498621|gb|ACK46814.1| peptide deformylase [Shewanella baltica OS223]
 gi|304352441|gb|EFM16838.1| peptide deformylase [Shewanella baltica OS183]
 gi|306911751|gb|EFN42176.1| peptide deformylase [Shewanella baltica BA175]
 gi|315267381|gb|ADT94234.1| peptide deformylase [Shewanella baltica OS678]
          Length = 163

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I + +   ID+++E MY TD GIGLAA Q+G    ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIEA-VQGFIDDLIETMYHTDDGIGLAATQVGSTDAIIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D   R  P V INP+I+  S +F V +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  DG--RDQPQVLINPEIVEKSGEF-VGEEGCLSIPGYRAKVSRFEKVKVTALDRTGKAIEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ETDEFLAIVLQHEIDHLHGKVFIEHLSMLKQQIALKKVRK 161


>gi|298504245|gb|ADI82968.1| polypeptide formylmethionine deformylase [Geobacter sulfurreducens
           KN400]
          Length = 167

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++ +PDP+L++ + P+  IN     L+ +M E MY   G+GLAA QIGV  R++VID+
Sbjct: 3   RTILTYPDPVLKKKAVPVTIINDATRELVRDMAETMYDAQGVGLAAPQIGVSQRVIVIDV 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
                R   +V INP +I   +  S  +EGCLS+P Y A+V R   + V+ ++   +  +
Sbjct: 63  SQRDERPELIVCINP-VIIHGEGESYEEEGCLSVPKYSANVHRHERVVVKSLNLEGEEVV 121

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             A+GLLA   QHE+DHL+G+LF+DHLS LK++M  KK  ++ +
Sbjct: 122 HRAEGLLAIAFQHEIDHLDGVLFVDHLSALKKEMFKKKYRRMTE 165


>gi|322421893|ref|YP_004201116.1| peptide deformylase [Geobacter sp. M18]
 gi|320128280|gb|ADW15840.1| peptide deformylase [Geobacter sp. M18]
          Length = 168

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 110/169 (65%), Gaps = 6/169 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDG-IGLAAVQIGVLYRLV 59
           M  KP+V +PDPIL++V  P++ I+ +I  L++++++ M++  G +G+AA Q+GV  R+ 
Sbjct: 1   MAVKPIVTYPDPILKQVCPPVQAIDVEIRQLVEDLVDTMHAGPGSVGVAAPQVGVARRVC 60

Query: 60  VIDLQDHAHRKNP----MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
           VID+  + H K      ++ INP+I+  S   +V +EGC+S+PDY  DV+R+  +T+R+ 
Sbjct: 61  VIDVSKNRHGKENNHGLLLMINPEILAKSG-AAVMREGCMSVPDYTGDVERATELTLRFT 119

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + +   +   A G  A  +QHE+DHL+G+LF+D ++ LK  +  +K  K
Sbjct: 120 EPDGGVREFEASGFEAVAIQHEMDHLDGLLFLDRIASLKTGLFRRKSYK 168


>gi|268316440|ref|YP_003290159.1| peptide deformylase [Rhodothermus marinus DSM 4252]
 gi|262333974|gb|ACY47771.1| peptide deformylase [Rhodothermus marinus DSM 4252]
          Length = 189

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 97/156 (62%), Gaps = 9/156 (5%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL- 63
           P+ ++ DPILR  ++P+   + ++  L+D+M+E M++  GIGLAA Q+G   R+ V+DL 
Sbjct: 4   PIHVYGDPILRERAQPVAADSPELQQLLDDMVETMHAASGIGLAAPQVGRRERVFVVDLT 63

Query: 64  --------QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
                   +       PM FINP+I+  S++   ++EGCLSIPD R  V+R   + +RY+
Sbjct: 64  PMKEELEAEGETLPPMPMFFINPEIVWTSEEQCSFEEGCLSIPDVREVVERPVAVRIRYL 123

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           D   + Q + A G+LA  +QHE DHL GILFID +S
Sbjct: 124 DRQFRPQELEARGMLARVIQHEYDHLEGILFIDRIS 159


>gi|297588336|ref|ZP_06946979.1| peptide deformylase [Finegoldia magna ATCC 53516]
 gi|297573709|gb|EFH92430.1| peptide deformylase [Finegoldia magna ATCC 53516]
          Length = 162

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 3/150 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR+ SR ++KI+  I  ++D+M E MY   GIGLA VQ+G+L R+VVID+QD   + 
Sbjct: 11  DPILRKKSREVKKIDDRIKQIVDDMFETMYENKGIGLACVQVGMLKRIVVIDMQDEDGK- 69

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             MV INPKI+  SD+  +  EGCLS+P     V+R   +TV Y D +   Q   A    
Sbjct: 70  --MVLINPKIVERSDEKQINVEGCLSVPGKNGYVERPKTVTVEYTDLDGNIQRKTATDYK 127

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITK 160
           A C  HELDHL+G+L+ D +  L  + + +
Sbjct: 128 AHCFCHELDHLDGVLYTDKVLNLSDEEVER 157


>gi|22299219|ref|NP_682466.1| peptide deformylase [Thermosynechococcus elongatus BP-1]
 gi|39930888|sp|Q8DIB4|DEF_THEEB RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|22295401|dbj|BAC09228.1| polypeptide deformylase [Thermosynechococcus elongatus BP-1]
          Length = 188

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 91/141 (64%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ + K++  I ++   ML+ MYS DGIGLAA Q+G+  +++VID+       
Sbjct: 24  DRVLRQPAKRVSKVDDSIRDIARKMLQTMYSADGIGLAAPQVGINKQILVIDIHPDDPEA 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP I  FS++  V QEGCLSIP    +V+R A + V Y D   + Q+I A GLL
Sbjct: 84  EPLVMINPVIKDFSEELEVCQEGCLSIPGVYLEVRRPAMVEVSYKDEWGRPQVIMAGGLL 143

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A  +QHE+DHL G++F+D + 
Sbjct: 144 ARAIQHEIDHLTGVMFVDRVE 164


>gi|254229199|ref|ZP_04922618.1| peptide deformylase [Vibrio sp. Ex25]
 gi|262395549|ref|YP_003287402.1| peptide deformylase [Vibrio sp. Ex25]
 gi|151938284|gb|EDN57123.1| peptide deformylase [Vibrio sp. Ex25]
 gi|262339143|gb|ACY52937.1| peptide deformylase [Vibrio sp. Ex25]
          Length = 168

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 107/162 (66%), Gaps = 5/162 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
            PDP L+  +  +  + S +  LID+MLE +Y+T +GIGLA+ Q+G    +VVID+ D  
Sbjct: 9   IPDPRLKVKAEKVTDV-STVQTLIDDMLETLYATGNGIGLASTQVGRKEAVVVIDISDE- 66

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R +P++ +NP++++  ++ ++ QEGCLS+P+Y ADV+R   + V  +D +     I +D
Sbjct: 67  -RNDPLILVNPEVVS-GENKALGQEGCLSVPEYYADVERYTSVVVSALDRDGNPMTIESD 124

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ +
Sbjct: 125 EFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVKKYVKAQ 166


>gi|46581767|ref|YP_012575.1| polypeptide deformylase [Desulfovibrio vulgaris str. Hildenborough]
 gi|120601080|ref|YP_965480.1| peptide deformylase [Desulfovibrio vulgaris DP4]
 gi|46451190|gb|AAS97835.1| polypeptide deformylase [Desulfovibrio vulgaris str. Hildenborough]
 gi|120561309|gb|ABM27053.1| peptide deformylase [Desulfovibrio vulgaris DP4]
 gi|311232326|gb|ADP85180.1| peptide deformylase [Desulfovibrio vulgaris RCH1]
          Length = 171

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%)

Query: 30  NLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSV 89
            L  +M+E MY  DGIGLAA Q+G   RL+V+D+     R++ M FINP++    D+   
Sbjct: 29  QLAADMVETMYREDGIGLAAPQVGANCRLIVVDVSGPEKRESLMTFINPRLEPLGDEKVE 88

Query: 90  YQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDH 149
            +EGCLS+P  RA V+R   + +   D +     + ADGLLA CLQHE+DHL G LFID 
Sbjct: 89  SEEGCLSVPALRAKVERHERVRLTARDLDGNEVCMDADGLLAICLQHEIDHLGGTLFIDR 148

Query: 150 LSRLKRDMITKKMSKLVQLR 169
           +SRLKR +   K+ K ++ R
Sbjct: 149 ISRLKRSLYDAKVKKWLKAR 168


>gi|75907053|ref|YP_321349.1| peptide deformylase [Anabaena variabilis ATCC 29413]
 gi|75700778|gb|ABA20454.1| peptide deformylase [Anabaena variabilis ATCC 29413]
          Length = 187

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (62%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++ +   LI +ML+ MYS DGIGLAA Q+G+  +L+VID +      
Sbjct: 24  DRVLRQPAKRITKVDDETRQLIRDMLQTMYSNDGIGLAAPQVGINKQLIVIDCEPDNPAN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP I   S +    QEGCLSIP    DVKR   + V Y D N + Q + A  LL
Sbjct: 84  PPLVLINPTIKQVSREICSAQEGCLSIPGVYMDVKRPEVVEVAYKDENGRPQTLKATDLL 143

Query: 131 ATCLQHELDHLNGILFIDHL 150
             C+QHE+DHLNG++F+D +
Sbjct: 144 GRCIQHEMDHLNGVVFVDRV 163


>gi|299068355|emb|CBJ39579.1| peptide deformylase [Ralstonia solanacearum CMR15]
          Length = 169

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 98/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAVVDDRIRKLVADMAETMYDAPGIGLAATQVDVHERVITIDISES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  SD   V+ EGCLS+PD    V+R   + VR ++   +   +  DG
Sbjct: 67  RDELRVFINPEIVWASDARKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGESFELETDG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 162


>gi|217968557|ref|YP_002353791.1| peptide deformylase [Thauera sp. MZ1T]
 gi|217505884|gb|ACK52895.1| peptide deformylase [Thauera sp. MZ1T]
          Length = 167

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 101/160 (63%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L  V+ P+ +++ +I  LI +M E MY   GIGLAA Q+ V  R+VVID+ 
Sbjct: 5   PILRYPDPRLHTVAAPVGRVDDEIRRLIADMAETMYEAPGIGLAATQVDVHKRIVVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   +   M  INP+I+  S +  V +EGCLS+P     V R+  + VR ++   +    
Sbjct: 65  ED--KSGLMALINPEILERSGE-QVCEEGCLSVPGIYEKVSRAERVKVRALNEKGESFEF 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            ADGLLA C+QHE+DHL+G +F+++LS+LK   I  K++K
Sbjct: 122 EADGLLAVCVQHEIDHLDGKVFVEYLSQLKLGRIKSKLAK 161


>gi|15894999|ref|NP_348348.1| peptide deformylase [Clostridium acetobutylicum ATCC 824]
 gi|3023622|sp|O05100|DEF1_CLOAB RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|15024688|gb|AAK79688.1|AE007681_9 N-formylmethionyl-tRNA deformylase [Clostridium acetobutylicum ATCC
           824]
 gi|1905954|gb|AAB50347.1| deformylase [Clostridium acetobutylicum ATCC 824]
 gi|325509136|gb|ADZ20772.1| peptide deformylase [Clostridium acetobutylicum EA 2018]
          Length = 150

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 96/144 (66%), Gaps = 6/144 (4%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           + D +LR+ SR +EKI+  ++ LID+M E MY+ DG+GLAA Q+G+L RLVVID+ +   
Sbjct: 9   YGDELLRKKSRKVEKIDKRLLTLIDDMFETMYNADGVGLAAPQVGILKRLVVIDVGE--- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
              P+V INP+I+  S   +V  EGCLSIP+ + +V+R  ++  + ++   +  +I A+ 
Sbjct: 66  --GPVVLINPEILETSGK-AVDVEGCLSIPERQGEVERPTYVKAKALNEKGEEIVIEAED 122

Query: 129 LLATCLQHELDHLNGILFIDHLSR 152
           L A  + HE DHLNG+LF+D L+ 
Sbjct: 123 LFARAICHETDHLNGVLFVDKLAE 146


>gi|261409931|ref|YP_003246172.1| peptide deformylase [Paenibacillus sp. Y412MC10]
 gi|261286394|gb|ACX68365.1| peptide deformylase [Paenibacillus sp. Y412MC10]
          Length = 172

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 100/151 (66%), Gaps = 7/151 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDG-IGLAAVQIGVLYRLV 59
           M  KP+V F DPILR+++RP++ +N+ ++ ++D+M+E +Y +DG  GLAA QIG+L RL+
Sbjct: 1   MTVKPIVPFGDPILRKIARPVDSVNARVLKILDDMVETLYDSDGRAGLAAPQIGILRRLI 60

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           V+D  +       +  INP+I+   D   +  E CLS P Y   VKR+  +TV+ ++   
Sbjct: 61  VMDCGEGL-----IELINPEIVEM-DGEQMGPEACLSYPGYYGYVKRADKVTVKTLNRQG 114

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHL 150
           Q  I+  +  LA C+QHE+DHLNGILF+DH+
Sbjct: 115 QTVILKGEDYLARCMQHEIDHLNGILFVDHV 145


>gi|313144549|ref|ZP_07806742.1| peptide deformylase [Helicobacter cinaedi CCUG 18818]
 gi|313129580|gb|EFR47197.1| peptide deformylase [Helicobacter cinaedi CCUG 18818]
          Length = 179

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 97/151 (64%), Gaps = 5/151 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL----Q 64
           +P+PILR+ S  +E  +  +  L+D+M E M  + G+GLAA+Q+G+  R++VI+L     
Sbjct: 15  YPNPILRQKSTKVESFDESLHTLLDDMYETMIESGGVGLAAIQVGIAKRILVINLPRDED 74

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
              ++++ +  INP  +T  DD   ++EGCLS+P++   VKR   ++V Y D     +I+
Sbjct: 75  KQQYKEDLLEVINPTFLTQEDDIE-WEEGCLSVPEFYESVKRFNKVSVAYKDRFGNDKIL 133

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKR 155
            A+G LA  LQHE+DHLNGILF+D L  L+R
Sbjct: 134 QAEGFLAVALQHEIDHLNGILFVDKLPILRR 164


>gi|295675125|ref|YP_003603649.1| peptide deformylase [Burkholderia sp. CCGE1002]
 gi|295434968|gb|ADG14138.1| peptide deformylase [Burkholderia sp. CCGE1002]
          Length = 167

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 101/159 (63%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+E++N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVEEVNDRIRRLVADMAETMYAAPGVGLAATQVDVHERVIVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               + FINP+I+  SD   + +EGCLS+P    +V+R+  + VR ++   +   +  +G
Sbjct: 67  HDELLAFINPEIVWSSDQRKLSEEGCLSVPGIYDNVERAEKVRVRALNQKGETFELDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCIQHEMDHLMGRVFVEYLSPLKQTRIKSKMKKLAH 165


>gi|153836422|ref|ZP_01989089.1| peptide deformylase [Vibrio parahaemolyticus AQ3810]
 gi|149750324|gb|EDM61069.1| peptide deformylase [Vibrio parahaemolyticus AQ3810]
          Length = 168

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 107/162 (66%), Gaps = 5/162 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
            PDP L+  +  +  + S I  LID+MLE +Y+T +GIGLA+ Q+G    +VVID+ D  
Sbjct: 9   IPDPRLKVKAEKVTDV-STIQTLIDDMLETLYATGNGIGLASTQVGRKEAVVVIDISDE- 66

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R +P++ +NP++++  ++ ++ QEGCLS+P+Y ADV+R   + V  +D +     I +D
Sbjct: 67  -RNDPLILVNPEVVS-GENKALGQEGCLSVPEYYADVERYTSVVVSALDRDGSPITIESD 124

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ +
Sbjct: 125 EFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVKKYVKAQ 166


>gi|33860628|ref|NP_892189.1| peptide deformylase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|39930841|sp|Q7V3K7|DEF_PROMP RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|33633570|emb|CAE18527.1| putative formylmethionine deformylase [Prochlorococcus marinus
           subsp. pastoris str. CCMP1986]
          Length = 201

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 92/141 (65%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR  ++ I K+++ I NL  +ML+ MY+  GIGLAA QIG+   L+VID+       
Sbjct: 38  DDVLRENAKRISKVDNSIRNLAKDMLQSMYAAKGIGLAAPQIGIKKELLVIDVNFEDAAA 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP+I  +    + Y+EGCLSIP    +V R + I +R+ D   + + + ADGLL
Sbjct: 98  EPLILINPEITDYGTTLNSYEEGCLSIPGVYLNVVRPSTIKLRFRDEMGRPRKMKADGLL 157

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHLNG+LF+D ++
Sbjct: 158 ARCIQHEMDHLNGVLFVDRVT 178


>gi|224438109|ref|ZP_03659044.1| peptide deformylase [Helicobacter cinaedi CCUG 18818]
          Length = 175

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 97/151 (64%), Gaps = 5/151 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL----Q 64
           +P+PILR+ S  +E  +  +  L+D+M E M  + G+GLAA+Q+G+  R++VI+L     
Sbjct: 11  YPNPILRQKSTKVESFDESLHTLLDDMYETMIESGGVGLAAIQVGIAKRILVINLPRDED 70

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
              ++++ +  INP  +T  DD   ++EGCLS+P++   VKR   ++V Y D     +I+
Sbjct: 71  KQQYKEDLLEVINPTFLTQEDDIE-WEEGCLSVPEFYESVKRFNKVSVAYKDRFGNDKIL 129

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKR 155
            A+G LA  LQHE+DHLNGILF+D L  L+R
Sbjct: 130 QAEGFLAVALQHEIDHLNGILFVDKLPILRR 160


>gi|28900639|ref|NP_800294.1| peptide deformylase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365515|ref|ZP_05778052.1| peptide deformylase [Vibrio parahaemolyticus K5030]
 gi|260877578|ref|ZP_05889933.1| peptide deformylase [Vibrio parahaemolyticus AN-5034]
 gi|260895409|ref|ZP_05903905.1| peptide deformylase [Vibrio parahaemolyticus Peru-466]
 gi|260901682|ref|ZP_05910077.1| peptide deformylase [Vibrio parahaemolyticus AQ4037]
 gi|31076642|sp|Q87I22|DEF2_VIBPA RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|28809019|dbj|BAC62127.1| polypeptide deformylase [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085281|gb|EFO34976.1| peptide deformylase [Vibrio parahaemolyticus Peru-466]
 gi|308090907|gb|EFO40602.1| peptide deformylase [Vibrio parahaemolyticus AN-5034]
 gi|308108907|gb|EFO46447.1| peptide deformylase [Vibrio parahaemolyticus AQ4037]
 gi|308114324|gb|EFO51864.1| peptide deformylase [Vibrio parahaemolyticus K5030]
 gi|328470579|gb|EGF41490.1| peptide deformylase [Vibrio parahaemolyticus 10329]
          Length = 168

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 107/162 (66%), Gaps = 5/162 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
            PDP L+  +  +  + S I  LID+MLE +Y+T +GIGLA+ Q+G    +VVID+ D  
Sbjct: 9   IPDPRLKVKAEKVTDV-STIQTLIDDMLETLYATGNGIGLASTQVGRKEAVVVIDISDE- 66

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R +P++ +NP++++  ++ ++ QEGCLS+P+Y ADV+R   + V  +D +     I +D
Sbjct: 67  -RNDPLILVNPEVVS-GENKALGQEGCLSVPEYYADVERYTSVVVSALDRDGNPITIESD 124

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ +
Sbjct: 125 EFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVKKYVKAQ 166


>gi|253997550|ref|YP_003049614.1| peptide deformylase [Methylotenera mobilis JLW8]
 gi|253984229|gb|ACT49087.1| peptide deformylase [Methylotenera mobilis JLW8]
          Length = 166

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L  V++P++++N+ +  LID+M E MY+  GIGLAA Q+    +L+++D  +   
Sbjct: 9   YPDPRLHTVAKPVKEVNAAVHRLIDDMAETMYAAPGIGLAATQVDQHVQLLLVDTSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +    VFINPKI+   D   VY+EGCLS+P     V R+  I V  +  + +   + A G
Sbjct: 67  KDQLQVFINPKILE-RDGEQVYEEGCLSVPGVYESVTRAEKILVEALGKDGKRFTLEAHG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LL+ C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 126 LLSVCIQHEMDHLQGKVFVEYLSPLKRNRIKNKMLK 161


>gi|91205496|ref|YP_537851.1| polypeptide deformylase [Rickettsia bellii RML369-C]
 gi|157827211|ref|YP_001496275.1| polypeptide deformylase [Rickettsia bellii OSU 85-389]
 gi|91069040|gb|ABE04762.1| Polypeptide deformylase [Rickettsia bellii RML369-C]
 gi|157802515|gb|ABV79238.1| Polypeptide deformylase [Rickettsia bellii OSU 85-389]
          Length = 183

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 101/163 (61%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++    IE ++ +I  +ID ML  M     +GL A  +G+L R+ V+DL +
Sbjct: 10  IVYAPNDIFKKQGELIEVVDDNIRTIIDKMLNTMQIERAVGLGANMVGILKRIAVVDLHE 69

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ +P++FINP+I  FS D   + E  LS P   A + RS  I + Y+D +   Q + 
Sbjct: 70  N-NKSSPIIFINPEITYFSSDKQTFMERSLSFPGIEAPITRSKAIKINYLDYHGNKQELE 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A   LAT +QHE+D+LNG +F+DHLS+LKRD + KKM K +++
Sbjct: 129 AQDFLATVIQHEVDYLNGKVFLDHLSKLKRDTLLKKMLKYIKM 171


>gi|256827225|ref|YP_003151184.1| peptide deformylase [Cryptobacterium curtum DSM 15641]
 gi|256583368|gb|ACU94502.1| peptide deformylase [Cryptobacterium curtum DSM 15641]
          Length = 175

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (56%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V+ PDPILR+ +   +  +  + +L   M E MY  +G GLAA Q+GVL RL+VID   
Sbjct: 3   IVLSPDPILRQRAEEADIADESLKSLAQQMAETMYENNGCGLAAPQVGVLKRLIVIDCDT 62

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
            +  +NP+  INP I+  + ++    EGCLS+P     ++R AF  V Y D +     I 
Sbjct: 63  ESEERNPITLINPVILETAGEWETEGEGCLSVPGITVPIRRRAFARVEYRDLDGNVCTIE 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKR 155
            DGLL  CLQHE+DHLNG    +    + R
Sbjct: 123 GDGLLGRCLQHEIDHLNGKTLFESCDPITR 152


>gi|284047692|ref|YP_003398031.1| peptide deformylase [Acidaminococcus fermentans DSM 20731]
 gi|283951913|gb|ADB46716.1| peptide deformylase [Acidaminococcus fermentans DSM 20731]
          Length = 158

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 88/137 (64%), Gaps = 4/137 (2%)

Query: 12  PILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKN 71
           PILR  + P+ + +  +  L+ +M E MY+ +G GLAA QIG+  RLVVID  D A  + 
Sbjct: 12  PILREKAVPVTRFDKKLARLLKDMAETMYAANGCGLAAPQIGLSKRLVVIDAGDGAGIRE 71

Query: 72  PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLA 131
              F+NP ++T  +  +V  EGCLS+PDY  +VKR+A ITV + D    H  + ADGLLA
Sbjct: 72  ---FVNP-VLTDPEGEAVDSEGCLSVPDYEGEVKRAARITVHFQDRKGDHYRLTADGLLA 127

Query: 132 TCLQHELDHLNGILFID 148
             LQHE DHL G+LFID
Sbjct: 128 RALQHECDHLEGVLFID 144


>gi|332830442|gb|EGK03070.1| polypeptide deformylase [Dysgonomonas gadei ATCC BAA-286]
          Length = 187

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 104/172 (60%), Gaps = 9/172 (5%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+ ++   +LR+ SR I     ++  LI+NM E MY+ DGIGLAA QIG+  RL VIDL+
Sbjct: 4   PIYLYGHSVLRKKSREISSDYPNLKELIENMFETMYNADGIGLAAPQIGLDIRLFVIDLE 63

Query: 65  DHAHRKNPM------VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCN 118
             A   NP+      VFINP II  + +    +EGCLSIP     V R+  I ++Y+D N
Sbjct: 64  PLA-EDNPIYSGFKKVFINPVIIEETGEVVKMEEGCLSIPGINEGVDRNEKIRIQYLDEN 122

Query: 119 -AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
              H  +Y D   A C+QHE DH+ GILFID +S +++ +I  K++ L++ R
Sbjct: 123 FVSHDEVY-DAFFARCIQHEYDHIEGILFIDKISGIRKQLIKSKLNNLIKGR 173


>gi|227821802|ref|YP_002825772.1| peptide deformylase [Sinorhizobium fredii NGR234]
 gi|227340801|gb|ACP25019.1| peptide deformylase-like protein [Sinorhizobium fredii NGR234]
          Length = 163

 Score =  129 bits (325), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 99/165 (60%), Gaps = 3/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++ FP+P L   +  + + +S + +L+D++ + M +  GIG+ A  IGVL R+ V
Sbjct: 1   MALRPIIRFPNPALGMSAEMVTRFDSSLRSLVDDLTDTMRAAPGIGITAPHIGVLQRVTV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           I+L+  A    P  F+NP++I  S++   + EG +S+P    +V+R   I VRY   + +
Sbjct: 61  IELERQA---GPRTFVNPQMIWCSEETERHSEGSVSMPGISEEVERPTSIRVRYQTISGE 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                A GL+A CLQHE+D L+GI +I  LSRLKR+   K+  KL
Sbjct: 118 TLEEEASGLMAVCLQHEIDQLDGIFWIRRLSRLKRERAVKRFEKL 162


>gi|83816785|ref|YP_445415.1| peptide deformylase [Salinibacter ruber DSM 13855]
 gi|294507298|ref|YP_003571356.1| peptide deformylase [Salinibacter ruber M8]
 gi|123739741|sp|Q2S316|DEF_SALRD RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|83758179|gb|ABC46292.1| peptide deformylase [Salinibacter ruber DSM 13855]
 gi|294343626|emb|CBH24404.1| Peptide deformylase [Salinibacter ruber M8]
          Length = 195

 Score =  129 bits (325), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (59%), Gaps = 9/156 (5%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+ ++    LR  + P+++    +  LIDNM+E M++  GIGLAA Q+G   RL V+DL 
Sbjct: 4   PIYVYGHEALRNETDPVQENTEALQELIDNMIETMHNAAGIGLAAPQVGRTERLFVVDLT 63

Query: 65  DHAHR---------KNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
             A             PMVFINP+I+  S+D +  +EGCLSIP+ R  V R   I +RY 
Sbjct: 64  PMADEIAEAGEPLPPQPMVFINPEIVEESEDTAEMEEGCLSIPEVREAVARPERIRMRYR 123

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           D   + Q + A G+L+  LQHE DHL+G+LF D+LS
Sbjct: 124 DREFEEQELEAGGMLSRVLQHERDHLDGVLFTDYLS 159


>gi|88807213|ref|ZP_01122725.1| peptide deformylase [Synechococcus sp. WH 7805]
 gi|88788427|gb|EAR19582.1| peptide deformylase [Synechococcus sp. WH 7805]
          Length = 183

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 95/156 (60%), Gaps = 7/156 (4%)

Query: 3   KKPLVIFP-------DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVL 55
           K+PL   P       D +LR  +R I K++  + +L  +ML  MY+  GIGLAA Q+GV 
Sbjct: 5   KEPLETAPLQIHTLGDDVLRLDARRIGKVDETVRDLARDMLRSMYTARGIGLAAPQVGVH 64

Query: 56  YRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
            +L+VIDL        P+V INP+II+ S     Y+EGCLSIP    DV R + + V + 
Sbjct: 65  QQLLVIDLDPETASSPPLVLINPEIISASASLDTYEEGCLSIPGVYLDVVRPSAVQVSFR 124

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           D   + + + ADGL+A C+QHE+DHL G+LF+D ++
Sbjct: 125 DEMGRPKTLKADGLMARCIQHEMDHLTGVLFVDRVT 160


>gi|89074343|ref|ZP_01160825.1| peptide deformylase [Photobacterium sp. SKA34]
 gi|89049830|gb|EAR55371.1| peptide deformylase [Photobacterium sp. SKA34]
          Length = 170

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 102/162 (62%), Gaps = 5/162 (3%)

Query: 10  PDPILRRVSRPIEKINSD-IMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
           P+P LR  +  +  + ++ I  LID+ML  MY T +GIGLAA Q+G    ++VIDL +  
Sbjct: 10  PNPKLRVQAEDVADVKAEHIQTLIDDMLHTMYETGNGIGLAAPQVGRKESIIVIDLSEE- 68

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R  P VF+NPKI+   ++  V QEGCLS+PDY ADV+R   I +  +D +     +  D
Sbjct: 69  -RNEPHVFVNPKIVR-GENPVVGQEGCLSVPDYYADVERFEKIELTALDRDGNDIHLERD 126

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             LA  LQHE+DHL GILFID+LS LKR M  KK+ K ++ +
Sbjct: 127 DFLAIALQHEIDHLKGILFIDYLSPLKRQMAMKKVKKFLKAQ 168


>gi|269968185|ref|ZP_06182216.1| peptide deformylase [Vibrio alginolyticus 40B]
 gi|269827183|gb|EEZ81486.1| peptide deformylase [Vibrio alginolyticus 40B]
          Length = 168

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 106/160 (66%), Gaps = 5/160 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
            PDP L+  +  +  + S +  LID+MLE +Y+T +GIGLA+ Q+G    +VVID+ D  
Sbjct: 9   IPDPRLKVKAEKVTDV-STVQTLIDDMLETLYATGNGIGLASTQVGRKEAVVVIDISDE- 66

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R +P++ +NP++++  ++ ++ QEGCLS+P+Y ADV+R   + V  +D +     I +D
Sbjct: 67  -RNDPLILVNPEVVS-GENKALGQEGCLSVPEYYADVERYTSVVVSALDRDGNPITIESD 124

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+
Sbjct: 125 EFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVKKYVK 164


>gi|189347171|ref|YP_001943700.1| peptide deformylase [Chlorobium limicola DSM 245]
 gi|238692163|sp|B3EE19|DEF_CHLL2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|189341318|gb|ACD90721.1| peptide deformylase [Chlorobium limicola DSM 245]
          Length = 185

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 106/168 (63%), Gaps = 5/168 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-- 62
           P+ I+ D +LR+ + P+E ++ ++  L+ NM E MYS  GIGLAA Q+G   RL+V+D  
Sbjct: 4   PINIYSDDVLRQQALPLEGVDKEVEELLGNMFETMYSAPGIGLAAPQVGRSLRLLVLDIS 63

Query: 63  -LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
            ++++A+ K PMV INP+I+     +   +EGCLS+P  + DV R + I++ Y D + + 
Sbjct: 64  CMREYANVK-PMVVINPEIVAVKG-YRSMEEGCLSLPGLQGDVVRPSSISLNYRDEHFEG 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
           Q     GLLA  LQHE+DHL+G LF+D L + +R  + K++  L   R
Sbjct: 122 QNAEFSGLLARVLQHEIDHLDGRLFVDRLQKKERRKVQKELDALASGR 169


>gi|116073817|ref|ZP_01471079.1| peptide deformylase [Synechococcus sp. RS9916]
 gi|116069122|gb|EAU74874.1| peptide deformylase [Synechococcus sp. RS9916]
          Length = 201

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 88/141 (62%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ +R I K++  +  L  +ML  MY+  GIGLAA Q+GV  +L+VIDL       
Sbjct: 38  DEVLRQEARRISKVDESVRELARDMLRSMYTAKGIGLAAPQVGVHKQLLVIDLDLETPSS 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I T S     Y+EGCLSIP    DV R   I + Y D   + + + ADGL+
Sbjct: 98  PPLVLINPEITTASATVDTYEEGCLSIPGVYLDVVRPTAIQLSYRDEMGRPKTMKADGLM 157

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHL G+LF+D ++
Sbjct: 158 ARCIQHEMDHLKGVLFVDRVT 178


>gi|134093408|ref|YP_001098483.1| peptide deformylase [Herminiimonas arsenicoxydans]
 gi|133737311|emb|CAL60354.1| Peptide deformylase (PDF) [Herminiimonas arsenicoxydans]
          Length = 176

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 97/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L ++++P+   ++ I  L+ +M E MY   G+GLAA Q+ V  +++VID  +   
Sbjct: 9   YPDSRLHKIAKPVTTFDARIKTLVADMAETMYDAPGVGLAASQVDVHEQVIVIDTSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R     +INP++I  S +  +Y EGCLS+P     V+R A + VR  D + +   + A+G
Sbjct: 67  RTELRAYINPELIWVSPEMQIYDEGCLSVPGVYDGVERHAKVKVRAYDADGKQFELEAEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LKR+ I  KM K
Sbjct: 127 LLAVCIQHEMDHLKGKVFVEYLSPLKRNRIKTKMLK 162


>gi|127513031|ref|YP_001094228.1| peptide deformylase [Shewanella loihica PV-4]
 gi|126638326|gb|ABO23969.1| peptide deformylase [Shewanella loihica PV-4]
          Length = 163

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 103/160 (64%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P+E I + +   ID+++E MY TD GIGLAA Q+G  + ++VIDL 
Sbjct: 6   ILTIPDERLKRKAKPVEDIAA-VQGFIDDLIETMYHTDDGIGLAATQVGSEHAILVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  PMV INP+ +  S +  V +EGCLSIP YRA V R   + V+ ++   +   I
Sbjct: 65  ED--RDQPMVVINPEFVERSGEI-VGEEGCLSIPGYRAKVTRFEKVKVKALNREGEAFEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            +D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ESDDFLAIVLQHEMDHLDGKVFIEHLSPLKQQIALKKVKK 161


>gi|325105696|ref|YP_004275350.1| peptide deformylase [Pedobacter saltans DSM 12145]
 gi|324974544|gb|ADY53528.1| peptide deformylase [Pedobacter saltans DSM 12145]
          Length = 188

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 99/171 (57%), Gaps = 5/171 (2%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K P+V + DP+L++V+  IEK   ++  LI+NM E M + +G+GLAA QIG+  RL VI
Sbjct: 1   MKLPIVAYGDPVLKKVAVDIEKDYPELPALIENMFETMDNANGVGLAAPQIGLSIRLFVI 60

Query: 62  DLQDHAHRKNPM-----VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
           D    A     +     +FINP I   S     + EGCLSIPD R DV R   IT+ Y D
Sbjct: 61  DATPFADEDASLASFKKIFINPIITDESGKEWKFNEGCLSIPDIREDVSRKEQITISYFD 120

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            N  H     +GL A  +QHE DH+ G LF D +S LK+ M+  K+  +V+
Sbjct: 121 ENWIHHEDTFNGLAARVIQHEYDHIQGKLFTDRISPLKKAMLKGKLDAIVK 171


>gi|254431727|ref|ZP_05045430.1| peptide deformylase [Cyanobium sp. PCC 7001]
 gi|197626180|gb|EDY38739.1| peptide deformylase [Cyanobium sp. PCC 7001]
          Length = 183

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 87/141 (61%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR  +R I K++  +  L  +ML  MY+  GIGLAA Q+GV  +L+VIDL       
Sbjct: 20  DAVLRTPARRISKVDEAVRELARDMLRSMYTAKGIGLAAPQVGVHKQLLVIDLDPDNPAT 79

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            PMV INP+I +F      Y+EGCLSIP    +V R   + V + D   + Q +  DGLL
Sbjct: 80  PPMVLINPEIRSFGGSLDTYEEGCLSIPGVYLNVVRPTAVEVSFRDEMGRPQKLRTDGLL 139

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHLNG+LF+D ++
Sbjct: 140 ARCIQHEMDHLNGVLFVDRVT 160


>gi|90579699|ref|ZP_01235508.1| peptide deformylase [Vibrio angustum S14]
 gi|90439273|gb|EAS64455.1| peptide deformylase [Vibrio angustum S14]
          Length = 170

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 101/160 (63%), Gaps = 5/160 (3%)

Query: 10  PDPILRRVSRPIEKINSD-IMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
           P+P LR  +  +  + ++ I  LID+ML  MY T +GIGLAA Q+G    ++VIDL +  
Sbjct: 10  PNPKLRVQAEDVVDVKAEHIQTLIDDMLHTMYETGNGIGLAAPQVGRKESIIVIDLSEE- 68

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R  P VF+NPKI+   ++  V QEGCLS+PDY ADV+R   I +  +D +     +  D
Sbjct: 69  -RNEPQVFVNPKIVR-GENPVVGQEGCLSVPDYYADVERFEKIELTALDRDGNDIHLERD 126

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             LA  LQHE+DHL GILFID+LS LKR M  KK+ K ++
Sbjct: 127 DFLAIALQHEIDHLKGILFIDYLSPLKRQMAMKKVKKFLK 166


>gi|300775194|ref|ZP_07085056.1| peptide deformylase [Chryseobacterium gleum ATCC 35910]
 gi|300505934|gb|EFK37070.1| peptide deformylase [Chryseobacterium gleum ATCC 35910]
          Length = 190

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 97/159 (61%), Gaps = 13/159 (8%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL- 63
           P+  F DP+LR+V + I+K    +  LIDNM E MYS +GIGLAA QIG+  RL VID+ 
Sbjct: 4   PIRAFGDPVLRKVGKDIDKDYPGLQELIDNMFETMYSANGIGLAAPQIGLDIRLFVIDVT 63

Query: 64  -----QDHAHRKNPM-----VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVR 113
                +D+   K+ +     VFIN +I+  S +   + EGCLSIPD R DVKR   I + 
Sbjct: 64  PLAEDEDYEDIKDELAEFKKVFINAQILEESGEEWKFNEGCLSIPDVREDVKRKGTIVIE 123

Query: 114 YMDCN-AQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           Y D N  +H   ++D + A  +QHE DH+ GILF DHLS
Sbjct: 124 YYDENFVKHTETFSD-IRARVIQHEYDHIEGILFTDHLS 161


>gi|33239533|ref|NP_874475.1| peptide deformylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|39930846|sp|Q7VED2|DEF_PROMA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|33237058|gb|AAP99127.1| N-formylmethionyl-tRNA deformylase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 203

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 87/135 (64%)

Query: 14  LRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPM 73
           LR+ ++ I K++ +I +L+  ML  MY+  GIGLAA QIG   +L+VIDL        P+
Sbjct: 41  LRQSAKRISKVDKNIRDLVKKMLHSMYAAKGIGLAAPQIGSQQQLLVIDLDIENSATPPI 100

Query: 74  VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATC 133
           + INP+I  FS     Y+EGCLSIP    DV R + I V + D   + + I ADGLLA C
Sbjct: 101 ILINPEITEFSATIDTYEEGCLSIPGVYLDVIRPSSIKVNFRDEMGRPKKINADGLLARC 160

Query: 134 LQHELDHLNGILFID 148
           +QHE+DHLNG+LF+D
Sbjct: 161 IQHEMDHLNGVLFVD 175


>gi|313894829|ref|ZP_07828389.1| peptide deformylase [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976510|gb|EFR41965.1| peptide deformylase [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 156

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (66%), Gaps = 4/138 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+L++V+ PI+++      L+D+M E MYS +G+GLAA QIG   R+VVID++D     
Sbjct: 11  DPVLKQVAEPIDRLTKRHRQLLDDMAETMYSANGVGLAAPQIGKSIRMVVIDVEDE---H 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  INP +IT  +   V  EGCLS+P    DV+R+A +TV Y D  ++ + + A+GLL
Sbjct: 68  GLLELINP-VITMREGTVVGSEGCLSVPKMFGDVERAARVTVEYTDRRSRRRSLTAEGLL 126

Query: 131 ATCLQHELDHLNGILFID 148
           A C+QHE DHL+G LFID
Sbjct: 127 ARCIQHECDHLDGRLFID 144


>gi|257457589|ref|ZP_05622756.1| peptide deformylase [Treponema vincentii ATCC 35580]
 gi|257444975|gb|EEV20051.1| peptide deformylase [Treponema vincentii ATCC 35580]
          Length = 173

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 92/154 (59%), Gaps = 4/154 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           +  LR+ S+P+E I+  +  LI  M   M   +GIGLAA QIG   RL ++ + D   R 
Sbjct: 8   EETLRQPSKPVEHIDEALHELIREMFITMDEDNGIGLAAPQIGKNVRLFIVKIDDGIER- 66

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
              VFINP I+  S+    Y+EGCLSIP   ADV R   +TV+Y D N + + I A GLL
Sbjct: 67  ---VFINPLIVGTSEKQCSYEEGCLSIPKMFADVVRPEAVTVQYQDMNGRRRTIEATGLL 123

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A  +QHE DHL G+LFID LS  +RD +  K ++
Sbjct: 124 ARVIQHEYDHLEGVLFIDRLSEKERDSLVAKFTQ 157


>gi|110637113|ref|YP_677320.1| peptide deformylase [Cytophaga hutchinsonii ATCC 33406]
 gi|123163813|sp|Q11X86|DEF_CYTH3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|110279794|gb|ABG57980.1| peptide deformylase [Cytophaga hutchinsonii ATCC 33406]
          Length = 184

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 102/166 (61%), Gaps = 3/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V + DP+L++V++ IEK + D++ +  +M E M +  G+GLAA Q+ +  R+ VID  
Sbjct: 4   PIVAYGDPVLKKVAQDIEKGSLDVVKMSADMFETMENAHGVGLAAPQVALNLRMFVIDTS 63

Query: 65  DHAHRK-NPM--VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
                K  P+   FINP I     D   Y+EGCLSIP  RADV R A + +RY D + + 
Sbjct: 64  VFDDEKITPVRKTFINPVIEEEWGDEWPYEEGCLSIPGVRADVYRPANLRIRYFDTDWKE 123

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +   DG+ A  +QHE DH+ G+LF+DHLS +K+ ++  K++ + +
Sbjct: 124 HVEEFDGMTARVIQHEYDHIEGVLFVDHLSSIKKRLLKGKLTNISK 169


>gi|329924705|ref|ZP_08279720.1| peptide deformylase [Paenibacillus sp. HGF5]
 gi|328940539|gb|EGG36861.1| peptide deformylase [Paenibacillus sp. HGF5]
          Length = 172

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 100/151 (66%), Gaps = 7/151 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDG-IGLAAVQIGVLYRLV 59
           M  KP+V F DPILR+++RP++ +N+ ++ ++D+M+E +Y +DG  GLAA QIG+L RL+
Sbjct: 1   MTVKPIVPFGDPILRKIARPVDSVNARVLKILDDMVETLYDSDGRAGLAAPQIGILRRLI 60

Query: 60  VIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           V+D  +       +  INP+I+   D   +  E CLS P Y   VKR+  +TV+ ++   
Sbjct: 61  VMDCGEGL-----IELINPEIVEM-DGEQMGPEACLSYPGYYGYVKRADKVTVKTLNRQG 114

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHL 150
           +  I+  +  LA C+QHE+DHLNGILF+DH+
Sbjct: 115 ETVILKGEDYLARCMQHEIDHLNGILFVDHV 145


>gi|317967982|ref|ZP_07969372.1| peptide deformylase [Synechococcus sp. CB0205]
          Length = 200

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 89/141 (63%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR  +R I K++  +  L  +ML  MY+  GIGLAA QIGV  +L+VIDL+      
Sbjct: 37  DEVLREPARRIGKVDDAVRKLATDMLVSMYAAKGIGLAAPQIGVNQQLLVIDLELEDPSS 96

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I +       Y+EGCLSIP    DV R + + V Y D   + + + ADGL+
Sbjct: 97  PPLVLINPEITSVGGGLCTYEEGCLSIPGVYLDVVRPSVVDVSYRDAFGRPKRMKADGLM 156

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHLNG+LF+D ++
Sbjct: 157 ARCIQHEMDHLNGVLFVDRVT 177


>gi|282900896|ref|ZP_06308832.1| Formylmethionine deformylase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194234|gb|EFA69195.1| Formylmethionine deformylase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 190

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 99/155 (63%), Gaps = 4/155 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I KI+ ++  LI +ML+ MYS DGIGLAA Q+GV  +LVVID        
Sbjct: 24  DRVLRQPAKRITKIDDELRQLIRDMLQTMYSEDGIGLAAPQVGVNKQLVVIDCNPDKPEM 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP I   S +  V QEGCLSIP    +VKR   + + Y D   + Q + AD LL
Sbjct: 84  PPLILINPVIKQVSSELCVAQEGCLSIPKVFLEVKRPKIVEIAYKDEYGRPQTLKADNLL 143

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDM-ITKKMSK 164
           A C+ HE+DHLNG++F+D   R++  + +T+++SK
Sbjct: 144 ARCILHEMDHLNGVVFVD---RVENSLSLTEELSK 175


>gi|17544789|ref|NP_518191.1| peptide deformylase [Ralstonia solanacearum GMI1000]
 gi|23396562|sp|Q8Y3B0|DEF1_RALSO RecName: Full=Peptide deformylase 1; Short=PDF 1; AltName:
           Full=Polypeptide deformylase 1
 gi|17427078|emb|CAD13598.1| probable peptide deformylase 1 (pdf 1) (polypeptide deformylase1)
           protein [Ralstonia solanacearum GMI1000]
          Length = 169

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 98/156 (62%), Gaps = 2/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP L +V++P+  ++  I  L+ +M E MY   GIGLAA Q+ V  R++ ID+ +   
Sbjct: 9   YPDPRLHKVAKPVAVVDDRIRKLVADMAETMYDAPGIGLAATQVDVHERVITIDVSES-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R    VFINP+I+  S+   V+ EGCLS+PD    V+R   + VR ++   +   +  DG
Sbjct: 67  RDELRVFINPEIVWASEARKVWDEGCLSVPDIYDKVERPDRVRVRALNEKGESFELETDG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE+DHL G +F+++LS LK++ I  K+ K
Sbjct: 127 LLAVCIQHEMDHLMGKVFVEYLSPLKQNRIKIKLKK 162


>gi|260434658|ref|ZP_05788628.1| peptide deformylase [Synechococcus sp. WH 8109]
 gi|260412532|gb|EEX05828.1| peptide deformylase [Synechococcus sp. WH 8109]
          Length = 201

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 88/141 (62%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ +R I K+N  +  L  +ML  MY+  GIGLAA Q+G+  +L+VIDL       
Sbjct: 38  DEVLRQSARRIGKVNEQVRELARDMLRSMYTAKGIGLAAPQVGIHQQLLVIDLDLENAAT 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I   S     Y+EGCLSIP    DV R   I + + D   + + + ADGL+
Sbjct: 98  PPLVLINPEITAASAGLDTYEEGCLSIPGVYLDVVRPTAIELSFRDEMGRPRKMKADGLM 157

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHLNG+LF+D ++
Sbjct: 158 ARCIQHEMDHLNGVLFVDRVT 178


>gi|72383267|ref|YP_292622.1| peptide deformylase [Prochlorococcus marinus str. NATL2A]
 gi|123773734|sp|Q46HV9|DEF_PROMT RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|72003117|gb|AAZ58919.1| peptide deformylase [Prochlorococcus marinus str. NATL2A]
          Length = 202

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 94/149 (63%), Gaps = 2/149 (1%)

Query: 5   PLVIFP--DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL ++   D  LR  +  I K++  I  L  +ML  MYS+ GIGLAA Q+G+  RL+VID
Sbjct: 30  PLKVYQLGDEALRTPANRIVKVDDAIRKLAKDMLITMYSSKGIGLAAPQVGIQKRLLVID 89

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           L+       PMVFINP+II+ S     Y+EGCLSIP    +V R + I + Y D   + +
Sbjct: 90  LKFEDPNSPPMVFINPEIISSSATLDTYEEGCLSIPGVYLNVLRPSSIKLSYRDEMGRPK 149

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLS 151
            + ADGL+A C+QHE+DHLNG+ F+D ++
Sbjct: 150 KMNADGLMARCIQHEIDHLNGVCFVDKVT 178


>gi|148245003|ref|YP_001219697.1| polypeptide deformylase [Candidatus Vesicomyosocius okutanii HA]
 gi|146326830|dbj|BAF61973.1| polypeptide deformylase [Candidatus Vesicomyosocius okutanii HA]
          Length = 180

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 110/178 (61%), Gaps = 15/178 (8%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PD  LR  ++ +  +N  I  LI NM E MY+ +GIGLAA Q+    ++VVID+ 
Sbjct: 4   PILSYPDKRLRIKAKNVNIVNKTIQTLIKNMFETMYARNGIGLAATQVNQHLQIVVIDVP 63

Query: 65  DH----AHRKN----------PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFI 110
           +      +RKN          P+ FINP+I         + EGCLS+ D++A+++R+  I
Sbjct: 64  NSQFLFKNRKNNSQKLLQKQHPLCFINPEIKEKYGQ-EKHTEGCLSVSDFQAEIQRANHI 122

Query: 111 TVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
            V+ ++   +  I+ A GLLA C+QHE+DHL GILF+D+LS+LK+  + +++ K+ ++
Sbjct: 123 KVKALNEKGEIFILQATGLLAICIQHEIDHLKGILFVDYLSKLKQKRLLERIKKMTKV 180


>gi|78224736|ref|YP_386483.1| formylmethionine deformylase [Geobacter metallireducens GS-15]
 gi|78195991|gb|ABB33758.1| Formylmethionine deformylase [Geobacter metallireducens GS-15]
          Length = 168

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 103/166 (62%), Gaps = 6/166 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDG-IGLAAVQIGVLYRLV 59
           M  +P++ +P P+L++VS  +  I+ +I  LID++L+ M +  G +G+AA QIG   R+ 
Sbjct: 1   MPAQPILCYPHPVLKKVSHAVAVIDDEIRGLIDDLLDTMRAGPGSVGVAAPQIGATLRVC 60

Query: 60  VIDLQDHAHRKNP----MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
           V+D+    H K      +V +NP+I+   +  ++ +EGC+S+PDY  DV+R+  ITVR+ 
Sbjct: 61  VVDVSGSRHGKENNHGVLVMVNPEIV-HREGAAIMREGCMSVPDYTGDVERATTITVRFR 119

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK 161
           D     + I A G  A  +QHE+DHL+GILF+D +  LK  +  +K
Sbjct: 120 DGEGTEREISASGFEAVAIQHEMDHLDGILFLDRIVSLKTGLFRRK 165


>gi|110597712|ref|ZP_01385996.1| Peptide deformylase [Chlorobium ferrooxidans DSM 13031]
 gi|110340619|gb|EAT59099.1| Peptide deformylase [Chlorobium ferrooxidans DSM 13031]
          Length = 186

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/165 (41%), Positives = 104/165 (63%), Gaps = 3/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+ I+ D ILR+ ++P++ I+S I  LI +M E M + +GIGLAA Q+G   RL+V+DL 
Sbjct: 4   PINIYSDDILRQKAKPLKGIDSTIEALIASMFESMRNAEGIGLAAPQVGHSVRLLVLDLS 63

Query: 65  --DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
             D+   + PMV INP I+  S   +V +EGCLSIP    DV+R A I+++Y D +   +
Sbjct: 64  CIDNYANEKPMVVINPHILAVSG-CNVMEEGCLSIPGVNGDVERPAVISLKYRDEHFLER 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
                G+LA  LQHE+DHL+G LF+D + +  R  I K+++ +  
Sbjct: 123 TREFSGMLARALQHEIDHLDGTLFVDRMEKRSRKKIQKELTDIAS 167


>gi|261416784|ref|YP_003250467.1| peptide deformylase [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261373240|gb|ACX75985.1| peptide deformylase [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302325617|gb|ADL24818.1| peptide deformylase [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 179

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 95/166 (57%), Gaps = 3/166 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+ I+ DP+LR+   PI +I  ++  L  +MLE MY   G GLAA QIG   RLVVID  
Sbjct: 5   PIRIYGDPVLRKKCEPITEITPELRQLAKDMLETMYDAPGCGLAAPQIGKNIRLVVIDTA 64

Query: 65  -DHAHRKNPMVFINPKIITFSDDFSV-YQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
                   P +  NP+     D  +V Y EGCLS+P+   +V R   +TVR+ D N + Q
Sbjct: 65  IPDEEEPRPYIMFNPEWEAEPDAKNVDYDEGCLSLPEIFCNVVRPDRVTVRFFDINGEAQ 124

Query: 123 IIY-ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            I+  +GL A C+QHE DHLNG LF+D +S   R M   K+ K+ +
Sbjct: 125 EIHNCEGLFARCIQHECDHLNGDLFVDKISTSDRTMNQSKLRKMAK 170


>gi|282896056|ref|ZP_06304082.1| Polypeptide deformylase [Raphidiopsis brookii D9]
 gi|281198974|gb|EFA73849.1| Polypeptide deformylase [Raphidiopsis brookii D9]
          Length = 218

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/155 (44%), Positives = 99/155 (63%), Gaps = 4/155 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I KI+ ++  LI +ML+ MYS DGIGLAA Q+GV  +LVVID        
Sbjct: 52  DRVLRQPAKRITKIDDELRQLIRDMLQTMYSEDGIGLAAPQVGVNKQLVVIDCNPDKPEI 111

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP I   S +  V QEGCLSIP    +VKR   + + Y D   + Q + AD LL
Sbjct: 112 PPLVLINPVIKQVSSELCVAQEGCLSIPKVFLEVKRPKIVEIAYKDEYGRPQTLKADNLL 171

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDM-ITKKMSK 164
           A C+ HE+DHLNG++F+D   R++  + +T+++SK
Sbjct: 172 ARCILHEMDHLNGVVFVD---RVENSLSLTEELSK 203


>gi|333029959|ref|ZP_08458020.1| Peptide deformylase [Bacteroides coprosuis DSM 18011]
 gi|332740556|gb|EGJ71038.1| Peptide deformylase [Bacteroides coprosuis DSM 18011]
          Length = 186

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 97/168 (57%), Gaps = 5/168 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL- 63
           P+ ++  P+LR V++ I     ++  LI NM E M   DGIGLAA QIG+  RLVV+DL 
Sbjct: 4   PIYVYGQPVLREVAKDITPEYPNLKELIQNMFETMEHADGIGLAAPQIGLSIRLVVMDLD 63

Query: 64  ---QDHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
              +D    K    VFINP I     D     EGCLS+P    DV R   + V Y D N 
Sbjct: 64  VLSEDFPELKGFRKVFINPYIEEVDGDDITMGEGCLSLPGIGEDVTRPDVVYVTYQDENF 123

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           +      +G LA  +QHE DHL+GI+FIDH+S L++ MI  K++K+V+
Sbjct: 124 EKHTEKVEGYLARVMQHEFDHLDGIMFIDHISPLRKQMIRSKLNKMVK 171


>gi|295134935|ref|YP_003585611.1| peptide deformylase [Zunongwangia profunda SM-A87]
 gi|294982950|gb|ADF53415.1| peptide deformylase [Zunongwangia profunda SM-A87]
          Length = 196

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 97/173 (56%), Gaps = 12/173 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V + DP+L++ ++PI+K    +  LI NM + MY+  G+GLAA Q+GV  RL VID  
Sbjct: 4   PIVAYGDPVLKKKAKPIDKDYPKLEELISNMWDTMYNAYGVGLAAPQVGVPIRLFVIDAA 63

Query: 65  DHAH------------RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
             A             +    VFIN K+I  + D   + EGCLSIPD R D+ R   +T+
Sbjct: 64  PFAEDDDLTAEEKEYLKGFKRVFINAKVIEETGDEWAFSEGCLSIPDVREDIFRKPEVTI 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Y D N + +     GL A  +QHE DH  GILF + +S LK+ +I  ++ K+
Sbjct: 124 EYQDQNFETKKETFTGLAARVVQHEYDHTEGILFTEKISSLKKRLINGRLKKI 176


>gi|229522817|ref|ZP_04412231.1| peptide deformylase [Vibrio cholerae TM 11079-80]
 gi|229340034|gb|EEO05042.1| peptide deformylase [Vibrio cholerae TM 11079-80]
          Length = 168

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/165 (44%), Positives = 106/165 (64%), Gaps = 5/165 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP LR  S+ +  + S +  LID++L+ + +TD GIGLAA Q+G    +VVIDL 
Sbjct: 6   ILTAPDPRLRLQSKQVTDVAS-VQTLIDDLLDTLCATDNGIGLAAPQVGREEAIVVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           D+  R  P+V INPK+++ S+   + QEGCLS+PDY ADV+R   + V  +D   +   I
Sbjct: 65  DN--RDQPLVLINPKVVSGSNK-EMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
                LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+ R
Sbjct: 122 ETSDFLAIVMQHEIDHLSGNLFIDYLSPLKQQMAMKKVKKHVKNR 166


>gi|260887303|ref|ZP_05898566.1| peptide deformylase [Selenomonas sputigena ATCC 35185]
 gi|330838943|ref|YP_004413523.1| peptide deformylase [Selenomonas sputigena ATCC 35185]
 gi|260862939|gb|EEX77439.1| peptide deformylase [Selenomonas sputigena ATCC 35185]
 gi|329746707|gb|AEC00064.1| peptide deformylase [Selenomonas sputigena ATCC 35185]
          Length = 155

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 93/145 (64%), Gaps = 6/145 (4%)

Query: 12  PILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKN 71
           P+L+ +  P+E++++ +  L+D+M E MY  +GIG+AA Q+G   R+VVID+ D      
Sbjct: 12  PVLKEICAPVERVDARLRKLLDDMAETMYEANGIGIAAPQVGEALRMVVIDIGD-----G 66

Query: 72  PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLA 131
            +  +NPKI TF +      EGCLS+P    +V+R+A + V ++D   + + I A GLLA
Sbjct: 67  IIELVNPKI-TFREGSETDSEGCLSVPGIFGEVERAAKVKVEFLDRRGKRKHITAKGLLA 125

Query: 132 TCLQHELDHLNGILFIDHLSRLKRD 156
            C+QHELDHL G+LFID    L+++
Sbjct: 126 RCIQHELDHLEGVLFIDVAQSLRKE 150


>gi|78213784|ref|YP_382563.1| peptide deformylase [Synechococcus sp. CC9605]
 gi|123756848|sp|Q3AHC4|DEF_SYNSC RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|78198243|gb|ABB36008.1| Formylmethionine deformylase [Synechococcus sp. CC9605]
          Length = 201

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 88/141 (62%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ +R I K+N  +  L  +ML  MY+  GIGLAA Q+G+  +L+VIDL       
Sbjct: 38  DEVLRQPARRIGKVNEQVRELARDMLRSMYTAKGIGLAAPQVGIHQQLLVIDLDLENAAT 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I   S     Y+EGCLSIP    DV R   I + + D   + + + ADGL+
Sbjct: 98  PPLVLINPEITAASAGLDTYEEGCLSIPGVYLDVVRPTAIELSFRDEMGRPRKMKADGLM 157

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHLNG+LF+D ++
Sbjct: 158 ARCIQHEMDHLNGVLFVDRVT 178


>gi|113970479|ref|YP_734272.1| peptide deformylase [Shewanella sp. MR-4]
 gi|113885163|gb|ABI39215.1| peptide deformylase [Shewanella sp. MR-4]
          Length = 163

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 103/160 (64%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I + I   ID+++E MY TD GIGLA+ Q+G    ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIEA-IQGFIDDLIETMYHTDDGIGLASTQVGSTDAVIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  R  P+V INP+I+  S ++ V +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  EN--RDQPLVLINPEIVEKSGEY-VGEEGCLSIPGYRAKVSRFEKVKVTALDRQGKAIEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ETDDFLAIVLQHEIDHLHGKVFIEHLSALKQQIALKKVRK 161


>gi|114047714|ref|YP_738264.1| peptide deformylase [Shewanella sp. MR-7]
 gi|113889156|gb|ABI43207.1| peptide deformylase [Shewanella sp. MR-7]
          Length = 163

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 103/160 (64%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I + I   ID+++E MY TD GIGLA+ Q+G    ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIEA-IQGFIDDLIETMYHTDDGIGLASTQVGSTDAVIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  R  P+V INP+I+  S ++ V +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  EN--RDQPLVLINPEIVEKSGEY-VGEEGCLSIPGYRAKVSRFEKVKVTALDRQGKAIEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ETDDFLAIVLQHEIDHLHGKVFIEHLSTLKQQIALKKVRK 161


>gi|306840629|ref|ZP_07473381.1| peptide deformylase [Brucella sp. BO2]
 gi|306289367|gb|EFM60603.1| peptide deformylase [Brucella sp. BO2]
          Length = 164

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 3/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +V +PDP LR  + P+   + D+  L D++L+ M +  GIG+ A  IG+  R+VV
Sbjct: 1   MTVRLIVKYPDPRLRAAAEPVTTFDEDLRKLADDLLDTMRAAPGIGITAPHIGISKRVVV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ++L        P  +INP+I+   ++   +QEG +S+P    +V+R A I +RY D +  
Sbjct: 61  LELD---RTTGPKTYINPEIVWACEEKIRHQEGSVSMPGVVDEVERHARIRLRYQDLDGN 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Q   +DGLLA C QHE+D L+GI ++  LSRLKR+ + K+  KL
Sbjct: 118 EQTEESDGLLAVCHQHEIDQLDGIFWVQRLSRLKRERLIKRYEKL 162


>gi|71281182|ref|YP_267165.1| peptide deformylase [Colwellia psychrerythraea 34H]
 gi|71146922|gb|AAZ27395.1| polypeptide deformylase [Colwellia psychrerythraea 34H]
          Length = 166

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (63%), Gaps = 5/159 (3%)

Query: 10  PDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHAH 68
           P+  L   ++P+  + S I  LID+++E MY T DGIGLAA Q+G    +VVID+ D+  
Sbjct: 10  PNDKLIEQAKPVSDV-SQIQMLIDDLIETMYDTEDGIGLAATQVGRSEAVVVIDISDN-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           R   +V +NP +IT  +  +  QEGCLSIP Y ADV+R   +TV  +D N +   I +D 
Sbjct: 67  RDELLVLVNP-VITHGEATAKGQEGCLSIPGYYADVERFTHVTVEALDRNGKELTITSDE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            LA  +QHE+DHL G LFID+LS LK+ M  KK+ K ++
Sbjct: 126 FLAIVMQHEIDHLKGKLFIDYLSPLKQQMALKKVKKTIK 164


>gi|86133858|ref|ZP_01052440.1| polypeptide deformylase [Polaribacter sp. MED152]
 gi|85820721|gb|EAQ41868.1| polypeptide deformylase [Polaribacter sp. MED152]
          Length = 196

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 96/175 (54%), Gaps = 12/175 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+V + DP+LR++   I+K   ++  LI NM E MY+  G+GLAA QIG   RL VID  
Sbjct: 4   PIVAYGDPVLRKMGVEIDKDYPNLKELIANMKETMYNASGVGLAAPQIGKAIRLFVIDAS 63

Query: 65  DHAHRKNPM------------VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
             A   +              V+INPKII    +   + EGCLSIPD R DV R + +T+
Sbjct: 64  PFAEDDDLDDEERATLKDFNRVYINPKIIDEEGEEWTFNEGCLSIPDVREDVTRKSKVTL 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Y D +        DGL A   QHE DH+ G+LF D +S LK+ +I +K+  + +
Sbjct: 124 EYQDEDFNTHTEVLDGLAARVFQHEYDHIEGVLFTDKVSSLKKRLIKRKLENISK 178


>gi|123967617|ref|YP_001008475.1| peptide deformylase [Prochlorococcus marinus str. AS9601]
 gi|158513947|sp|A2BNK7|DEF_PROMS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123197727|gb|ABM69368.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           AS9601]
          Length = 201

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 97/154 (62%), Gaps = 2/154 (1%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ S+ I K++  I  L   ML+ MY+  GIGLAA QIG+   L+VID+       
Sbjct: 38  DDVLRQNSKRITKVDESIRKLAREMLQSMYAAKGIGLAAPQIGINKELLVIDVNFEDSAA 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP+I  F    + Y+EGCLSIP    +V R + I +++ D   + + + ADGLL
Sbjct: 98  EPLILINPEITDFGTTLNSYEEGCLSIPGVYLNVVRPSTIKLKFRDEMGRPRKMKADGLL 157

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A C+QHE+DHLNGILF+D ++   +D + K++ K
Sbjct: 158 ARCIQHEMDHLNGILFVDRVT--SKDDLNKELLK 189


>gi|320530181|ref|ZP_08031251.1| peptide deformylase [Selenomonas artemidis F0399]
 gi|320137614|gb|EFW29526.1| peptide deformylase [Selenomonas artemidis F0399]
          Length = 156

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 93/138 (67%), Gaps = 4/138 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+L++V+ PI+++      L+D+M E MY+++G+GLAA QIG   R+VVID++D     
Sbjct: 11  DPVLKQVAEPIDRLTKRHRQLLDDMAETMYASNGVGLAAPQIGKSIRMVVIDVEDE---H 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP +IT  +   V  EGCLS+P    DV+R+A +TV Y D  ++ + + A+GLL
Sbjct: 68  GLLELVNP-VITMREGSVVGSEGCLSVPKMFGDVERAARVTVEYTDRRSRRRSLTAEGLL 126

Query: 131 ATCLQHELDHLNGILFID 148
           A C+QHE DHL+G LFID
Sbjct: 127 ARCIQHECDHLDGRLFID 144


>gi|126695417|ref|YP_001090303.1| peptide deformylase [Prochlorococcus marinus str. MIT 9301]
 gi|126542460|gb|ABO16702.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           MIT 9301]
          Length = 201

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 97/154 (62%), Gaps = 2/154 (1%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ S+ I K++  I  L   ML+ MY+  GIGLAA QIG+   L+VID+       
Sbjct: 38  DDVLRQNSKRITKVDESIRKLAREMLQSMYAAKGIGLAAPQIGINKELLVIDVNFEDSAA 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP+I  F    + Y+EGCLSIP    +V R + I +++ D   + + + ADGLL
Sbjct: 98  EPLILINPEITDFGTTLNSYEEGCLSIPGVYLNVVRPSTIKLKFRDEMGRPRKMKADGLL 157

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A C+QHE+DHLNGILF+D ++   +D + K++ K
Sbjct: 158 ARCIQHEMDHLNGILFVDRVT--SKDDLNKELLK 189


>gi|308047745|ref|YP_003911311.1| peptide deformylase [Ferrimonas balearica DSM 9799]
 gi|307629935|gb|ADN74237.1| peptide deformylase [Ferrimonas balearica DSM 9799]
          Length = 171

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 97/168 (57%), Gaps = 3/168 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + ++ FPD  LR V+ P+      +  L+D+M + MY   GIGLAA QI    +++V
Sbjct: 1   MAVREVLRFPDERLRTVAEPVTDFGPALQQLVDDMFDTMYEERGIGLAATQINEHVQVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D  +   R  P VFINPKII     F+  +EGCLS+P   A V+R+  +     D    
Sbjct: 61  MDHSED--RSEPKVFINPKIIEEKGHFT-NEEGCLSVPGVYAKVERAEHVVFEAQDREGN 117

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
              + AD LL+ C+QHE+DHL G LF+D+LS LKR  I +K+ K  +L
Sbjct: 118 PFTVEADELLSICIQHEMDHLLGKLFVDYLSPLKRQRIKQKLEKQARL 165


>gi|255529965|ref|YP_003090337.1| peptide deformylase [Pedobacter heparinus DSM 2366]
 gi|255342949|gb|ACU02275.1| peptide deformylase [Pedobacter heparinus DSM 2366]
          Length = 186

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 96/163 (58%), Gaps = 2/163 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K P++ + DP+L++V  PIE+   D+  LI NM E MY+  G+GLAA Q+G+  RL ++
Sbjct: 1   MKLPIIAYGDPVLKKVCTPIEQTYPDLKQLISNMFETMYNAHGVGLAAPQVGLPIRLFIV 60

Query: 62  DLQDHAHRKNPM--VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           D       KN    VFIN +I+  + +   + EGCLSIPD R DV R   I ++Y D + 
Sbjct: 61  DTGADEGDKNKFKKVFINAEILEETGEPWAFNEGCLSIPDIREDVMRKPNIRIKYYDEHW 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
           +       G+ A  +QHE DH+ G LF D LS L++ M+  K+
Sbjct: 121 ELHEEEVSGMPARVIQHEYDHIEGKLFTDTLSLLRKTMLKSKL 163


>gi|241608057|ref|XP_002405931.1| polypeptide deformylase, putative [Ixodes scapularis]
 gi|215500709|gb|EEC10203.1| polypeptide deformylase, putative [Ixodes scapularis]
          Length = 164

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 101/156 (64%), Gaps = 1/156 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V  P+ I ++ +  I+ ++ +I  ++D +L+ ++    +GL A  +G+L R+ V+DL +
Sbjct: 10  IVYAPNDIFKKQAEYIDIVDDNIRTIVDKILQTLHIERAVGLGANMVGILKRIAVVDLHE 69

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           + ++ + + FINP+I  FS++   + EG LS P   A + RS  I V+Y+D N   Q + 
Sbjct: 70  N-NKSSTIAFINPEITYFSEEKQTFIEGSLSFPGIEASITRSKAIKVKYLDYNGNKQELA 128

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKK 161
           A+G LAT +QHE+D+LNG  F+D+LS+LKRD + KK
Sbjct: 129 AEGFLATVIQHEIDYLNGKTFLDYLSKLKRDTLLKK 164


>gi|148240477|ref|YP_001225864.1| peptide deformylase [Synechococcus sp. WH 7803]
 gi|147849016|emb|CAK24567.1| Peptide deformylase [Synechococcus sp. WH 7803]
          Length = 201

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 94/156 (60%), Gaps = 7/156 (4%)

Query: 3   KKPLVIFP-------DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVL 55
           K+PL   P       D +LR  +R I K++  + +L  +ML  MY+  GIGLAA Q+GV 
Sbjct: 23  KEPLDTAPLQIHTLGDDVLRLDARRIGKVDETVRDLARDMLRSMYTARGIGLAAPQVGVH 82

Query: 56  YRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
            +L+VIDL        P+V INP+I + S     Y+EGCLSIP    DV R + + V + 
Sbjct: 83  QQLLVIDLDPETASSPPLVLINPEITSASASLETYEEGCLSIPGVYLDVVRPSAVQVSFR 142

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           D   + + + ADGL+A C+QHE+DHL G+LF+D ++
Sbjct: 143 DEMGRPRTMKADGLMARCIQHEMDHLTGVLFVDRVT 178


>gi|52426256|ref|YP_089393.1| peptide deformylase [Mannheimia succiniciproducens MBEL55E]
 gi|81691285|sp|Q65QF2|DEF_MANSM RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|52308308|gb|AAU38808.1| Def protein [Mannheimia succiniciproducens MBEL55E]
          Length = 171

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 102/160 (63%), Gaps = 3/160 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++I+PD  L+ ++ P+ + N ++   ID+M E MY  +GIGLAA Q+ V  R++ ID+  
Sbjct: 6   VLIYPDERLKTIAEPVTEFNDELQTFIDDMFETMYQEEGIGLAATQVDVHKRVITIDIT- 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              +   +V INP+++    +  + +  CLS+P  R  V R   +TV+ ++   +   ++
Sbjct: 65  -GEKTEQLVLINPELLDGEGETGIEEG-CLSLPGLRGFVPRKEKVTVKALNRQGEEFTLH 122

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           ADGLLA C+QHE+DHLNGI+F D+LS LKR+ + +K+ KL
Sbjct: 123 ADGLLAICIQHEIDHLNGIVFADYLSPLKRNRMKEKLVKL 162


>gi|295696040|ref|YP_003589278.1| peptide deformylase [Bacillus tusciae DSM 2912]
 gi|295411642|gb|ADG06134.1| peptide deformylase [Bacillus tusciae DSM 2912]
          Length = 155

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 93/141 (65%), Gaps = 6/141 (4%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR  ++P+ K+  +I  LID+M + MY+ DGIGLAA Q+G+L R++V D+ +     
Sbjct: 11  DPILREKAKPVSKVTPNIQRLIDDMADTMYNADGIGLAAPQVGILKRVIVADIGEGL--- 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP+++   +      EGCLSIP  +ADV R+  + VR  D N +  ++ A+GLL
Sbjct: 68  --LGLVNPEVV-LEEGEQTGPEGCLSIPGIQADVTRAHHVIVRAQDRNGEPLVVDAEGLL 124

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A CL HE+DHL+GILF+D ++
Sbjct: 125 ARCLLHEIDHLDGILFLDRVT 145


>gi|303233239|ref|ZP_07319911.1| peptide deformylase [Atopobium vaginae PB189-T1-4]
 gi|302480629|gb|EFL43717.1| peptide deformylase [Atopobium vaginae PB189-T1-4]
          Length = 183

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 89/154 (57%), Gaps = 2/154 (1%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           K +V FP PIL+ V  P++ I SDI  L  +ML+VMY+TDG GLAA QIG   RLVVID+
Sbjct: 8   KEMVCFPSPILQTVCTPVKHITSDIKELAHHMLDVMYATDGCGLAAPQIGETIRLVVIDV 67

Query: 64  -QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
                  KNP V +NP I+T      +  EGCLS P     V R + +     + + +  
Sbjct: 68  DWSSTSAKNPYVLVNPTIVTADGKDRLMPEGCLSYPGIMVGVTRPSHVICEAYNLDGECM 127

Query: 123 IIYADG-LLATCLQHELDHLNGILFIDHLSRLKR 155
              A G L+A CLQHE DH+NGI   DHL  L++
Sbjct: 128 RYEATGNLMAACLQHECDHINGITIPDHLPPLEK 161


>gi|313673898|ref|YP_004052009.1| peptide deformylase [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940654|gb|ADR19846.1| peptide deformylase [Calditerrivibrio nitroreducens DSM 19672]
          Length = 167

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 97/157 (61%), Gaps = 5/157 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PDP LR   +P++K + ++  ++++M E MY+  G+GLAA Q+G+  RL +ID+   + 
Sbjct: 8   YPDPRLRVKCKPVDKFDEELKKIVNDMAETMYNAPGVGLAAPQVGIDKRLFIIDI---SK 64

Query: 69  RKNPM-VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            KN + VFINP I+    +    +EGCLS+P   A+V R+  +     D N    II AD
Sbjct: 65  EKNDLKVFINPTILKKEGEI-CDEEGCLSVPGEYANVTRAEVVEAVAQDINGNEFIIKAD 123

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           GL+A  +QHELDHLNG LF+D L   KR+ + K + +
Sbjct: 124 GLMARAIQHELDHLNGTLFLDRLPAFKRESVKKHIKR 160


>gi|227484652|ref|ZP_03914968.1| peptide deformylase [Anaerococcus lactolyticus ATCC 51172]
 gi|227237372|gb|EEI87387.1| peptide deformylase [Anaerococcus lactolyticus ATCC 51172]
          Length = 161

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 91/138 (65%), Gaps = 3/138 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPILR++SRP+E +   I  L+D+M E MY+ DG+GLAA Q+G L R++V+D +D     
Sbjct: 11  DPILRKISRPVEDVTDRIRILLDDMAETMYAADGVGLAAPQVGNLRRVIVVDPRD--GED 68

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
           + +  +NP+I+   D   +  EGCLSIPD+ A VKR   + V+Y+D N + +I  A G  
Sbjct: 69  SLVKLVNPEILEM-DGEQIGVEGCLSIPDFNATVKRPEHVKVKYLDENGEEKIWDAHGFP 127

Query: 131 ATCLQHELDHLNGILFID 148
           A  L HE+DHLNGILF D
Sbjct: 128 AVILCHEIDHLNGILFKD 145


>gi|304316976|ref|YP_003852121.1| peptide deformylase [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302778478|gb|ADL69037.1| peptide deformylase [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 159

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 6/143 (4%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DPIL + ++ +EKI+  I+ ++D+M E MYS DG+GLAA QIG+L RLVV+D+ D     
Sbjct: 11  DPILYKKAKHVEKIDDHILMILDDMAETMYSADGVGLAANQIGILRRLVVVDVGD----- 65

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  INP+II   +   + QEGCLS+P+  A+VKR   I V+Y D N   + I  +  L
Sbjct: 66  GLIELINPEII-LEEGEQIGQEGCLSVPNVTAEVKRPKKIKVKYQDRNGDIREIEGEDFL 124

Query: 131 ATCLQHELDHLNGILFIDHLSRL 153
           A  L HE+DHLNG+LF+D   R+
Sbjct: 125 ARALSHEIDHLNGVLFVDKAIRI 147


>gi|194334376|ref|YP_002016236.1| peptide deformylase [Prosthecochloris aestuarii DSM 271]
 gi|238693348|sp|B4S9B9|DEF_PROA2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|194312194|gb|ACF46589.1| peptide deformylase [Prosthecochloris aestuarii DSM 271]
          Length = 186

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 101/164 (61%), Gaps = 3/164 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P+ I+ D +LRR ++P++ I++    LI NM+E M +  GIGLAA QIG+  RL+++DL 
Sbjct: 4   PITIYSDEVLRRKAKPLKGIDTSHEELIGNMIESMRNASGIGLAAPQIGLSMRLLIVDLS 63

Query: 65  DHAHRKN--PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
                +N  PMV INP I+     ++  +EGCLSIPD  ADV R + I ++Y + + + +
Sbjct: 64  PVQGYENAEPMVVINPHILAVKG-YNAMEEGCLSIPDIHADVVRPSSIQLKYRNEHFEER 122

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV 166
           +     L+A  LQHE+DHL+G LF+D L R  R  + K +  + 
Sbjct: 123 VDEFSALMARVLQHEIDHLDGTLFVDKLQRRDRRKVQKSLEDIA 166


>gi|124024845|ref|YP_001013961.1| peptide deformylase [Prochlorococcus marinus str. NATL1A]
 gi|158512738|sp|A2BZN6|DEF_PROM1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|123959913|gb|ABM74696.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           NATL1A]
          Length = 202

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 93/149 (62%), Gaps = 2/149 (1%)

Query: 5   PLVIFP--DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL ++   D  LR  +  I K++  I  L  +ML  MYS+ GIGLAA Q+G+  RL+VID
Sbjct: 30  PLKVYQLGDEALRTPANRIVKVDDAIRKLAKDMLITMYSSKGIGLAAPQVGIQKRLLVID 89

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           L        PMVFINP+II+ S     Y+EGCLSIP    +V R + I + Y D   + +
Sbjct: 90  LNFEDPNSPPMVFINPEIISSSATVDTYEEGCLSIPGVYLNVLRPSSIKLSYRDEMGRPK 149

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLS 151
            + ADGL+A C+QHE+DHLNG+ F+D ++
Sbjct: 150 KMNADGLMARCIQHEIDHLNGVCFVDKVT 178


>gi|117920762|ref|YP_869954.1| peptide deformylase [Shewanella sp. ANA-3]
 gi|117613094|gb|ABK48548.1| peptide deformylase [Shewanella sp. ANA-3]
          Length = 163

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 102/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I + I   ID+++E MY TD GIGLA+ Q+G    ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIEA-IQGFIDDLIETMYHTDDGIGLASTQVGSTDAVIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I+  S ++ V +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  ET--RDQPLVLINPEIVEKSGEY-VGEEGCLSIPGYRAKVTRFEKVKVTALDRQGKAIEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ETDDFLAIVLQHEIDHLHGKVFIEHLSALKQQIALKKVRK 161


>gi|32491245|ref|NP_871499.1| hypothetical protein WGLp496 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|30172741|sp|Q8D258|DEF_WIGBR RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|25166452|dbj|BAC24642.1| def [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 152

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (65%), Gaps = 3/146 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +P+  LR+++  I  I+S+I +LI NMLE MY  +GIGLAA Q+ V  R++VID+  + +
Sbjct: 9   YPNKKLRKIASNISLIDSEIKSLIKNMLETMYFNEGIGLAATQVDVHKRIIVIDISKNKN 68

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P++ INP  I        ++EGCLSIP   A V RS  + ++ ++C  +  ++ + G
Sbjct: 69  K--PLILINPVFINKCGA-QTFEEGCLSIPKKTAFVNRSKKVKIKAINCLGEEFLLKSKG 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLK 154
           LLATC+QHE+DHL G LFID++  LK
Sbjct: 126 LLATCIQHEMDHLIGKLFIDYIKPLK 151


>gi|87125300|ref|ZP_01081146.1| putative formylmethionine deformylase [Synechococcus sp. RS9917]
 gi|86167069|gb|EAQ68330.1| putative formylmethionine deformylase [Synechococcus sp. RS9917]
          Length = 201

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 7/158 (4%)

Query: 1   MVKKPLVIFP-------DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIG 53
           + K+PL + P       D +LR+ ++ I K+++ + +L  +ML  MY+  GIGLAA Q+G
Sbjct: 21  VTKEPLDVPPLEIHTLGDRVLRQPAKRISKVDAAVRDLARDMLRSMYTARGIGLAAPQVG 80

Query: 54  VLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVR 113
           V  +L+VIDL        P+V INP+I + S     Y+EGCLSIP    DV R + I + 
Sbjct: 81  VHKQLLVIDLDIENAAAPPLVLINPEITSASASVDTYEEGCLSIPGVYLDVVRPSAIQLS 140

Query: 114 YMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           Y D   + + + ADGL+A C+QHE+DHL G+LF+D ++
Sbjct: 141 YRDEMGRPRTMKADGLMARCIQHEMDHLKGVLFVDRVT 178


>gi|78778455|ref|YP_396567.1| peptide deformylase [Prochlorococcus marinus str. MIT 9312]
 gi|123727935|sp|Q31DB4|DEF_PROM9 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|78711954|gb|ABB49131.1| peptide deformylase [Prochlorococcus marinus str. MIT 9312]
          Length = 201

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 96/151 (63%), Gaps = 3/151 (1%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ S+ I K++  I  L   M++ MY+  GIGLAA QIG+   L+VID+       
Sbjct: 38  DDVLRQNSKRITKVDESIRKLTREMIQSMYAAKGIGLAAPQIGINKELLVIDVNFEDSAA 97

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP+I  +    + Y+EGCLSIP    +V R + I +++ D   + + + ADGLL
Sbjct: 98  EPLILINPEITDYGTTLNSYEEGCLSIPGVYLNVVRPSTIKLKFRDEMGRPRKMKADGLL 157

Query: 131 ATCLQHELDHLNGILFIDHLSR---LKRDMI 158
           A C+QHE+DHLNGILF+D ++    LK+++I
Sbjct: 158 ARCIQHEMDHLNGILFVDRVTSKDDLKKELI 188


>gi|242309635|ref|ZP_04808790.1| peptide deformylase [Helicobacter pullorum MIT 98-5489]
 gi|239523636|gb|EEQ63502.1| peptide deformylase [Helicobacter pullorum MIT 98-5489]
          Length = 169

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 106/162 (65%), Gaps = 4/162 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI---D 62
           ++ +P+P+LR++S+PIE  +  +  L+D M E M + +G+G++A+Q+    R ++I   D
Sbjct: 5   VITYPNPLLRQISKPIENFDESLHQLLDAMYETMLNKNGVGISAIQVAKPIRALLICLPD 64

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
            + + H++N +  INP+II  + +  ++ EGCLS+P++  +VKR + + + Y +   ++ 
Sbjct: 65  EEGNQHKENLLEIINPEIIEKNGEI-LFNEGCLSVPEFYEEVKRYSSLKIHYQNRYGENL 123

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            + A+  LA  LQHE+DHLNGILFID LS +KR    K++ +
Sbjct: 124 QLEANDYLAVALQHEIDHLNGILFIDKLSIIKRKKFEKELKQ 165


>gi|91225452|ref|ZP_01260574.1| peptide deformylase [Vibrio alginolyticus 12G01]
 gi|91189815|gb|EAS76088.1| peptide deformylase [Vibrio alginolyticus 12G01]
          Length = 168

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 105/160 (65%), Gaps = 5/160 (3%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQDHA 67
            PDP L+  +  +  + S I  LID+MLE +Y+T +GIGLA+ Q+G    +VVID+ D  
Sbjct: 9   IPDPRLKVKAEKVTDV-STIQTLIDDMLETLYATGNGIGLASTQVGRKEAVVVIDISDE- 66

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
            R +P++ +NP++++  ++ ++ QEGCLS+P+Y ADV+R   + V  +D +     I + 
Sbjct: 67  -RNDPLILVNPEVVS-GENKALGQEGCLSVPEYYADVERYTSVVVSALDRDGNPITIESG 124

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             LA  +QHE+DHL+G LFID+LS LK+ M  KK+ K V+
Sbjct: 125 EFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVKKYVK 164


>gi|24374073|ref|NP_718116.1| peptide deformylase [Shewanella oneidensis MR-1]
 gi|32363156|sp|Q8EE60|DEF3_SHEON RecName: Full=Peptide deformylase 3; Short=PDF 3; AltName:
           Full=Polypeptide deformylase 3
 gi|24348554|gb|AAN55560.1|AE015695_2 polypeptide deformylase [Shewanella oneidensis MR-1]
          Length = 163

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 102/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PD  L+R ++P++ I + I   ID+++E MY TD GIGLA+ Q+G    ++VIDL 
Sbjct: 6   ILTIPDERLKRKAQPVKDIEA-IQGFIDDLIETMYHTDDGIGLASTQVGSTDAVIVIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V +NP+I+  S ++ V +EGCLSIP YRA V R   + V  +D   +   I
Sbjct: 65  ET--RDQPLVLVNPEIVEKSGEY-VGEEGCLSIPGYRAKVTRFEKVKVTALDRQGKAIEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             D  LA  LQHE+DHL+G +FI+HLS LK+ +  KK+ K
Sbjct: 122 ETDDFLAIVLQHEIDHLHGKVFIEHLSTLKQQIALKKVRK 161


>gi|325972108|ref|YP_004248299.1| peptide deformylase [Spirochaeta sp. Buddy]
 gi|324027346|gb|ADY14105.1| Peptide deformylase [Spirochaeta sp. Buddy]
          Length = 167

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 94/158 (59%), Gaps = 4/158 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +L    +P+ K +S +  L+D M E M   DG+GLAA Q+GV  RL VI +Q   +R 
Sbjct: 9   DEVLTEKCQPVTKFDSALRILVDAMFETMAEADGVGLAAPQVGVNSRLFVIHIQGSENR- 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
               +INP+II  S +    +EGCLSIP    DV+R A +TV+  D   +   + A+GLL
Sbjct: 68  ---AYINPQIIETSIETDTSEEGCLSIPGVWHDVQRPARVTVQAQDVEGKVFTVKAEGLL 124

Query: 131 ATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQL 168
           A  +QHE DHLNG+LFID L+  +R+ + K   K  +L
Sbjct: 125 ARAIQHEYDHLNGVLFIDRLNDEEREKMVKAYEKRAKL 162


>gi|255657698|ref|ZP_05403107.1| peptide deformylase [Mitsuokella multacida DSM 20544]
 gi|260849886|gb|EEX69893.1| peptide deformylase [Mitsuokella multacida DSM 20544]
          Length = 155

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 4/144 (2%)

Query: 12  PILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKN 71
           P+L+ V  P+EKI+ D+  L+D+M   MY +DG+GLAA Q+G   R+VVID QD      
Sbjct: 12  PVLKEVCAPVEKIDKDLRKLLDDMAVTMYESDGVGLAAPQVGRPIRVVVIDCQDD---HG 68

Query: 72  PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLA 131
            +  INP +ITF +  +   EGCLS+P    +V+R+A + V +++   + Q + A GLLA
Sbjct: 69  LIELINP-VITFREGTATDTEGCLSVPGIYGEVERAAKVKVEFLNRRGKKQHLTATGLLA 127

Query: 132 TCLQHELDHLNGILFIDHLSRLKR 155
            C+QHELDHL G LFID    L R
Sbjct: 128 RCIQHELDHLEGQLFIDIAKSLHR 151


>gi|86604850|ref|YP_473613.1| peptide deformylase [Synechococcus sp. JA-3-3Ab]
 gi|86553392|gb|ABC98350.1| peptide deformylase [Synechococcus sp. JA-3-3Ab]
          Length = 198

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 89/141 (63%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ + ++N +I  L  +ML+ MYS DGIGLAA Q+G+  RL+V+DL       
Sbjct: 24  DKVLRQPAKRVSQVNDEIRQLARHMLQTMYSADGIGLAAPQVGIPKRLIVVDLYPDKPEV 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I  +  +    QEGCLSIP    +V R   + V + D   + + + AD LL
Sbjct: 84  PPLVLINPEIREYLGEVVAGQEGCLSIPGVFCEVMRPQGVVVSFKDETGRPRTLQADDLL 143

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A  +QHE+DHLNG+LF+DH+ 
Sbjct: 144 ARVIQHEIDHLNGVLFVDHVE 164


>gi|94264678|ref|ZP_01288460.1| Peptide deformylase [delta proteobacterium MLMS-1]
 gi|93454909|gb|EAT05153.1| Peptide deformylase [delta proteobacterium MLMS-1]
          Length = 263

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 106/184 (57%), Gaps = 19/184 (10%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P+V FP+  L+  +RP+ + +  +  L+ +M+  M+   G+GLAA Q+GV  ++VV
Sbjct: 72  MAIRPVVKFPEASLKSKARPVTEFDDSLRELVADMIATMHDAPGVGLAAPQVGVPLQVVV 131

Query: 61  I----------DLQDH-------AHRKNP-MVFINPKIITFSDDFSVYQEGCLSIPDYRA 102
           I          D +D        A  +NP +V INP+++    +  V +EGCLS+ DY +
Sbjct: 132 ILGRVARPELADGEDEQQPPAAVAEERNPSLVLINPRLVEGQGE-EVDEEGCLSVRDYSS 190

Query: 103 DVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
            VKR A + V  +D + Q   I A+G  A  LQHE+DHL G LFID LS LKR +  KK+
Sbjct: 191 KVKRYARVRVTALDLDGQPLEIEAEGFFARVLQHEIDHLEGTLFIDRLSSLKRALYRKKL 250

Query: 163 SKLV 166
            K++
Sbjct: 251 KKII 254


>gi|126640269|ref|YP_001083253.1| Zinc(II) binding peptide deformylase 1 [Acinetobacter baumannii
           ATCC 17978]
          Length = 142

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 88/136 (64%), Gaps = 2/136 (1%)

Query: 35  MLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGC 94
           M E MY+  GIGLAA Q+    +L+V+DL +   +  PMVFINPK+   +++   Y+EGC
Sbjct: 1   MFETMYAAPGIGLAASQVDRHIQLIVMDLSES--KDEPMVFINPKVTPLTEETQPYEEGC 58

Query: 95  LSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLK 154
           LS+P     V R + + +  ++   Q   I ADGLLA C+QHE+DHLNG LF+D+LS LK
Sbjct: 59  LSVPQIYDKVDRPSRVKIEAINLEGQAFEIEADGLLAVCIQHEMDHLNGKLFVDYLSPLK 118

Query: 155 RDMITKKMSKLVQLRD 170
           R    +K+ K+V+ R+
Sbjct: 119 RQRAREKVEKIVRQRE 134


>gi|148241454|ref|YP_001226611.1| peptide deformylase [Synechococcus sp. RCC307]
 gi|166198524|sp|A5GQU9|DEF_SYNR3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|147849764|emb|CAK27258.1| Peptide deformylase [Synechococcus sp. RCC307]
          Length = 201

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 86/138 (62%)

Query: 14  LRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPM 73
           LR+ ++ I K+N  +  L   ML  MY+  GIGLAA Q+GV  +L+VIDL        P+
Sbjct: 41  LRKPAKRISKVNEQVRELAREMLRSMYAAHGIGLAAPQVGVHQQLLVIDLDPEEAANPPL 100

Query: 74  VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATC 133
           V INP+I+  S     Y+EGCLSIP    +V R + + V+Y D   + Q   ADGL+A C
Sbjct: 101 VLINPEIVATSGALDTYEEGCLSIPGVYLNVVRPSQVDVKYRDELGRPQRRKADGLMARC 160

Query: 134 LQHELDHLNGILFIDHLS 151
           + HE+DHLNG+LF+D +S
Sbjct: 161 ILHEMDHLNGVLFVDRVS 178


>gi|148270260|ref|YP_001244720.1| peptide deformylase [Thermotoga petrophila RKU-1]
 gi|166198525|sp|A5ILS1|DEF_THEP1 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|147735804|gb|ABQ47144.1| peptide deformylase [Thermotoga petrophila RKU-1]
          Length = 164

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 94/155 (60%), Gaps = 5/155 (3%)

Query: 8   IFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA 67
           +F DP+LR+ ++P+ K + ++   I+ M+E MY  DG+GLAA Q+G+  R  V+D+ +  
Sbjct: 6   VFGDPVLRKRAKPVTKFDDNLEKTIERMIETMYHYDGVGLAAPQVGISQRFFVMDVGN-- 63

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
               P+  INP+I+    +  V +EGCLS P+   +++RS  I VRY +   ++     +
Sbjct: 64  ---GPVAVINPEILEIDPETEVAEEGCLSFPEIFVEIERSKRIKVRYQNTKGEYVEEVLE 120

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
           G  A   QHE DHLNG+L ID +S  KR ++ KK+
Sbjct: 121 GYAARVFQHEFDHLNGVLIIDRISPAKRLLLRKKL 155


>gi|149278151|ref|ZP_01884289.1| peptide deformylase [Pedobacter sp. BAL39]
 gi|149230917|gb|EDM36298.1| peptide deformylase [Pedobacter sp. BAL39]
          Length = 184

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 96/162 (59%), Gaps = 1/162 (0%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K P+V + DP+L++V  PIE+   ++  LI NM E MY+  G+GLAA QIG+  RL VI
Sbjct: 1   MKLPIVAYGDPVLKKVCAPIEQDYPELKQLISNMFETMYNAHGVGLAAPQIGLPIRLFVI 60

Query: 62  DLQ-DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           D   D        V+IN +I+  + +   + EGCLSIPD R DV R   I +RY D N +
Sbjct: 61  DTGGDEDEDGVKRVYINAEILEENGEPWAFNEGCLSIPDIREDVMRKPNIRIRYYDENWE 120

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
                  G+LA  +QHE DH+ G LF + LS L++ M+  K+
Sbjct: 121 LHEKEVTGMLARVIQHEYDHIQGKLFTETLSLLRKRMLQSKL 162


>gi|326798583|ref|YP_004316402.1| peptide deformylase [Sphingobacterium sp. 21]
 gi|326549347|gb|ADZ77732.1| Peptide deformylase [Sphingobacterium sp. 21]
          Length = 190

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 100/173 (57%), Gaps = 8/173 (4%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
           +K P+V + DP+L+R +  I+K   ++ NLI NM E MY+  G+G+AA Q+G+  RL V+
Sbjct: 1   MKLPIVAYGDPVLKRKAIDIDKDYPELENLIANMFETMYAAHGVGIAAPQVGLSIRLFVV 60

Query: 62  DLQDHAHRKNP------MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
           D    A    P       VFIN  I     +   + EGCLSIPD R DV R + I +RY 
Sbjct: 61  DASPFAEDDAPELKDFKKVFINAHIEEEEGEKWEFNEGCLSIPDIREDVSRHSIIHIRYF 120

Query: 116 DCN-AQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           D N  +H+  Y DGL A  +QHE DH+ G LF D LS L++ M+  K+  + +
Sbjct: 121 DENWVEHREKY-DGLAARVIQHEYDHIEGKLFTDRLSVLRKAMLKSKLDAISK 172


>gi|117621144|ref|YP_856896.1| peptide deformylase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117562551|gb|ABK39499.1| peptide deformylase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 166

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 101/160 (63%), Gaps = 5/160 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP L   +  +E I + +  LID+MLE +Y+TD GIGLAA Q+G    +V+IDL 
Sbjct: 6   ILTVPDPRLGIKAEQVEDIAA-VQGLIDDMLETLYATDNGIGLAATQVGRKEAIVIIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP++ T   + ++ QEGCLS+PDY ADV+R   + V  +D +     +
Sbjct: 65  EK--RDQPLVLINPQV-TSGTEPALGQEGCLSVPDYYADVERYGSVVVSALDRHGVPITV 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            +   LA  +QHE+DHL G +FID+LS LKR M  KK+ K
Sbjct: 122 KSSDFLAIVMQHEIDHLQGKVFIDYLSPLKRKMALKKVKK 161


>gi|116621863|ref|YP_824019.1| peptide deformylase [Candidatus Solibacter usitatus Ellin6076]
 gi|116225025|gb|ABJ83734.1| peptide deformylase [Candidatus Solibacter usitatus Ellin6076]
          Length = 171

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 101/167 (60%), Gaps = 2/167 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINS-DIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           P+V F DP+L R +  + + ++ ++   +D+M E MY+  G+GLAA QIGV  ++ VID+
Sbjct: 4   PIVKFGDPVLEREADTVTEFDTPELHKFLDDMFESMYAAKGVGLAAPQIGVSKKIAVIDV 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            +  +  + +V INPKI+   D     +EGCLSIP +R  V+R+  +T+R  +   +   
Sbjct: 64  SNGENADDKLVIINPKILKI-DGKQEGEEGCLSIPGFREQVRRARCVTIRAQNAKGEEFE 122

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
              + LLA    HE DHL G L+I H+S LKRD++ +K+ KL +  D
Sbjct: 123 KTGEDLLARAFLHETDHLYGRLYITHISALKRDLMKRKIKKLQRAGD 169


>gi|254409726|ref|ZP_05023507.1| peptide deformylase [Microcoleus chthonoplastes PCC 7420]
 gi|196183723|gb|EDX78706.1| peptide deformylase [Microcoleus chthonoplastes PCC 7420]
          Length = 190

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 86/141 (60%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ + K++  I  L   ML+ MYS DGIGLAA Q+GV  +++VID +      
Sbjct: 26  DRVLRQPAKRVAKVDQSIRQLAHQMLQTMYSADGIGLAAPQVGVNKQIIVIDCEPDNPEN 85

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP I  F       QEGCLS+P    DVKR   + V Y D N + Q + ADGLL
Sbjct: 86  PPLILINPTIKRFGQSICDAQEGCLSVPGVYLDVKRPVEVEVAYKDENGRPQRLKADGLL 145

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           +  +QHE+DHL G++F+D + 
Sbjct: 146 SRAIQHEMDHLTGVMFVDRVE 166


>gi|51244598|ref|YP_064482.1| peptide deformylase [Desulfotalea psychrophila LSv54]
 gi|81692939|sp|Q6AQ98|DEF_DESPS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|50875635|emb|CAG35475.1| probable peptide deformylase [Desulfotalea psychrophila LSv54]
          Length = 169

 Score =  127 bits (318), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 95/161 (59%), Gaps = 2/161 (1%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +  +PDP+LR+ +  I   +  ++ L ++M E MY   GIGLAA QIG   +LVV+    
Sbjct: 6   ICTYPDPVLRKETVAITVFDEKLVKLTEDMAETMYDAPGIGLAAPQIGESLKLVVVSTAR 65

Query: 66  HAHRKNP-MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
               K   MV  NP+I+   ++  V +EGCLS+P+  A VKR   I V Y D N +   +
Sbjct: 66  REDSKQEYMVMANPEIVE-KEESQVDEEGCLSVPELLAMVKRYRKIKVNYQDINGEPCSM 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
             +   A  LQHE+DHLNGILF+DHLS LKR++  KK+ K 
Sbjct: 125 TVEDRFAVVLQHEIDHLNGILFLDHLSSLKRNLYKKKVKKW 165


>gi|85700137|gb|ABC74518.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 103/160 (64%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+MLE M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDAKLHQQLDDMLETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETGGSM-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|220903297|ref|YP_002478609.1| peptide deformylase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867596|gb|ACL47931.1| peptide deformylase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 172

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (58%), Gaps = 1/163 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +PDP L+ V  P+ ++  +I  L  +MLE MY   G+GLAA Q+G   R++V+D   
Sbjct: 5   IVTYPDPRLKEVCEPVAEVTDEIRQLAADMLETMYEAPGVGLAAPQVGRNIRMLVMDPSA 64

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIP-DYRADVKRSAFITVRYMDCNAQHQII 124
               +NP V INP +    ++    QEGCLS+P +YRADVKR + + +   D +      
Sbjct: 65  QKDERNPRVLINPVLTLSGEEIISEQEGCLSVPMNYRADVKRMSRVHLSATDLDGNAIEE 124

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             +   A  +QHE DHL+GILFID +SRL+R +   K+ K ++
Sbjct: 125 DLEDFDAIVMQHEYDHLDGILFIDKVSRLRRSLYDSKVKKWLK 167


>gi|152991610|ref|YP_001357331.1| peptide deformylase [Sulfurovum sp. NBC37-1]
 gi|151423471|dbj|BAF70974.1| formylmethionine deformylase [Sulfurovum sp. NBC37-1]
          Length = 174

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 104/168 (61%), Gaps = 8/168 (4%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + +VI+PD  L+++SR +   +  + +L+D+M E M + +G+GLAA+Q+GV  R ++I++
Sbjct: 3   REIVIYPDKRLKQISREVGSFDGALHDLLDDMYETMIARNGVGLAAIQVGVDLRALIINV 62

Query: 64  ----QDHAH---RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMD 116
               ++  H   ++N +  INP I+   D    +QEGCLS+P    DV+R+  + V Y D
Sbjct: 63  PLEKEEGEHDQPKENTLEMINPVIVEM-DGKEKFQEGCLSVPGVYEDVERAKHVKVEYYD 121

Query: 117 CNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            N +  II  D  LA  +QHE+DHL+G +FI+ LS LKR    K+ +K
Sbjct: 122 RNGEKHIIEDDDFLAIAMQHEIDHLDGKVFIEKLSFLKRKKFEKEWAK 169


>gi|160872447|ref|ZP_02062579.1| peptide deformylase [Rickettsiella grylli]
 gi|159121246|gb|EDP46584.1| peptide deformylase [Rickettsiella grylli]
          Length = 168

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 103/165 (62%), Gaps = 3/165 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++  PD  LR  +  I   ++ +  LID+M E MY+  GIGLAA QI +  +L VID+ 
Sbjct: 5   PIIQLPDVRLRVPTTSITVFDATLQQLIDDMFETMYAAKGIGLAAPQIAISKKLAVIDVT 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           ++  + + +  INP I+    + ++ +EGCLS+P       R+ ++ ++ +D N +   I
Sbjct: 65  NN--KSHTLCLINPTIVEKKGE-ALLEEGCLSVPGIYDKAPRALWVKLQALDRNGKPYEI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
            A+GLLA C+QHE+DHLNG LF+DHLS LK+ +  KK+ K+ + R
Sbjct: 122 EAEGLLAHCIQHEVDHLNGKLFLDHLSPLKQQLARKKLDKIKKRR 166


>gi|15644409|ref|NP_229461.1| peptide deformylase [Thermotoga maritima MSB8]
 gi|3023626|sp|P96113|DEF_THEMA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|4982236|gb|AAD36728.1|AE001808_3 polypeptide deformylase [Thermotoga maritima MSB8]
 gi|1772608|emb|CAA71356.1| polypeptide deformylase [Thermotoga maritima]
          Length = 164

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (60%), Gaps = 5/155 (3%)

Query: 8   IFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA 67
           +F DP+LR+ ++P+ K + ++   I+ M+E MY  DG+GLAA Q+G+  R  V+D+ +  
Sbjct: 6   VFGDPVLRKRAKPVTKFDENLKKTIERMIETMYHYDGVGLAAPQVGISQRFFVMDVGN-- 63

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
               P+  INP+I+    +  V +EGCLS P+   +++RS  I V+Y +   ++     +
Sbjct: 64  ---GPVAVINPEILEIDPETEVAEEGCLSFPEIFVEIERSKRIKVKYQNTRGEYVEEELE 120

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
           G  A   QHE DHLNG+L ID +S  KR ++ KK+
Sbjct: 121 GYAARVFQHEFDHLNGVLIIDRISPAKRLLLRKKL 155


>gi|317011008|gb|ADU84755.1| peptide deformylase [Helicobacter pylori SouthAfrica7]
          Length = 174

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL---QD 65
           +P  ILR +S+ +   +  +   +D+M E M +++GIGLAA+Q+G+  R+++I+L    D
Sbjct: 9   YPSKILRTISKEVVSFDEKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPREDD 68

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  LQHKEDCLEIINPKWIETKGSL-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASALLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|292670259|ref|ZP_06603685.1| peptide deformylase [Selenomonas noxia ATCC 43541]
 gi|292648211|gb|EFF66183.1| peptide deformylase [Selenomonas noxia ATCC 43541]
          Length = 156

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 90/138 (65%), Gaps = 4/138 (2%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           +P+L++ + PIE++      ++D+M E MY+ +G+GLAA QIG   RLVVID++D     
Sbjct: 11  NPVLKQKAEPIERLTKRHRQMLDDMAETMYAANGVGLAAPQIGKSLRLVVIDVEDE---H 67

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
             +  +NP +IT  +   V  EGCLSIP    DV+R+  +TV Y D  ++ + + ADGLL
Sbjct: 68  GLLELVNP-VITMREGSVVDSEGCLSIPKVYGDVERAERVTVEYTDRRSRRRTLTADGLL 126

Query: 131 ATCLQHELDHLNGILFID 148
           A C+QHE DHL+G LFID
Sbjct: 127 ARCIQHECDHLDGRLFID 144


>gi|166364192|ref|YP_001656465.1| peptide deformylase [Microcystis aeruginosa NIES-843]
 gi|159030946|emb|CAO88636.1| def [Microcystis aeruginosa PCC 7806]
 gi|166086565|dbj|BAG01273.1| polypeptide deformylase [Microcystis aeruginosa NIES-843]
          Length = 191

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 90/140 (64%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++  I  L   ML+ MYS++GIGLAA Q+ V  +L+VID +      
Sbjct: 24  DRVLRQPAKRIAKVDDSIRQLAREMLQTMYSSNGIGLAAPQVAVNKQLIVIDCEHDKPEN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP+II +S +    +EGCLSIPD   DV R   I V Y D   + + + A+GLL
Sbjct: 84  PPLILINPQIIGYSRELCKAEEGCLSIPDVFLDVIRPQAIEVSYKDEQGKPRKLQANGLL 143

Query: 131 ATCLQHELDHLNGILFIDHL 150
           A  +QHE+DHLNG++F+D +
Sbjct: 144 ARVIQHEMDHLNGVMFVDRV 163


>gi|291612480|ref|YP_003522637.1| peptide deformylase [Sideroxydans lithotrophicus ES-1]
 gi|291582592|gb|ADE10250.1| peptide deformylase [Sideroxydans lithotrophicus ES-1]
          Length = 167

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 99/160 (61%), Gaps = 3/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PD  L +V++ +E+IN     L+ +M E MY+  GIGLAA Q+    RL+VID+ 
Sbjct: 5   PIIQYPDERLHKVAKKVEQINEATRKLVRDMAETMYAAPGIGLAATQVDKHIRLIVIDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +     +  VFINP+++    D    +EGCLS+P     V R+ F+TV  +D + +   +
Sbjct: 65  ET--HDDLKVFINPELVDSMGDKE-NEEGCLSVPGIYEKVTRAEFVTVNALDEHGKPFTL 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+GLLA C+QHE+DHL G +F++ LS LK+  I  K+ K
Sbjct: 122 NAEGLLAVCIQHEMDHLQGRVFVEKLSHLKQTRIRAKLKK 161


>gi|257784671|ref|YP_003179888.1| peptide deformylase [Atopobium parvulum DSM 20469]
 gi|257473178|gb|ACV51297.1| peptide deformylase [Atopobium parvulum DSM 20469]
          Length = 180

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 91/151 (60%), Gaps = 1/151 (0%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V++PDP L +    I+ IN D+  + ++ML+VMY+TDG+GLA  QIG + R+VVID+  
Sbjct: 8   MVLWPDPRLSQKCEEIDDINDDVRKMAEHMLKVMYATDGVGLAGPQIGYMKRMVVIDVDY 67

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
              ++NP V INP+I     +  VY+EGCLS P     V R + + V   + +       
Sbjct: 68  PNGQENPFVLINPEIKVADGEPRVYEEGCLSFPGITVPVTRPSHVVVHAYNLDGDLMRYE 127

Query: 126 ADG-LLATCLQHELDHLNGILFIDHLSRLKR 155
           A+G L A CLQHE+DH+NG+   DHL    R
Sbjct: 128 AEGDLFAVCLQHEIDHINGVTMPDHLGPGAR 158


>gi|226313317|ref|YP_002773211.1| peptide deformylase [Brevibacillus brevis NBRC 100599]
 gi|226096265|dbj|BAH44707.1| peptide deformylase [Brevibacillus brevis NBRC 100599]
          Length = 158

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 91/148 (61%), Gaps = 5/148 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +V  PDPILR  +  + K NS++  L+D+M + MY  DG+GLAA Q+G+  R++V
Sbjct: 1   MAIRTIVKHPDPILREKAMVVTKFNSNLHKLLDDMADTMYDADGVGLAAPQVGISKRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D  D       +  INP+II    +   Y EGCLSIP  + DV+R  +I +R  D N  
Sbjct: 61  MDCGD-----GLIEMINPEIIEHEGEQYDYPEGCLSIPGLQGDVRRHKWIKLRGHDRNGN 115

Query: 121 HQIIYADGLLATCLQHELDHLNGILFID 148
              + AD LL+ C QHE+DHLNG+LFID
Sbjct: 116 VVELEADDLLSRCAQHEIDHLNGVLFID 143


>gi|159902617|ref|YP_001549961.1| peptide deformylase [Prochlorococcus marinus str. MIT 9211]
 gi|159887793|gb|ABX08007.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           MIT 9211]
          Length = 201

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 89/138 (64%)

Query: 14  LRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPM 73
           LR+ ++ + K+++ I  LI  ML  MYS  GIGLAA Q+G+  +L+VIDL        P+
Sbjct: 41  LRQTAQRVSKVDNSIRTLIKKMLHSMYSAKGIGLAAPQVGIHKQLLVIDLDIENSTTPPI 100

Query: 74  VFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATC 133
           V INP+I  FS     Y+EGCLSIP    +V R + I + + D   + + + ADGLL+ C
Sbjct: 101 VLINPQITDFSAAIETYEEGCLSIPGVYLNVIRPSSIKLNFRDEMGRPKKMNADGLLSRC 160

Query: 134 LQHELDHLNGILFIDHLS 151
           +QHE+DHLNG+LF+D ++
Sbjct: 161 IQHEMDHLNGVLFVDRVT 178


>gi|309389021|gb|ADO76901.1| peptide deformylase [Halanaerobium praevalens DSM 2228]
          Length = 150

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 93/143 (65%), Gaps = 5/143 (3%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+LR  ++ I+++N     LIDNM E MY+ DG+GLAA QIG+L R+ V+D+++     
Sbjct: 11  DPVLRTKAKEIDEVNKKTNELIDNMFETMYAEDGVGLAAPQIGMLKRIAVVDIREG---- 66

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
           N ++ INP+II   +  ++ +EGCLSIP    DV R+  I V+ ++   +     A+G  
Sbjct: 67  NKVILINPEIIE-KEGKAIMEEGCLSIPGETGDVIRAEKIKVKSLNRKGKEVTFLAEGFE 125

Query: 131 ATCLQHELDHLNGILFIDHLSRL 153
           A  +QHE+DHL+GILF+D + ++
Sbjct: 126 ARAIQHEIDHLDGILFVDKIIKI 148


>gi|315637680|ref|ZP_07892885.1| peptide deformylase [Arcobacter butzleri JV22]
 gi|315478027|gb|EFU68755.1| peptide deformylase [Arcobacter butzleri JV22]
          Length = 171

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 104/164 (63%), Gaps = 4/164 (2%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           + ++ +P+ +LR  S+ +EK +S++  L+D+M E M + +G+GLAA+Q+ V   ++VI+L
Sbjct: 3   REVITYPNKLLRLKSKDVEKFDSELHTLLDDMYETMIAQNGVGLAAIQVAVPLNVLVINL 62

Query: 64  --QDHAHRKNPMV-FINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
             ++    KN ++  INP +IT  D   V+ EGCLS+P +  DV R+  I V Y +   +
Sbjct: 63  PNEEDVQDKNDLIEAINP-VITHKDGTQVFTEGCLSVPGFSEDVTRAEHIVVEYFNRFGE 121

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            Q + ++G LA   QHE++HL+G LFI++LS +KR    K+  K
Sbjct: 122 KQTMESEGFLAVAWQHEMEHLSGHLFIENLSIIKRKKFEKEWKK 165


>gi|332709623|ref|ZP_08429583.1| peptide deformylase [Lyngbya majuscula 3L]
 gi|332351656|gb|EGJ31236.1| peptide deformylase [Lyngbya majuscula 3L]
          Length = 187

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 93/149 (62%), Gaps = 2/149 (1%)

Query: 5   PLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I    D +LR+ ++ + K++ +I  L + ML+ MYS DGIGLAA Q+G+  +++V+D
Sbjct: 16  PLTIHYLGDRVLRQPAKRVAKVDQNIRKLAEQMLQTMYSADGIGLAAPQVGINKQMIVVD 75

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
            + +     P+V INP+I +F       QEGCLSIP    DV R   I V Y D N + +
Sbjct: 76  CEPNNQDNQPLVLINPEIKSFGSTPCDGQEGCLSIPGVYLDVTRPDEIEVAYKDQNGRPR 135

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLS 151
            + A+GLL+  +QHE+DHL G++F+D + 
Sbjct: 136 TLKANGLLSRVIQHEIDHLKGVMFVDRVQ 164


>gi|288574972|ref|ZP_06393329.1| peptide deformylase [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570713|gb|EFC92270.1| peptide deformylase [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 164

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 94/158 (59%), Gaps = 6/158 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + + I+PDP+LR  ++ IE+ + +  + ++ M  +MY  DG+GLAA Q+G   ++ V
Sbjct: 1   MSDRTIRIYPDPVLREPTKEIERFDDNFKSFLEEMESLMYEYDGVGLAAPQVGESLKVAV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           I  +   H     V INP+I+ + D   V QEGCLS P    DV R A + V   D N +
Sbjct: 61  IAYEGKLH-----VLINPRIVDY-DGRQVDQEGCLSFPGIFEDVARPASVVVEAQDENGE 114

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
              I A+G LA  + HE+DHLNG L IDHLS +KR+M+
Sbjct: 115 PYSIEAEGFLARAMCHEIDHLNGKLMIDHLSPMKREMV 152


>gi|254526876|ref|ZP_05138928.1| peptide deformylase [Prochlorococcus marinus str. MIT 9202]
 gi|221538300|gb|EEE40753.1| peptide deformylase [Prochlorococcus marinus str. MIT 9202]
          Length = 201

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 98/161 (60%), Gaps = 5/161 (3%)

Query: 5   PLVIFP--DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I+      LR  ++ I K++ DI  L   ML+ MYS  GIGLAA Q+G+   L+VID
Sbjct: 30  PLEIYKLGSKALRTTAKRISKVDIDIRKLAKEMLQSMYSAKGIGLAAPQVGISKELLVID 89

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           +        P++ INP+I  +    + Y+EGCLSIP    +V R + I +++ D   + +
Sbjct: 90  INFEDSAAEPLILINPEITAYGSTLNSYEEGCLSIPGVYLNVIRPSTIKLKFRDEMGRPR 149

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSR---LKRDMITK 160
            + ADGLLA C+QHE+DHL G+LF+D ++    LK+++I +
Sbjct: 150 KMNADGLLARCIQHEVDHLKGVLFVDRVTSKEDLKKELIKE 190


>gi|302338169|ref|YP_003803375.1| peptide deformylase [Spirochaeta smaragdinae DSM 11293]
 gi|301635354|gb|ADK80781.1| peptide deformylase [Spirochaeta smaragdinae DSM 11293]
          Length = 161

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 94/159 (59%), Gaps = 4/159 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           ++   + +LR  +  + +++  I  L D+M+  M+  DG+GLAA QIGVL RL V     
Sbjct: 3   ILTLGNELLRERTATVAEVDESIRRLADDMIVTMHEDDGVGLAAPQIGVLKRLFVC---- 58

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
           H     P VFINP+II  S +   Y+EGCLSIP   ADV R   I V+ +D N +   + 
Sbjct: 59  HVRGDVPRVFINPEIIGTSQEQVRYEEGCLSIPGIYADVLRPESIQVQAIDENGKAFKLA 118

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           A+GLLA  +QHE+DHL G+LFIDHL   KR  + K   K
Sbjct: 119 AEGLLARVIQHEMDHLKGVLFIDHLEERKRRRLLKLYEK 157


>gi|312890426|ref|ZP_07749963.1| peptide deformylase [Mucilaginibacter paludis DSM 18603]
 gi|311297196|gb|EFQ74328.1| peptide deformylase [Mucilaginibacter paludis DSM 18603]
          Length = 190

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKIN-SDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           +K P++ + DP+LRR +  IE      I  L++NM E MY+  G+GLAA Q+G+  RL V
Sbjct: 1   MKYPIIAYGDPVLRRAATNIEPDEYPHIKELVENMFETMYAARGVGLAAPQVGLSMRLFV 60

Query: 61  IDLQ----DHAHRKN-PMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
           ID      D    K+   VFIN K++  + +   + EGCLSIPD R DV R   + + Y 
Sbjct: 61  IDATPFDDDEPELKDFKKVFINAKVLEETGEEWSFNEGCLSIPDIREDVYRKPVVRLSYY 120

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMS 163
           D N +H      GL A  +QHE DH+ G LF D LS L++ +I KK++
Sbjct: 121 DENWKHHEETFKGLAARVIQHEYDHIEGKLFTDKLSPLRKRLIQKKLT 168


>gi|225010669|ref|ZP_03701139.1| peptide deformylase [Flavobacteria bacterium MS024-3C]
 gi|225005222|gb|EEG43174.1| peptide deformylase [Flavobacteria bacterium MS024-3C]
          Length = 196

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 98/175 (56%), Gaps = 12/175 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL- 63
           P+V + DP+L++V+  I   + ++ +LI+NM E MY   G+GLAA QIG+  RL VID  
Sbjct: 4   PIVAYGDPVLKKVANAIAADHPNLESLIENMWETMYHAHGVGLAAPQIGLPIRLFVIDAT 63

Query: 64  -----------QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
                      +  A +    VFIN  I   + +   + EGCLSIPD R DV R   IT+
Sbjct: 64  PFADDEDLTQSEQDALKNFKAVFINATITEETGEEWTFNEGCLSIPDVREDVIRKPKITI 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            Y D   +      DGL+A  +QHE DH+ GILF D LS LK+ ++  ++S + +
Sbjct: 124 TYQDETFKTHTKTFDGLVARVIQHEYDHIEGILFTDKLSSLKKRILKGRLSNISK 178


>gi|160896282|ref|YP_001561864.1| peptide deformylase [Delftia acidovorans SPH-1]
 gi|160361866|gb|ABX33479.1| peptide deformylase [Delftia acidovorans SPH-1]
 gi|162662271|gb|EDQ49167.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 170

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 102/160 (63%), Gaps = 2/160 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L  V++P+ K++  I  L+ +M   MY   G+GLAA Q+ V  R+VV+D+ 
Sbjct: 5   PILCYPDPRLHTVAKPVAKVDDRIRQLVQDMYATMYDAQGVGLAATQVNVHERVVVVDVS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P   INP+++  S++  + +EGCLS+P     V+RS  I V+ +D N   +II
Sbjct: 65  EG--RDEPFALINPELLWASEETQLGEEGCLSVPGIYDGVERSTAIKVKALDENGNERII 122

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            A+G  A C+QHE+DHL G +F+++LS LKR+ I  K+ K
Sbjct: 123 EAEGFKAICIQHEMDHLMGKVFVEYLSPLKRNRIKTKLLK 162


>gi|182677516|ref|YP_001831662.1| peptide deformylase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633399|gb|ACB94173.1| peptide deformylase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 165

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 100/169 (59%), Gaps = 4/169 (2%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P++ FPDP L   ++ +E  +  +  L D+++E +++  GIG+ A  IGV  RLV 
Sbjct: 1   MAVRPVIRFPDPRLSMAAQKVEHFDETLRTLADDLVESLHAAHGIGITAPHIGVPARLVA 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ++L  +  R    +++NP+II  SD    +QEG +S+P     V+R A I VRY D +  
Sbjct: 61  LELTPNQTR----LYVNPEIIWSSDTKIRHQEGSVSMPGVTEIVERCAEIHVRYQDLDGS 116

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             I  ADG LA C QHE+D L+G+ +I  LSRLKR+ + K+  KL   R
Sbjct: 117 VHIEKADGFLAICHQHEIDQLDGLFWIQRLSRLKRERVIKRYEKLASDR 165


>gi|34558486|ref|NP_908301.1| peptide deformylase [Wolinella succinogenes DSM 1740]
 gi|39930815|sp|Q7M7M2|DEF_WOLSU RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|34481780|emb|CAE11201.1| POLYPEPTIDE DEFORMYLASE PDF FORMYLMETHIONINEDEFORMYLASE [Wolinella
           succinogenes]
          Length = 170

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 99/163 (60%), Gaps = 4/163 (2%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +P P+L++ S P+   + ++   +D M   M + +G+GLAAVQ+G   R +++++ 
Sbjct: 3   PIITYPHPLLKKRSEPVTLFDEELRQFLDEMYITMLAKNGVGLAAVQVGNPIRALIVNIP 62

Query: 65  D---HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D   +  R+N +  INP+ ++   +   + EGCLS+P++  DV R   + + Y D   + 
Sbjct: 63  DEEGNQERENLLEIINPEFLSKEGEIQ-FNEGCLSVPEFYEDVTRFDRVRLTYQDRYGER 121

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
             I A+G LA  LQHE+DHLNGILFID LS +KR    K++ K
Sbjct: 122 HEIEAEGYLAVALQHEIDHLNGILFIDKLSLIKRKKFEKELKK 164


>gi|318040515|ref|ZP_07972471.1| peptide deformylase [Synechococcus sp. CB0101]
          Length = 200

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 90/141 (63%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR  ++ I K++  I +L  +ML  MY+  GIGLAA QIG   +L+VIDL+    + 
Sbjct: 37  DQVLRTPAKRIGKVDDSIRSLARDMLVSMYAAKGIGLAAPQIGEPLQLLVIDLEIEDPKS 96

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P++ INP+I +       Y+EGCLSIP    DV R + + V Y D   + + + ADGL+
Sbjct: 97  PPLILINPEITSVGGSLCTYEEGCLSIPGVYLDVVRPSVVDVSYRDEMGRPKRLKADGLM 156

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHLNG+LF+D ++
Sbjct: 157 ARCIQHEMDHLNGVLFVDRVT 177


>gi|86610195|ref|YP_478957.1| peptide deformylase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558737|gb|ABD03694.1| peptide deformylase [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 196

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I ++N +I  L  +ML+ MYS DGIGLAA Q+G+  R++V+DL       
Sbjct: 26  DKVLRQPAKRISQVNDEIRQLARDMLQTMYSFDGIGLAAPQVGIPKRMIVVDLYPDKPEV 85

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I  +  +    QEGCLSIP    +V R   I V + D   + + + AD LL
Sbjct: 86  PPLVLINPEIREYIGEAVAGQEGCLSIPGVFCEVMRPEGIVVSFKDETGRPRTLRADDLL 145

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A  +QHE+DHLNG+LF+DH+ 
Sbjct: 146 ARVIQHEIDHLNGVLFVDHVE 166


>gi|308062113|gb|ADO04001.1| peptide deformylase [Helicobacter pylori Cuz20]
          Length = 175

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +DNM E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDNMHETMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETKGTI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|85375926|gb|ABC70185.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDTKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             HR++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHREDCLEIINPKWIETGGSI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|260778893|ref|ZP_05887785.1| peptide deformylase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605057|gb|EEX31352.1| peptide deformylase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 168

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 105/163 (64%), Gaps = 5/163 (3%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDLQ 64
           ++  PDP L+  +  +  I S +  LID+MLE +Y+T +GIGLAA Q+G    +V+IDL 
Sbjct: 6   ILTAPDPKLKIKAEKVSDIQS-VQTLIDDMLETLYATSNGIGLAATQVGHREAIVIIDLS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P++ +NP+++    + ++ QEGCLS+PDY ADV+R   + V  +D + +   I
Sbjct: 65  ES--RDQPLILVNPEVVE-GKNRAMGQEGCLSVPDYYADVERYTSVVVEALDRHGEPVRI 121

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
            +D  LA  +QHE+DHL G LFID+LS LK+ M  KK+ K ++
Sbjct: 122 ESDDFLAIVMQHEIDHLAGNLFIDYLSPLKQRMALKKVKKHIK 164


>gi|301632277|ref|XP_002945217.1| PREDICTED: peptide deformylase 1-like [Xenopus (Silurana)
           tropicalis]
          Length = 217

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 89/138 (64%), Gaps = 2/138 (1%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ 64
           P++ +PDP L +V++P+  +++ I +L+ +ML  MY   GIGLAA Q+ V  R+VVID  
Sbjct: 5   PILCYPDPRLHQVAQPVRAVDARIQSLVSDMLATMYDAQGIGLAATQVDVHERVVVIDTS 64

Query: 65  DHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQII 124
           +   R  P+V INP+I+  S +  V  EGCLS+P     V+R + + VR +D     ++I
Sbjct: 65  EE--RNQPLVLINPEIVWASAEKVVRDEGCLSVPGIYDGVERCSAVHVRALDEKGAARVI 122

Query: 125 YADGLLATCLQHELDHLN 142
            A+GLLA C+QHE+DHL 
Sbjct: 123 QAEGLLAVCMQHEMDHLT 140


>gi|170288957|ref|YP_001739195.1| peptide deformylase [Thermotoga sp. RQ2]
 gi|281412566|ref|YP_003346645.1| peptide deformylase [Thermotoga naphthophila RKU-10]
 gi|238688844|sp|B1LB14|DEF_THESQ RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|170176460|gb|ACB09512.1| peptide deformylase [Thermotoga sp. RQ2]
 gi|281373669|gb|ADA67231.1| peptide deformylase [Thermotoga naphthophila RKU-10]
          Length = 164

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (60%), Gaps = 5/155 (3%)

Query: 8   IFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHA 67
           +F DP+LR+ ++P+ K + ++   I+ M+E MY  DG+GLAA Q+G+  R  V+D+ +  
Sbjct: 6   VFGDPVLRKRAKPVTKFDDNLKKTIERMIETMYHYDGVGLAAPQVGISQRFFVMDVGN-- 63

Query: 68  HRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYAD 127
               P+  INP+I+    +  V +EGCLS P+   +++RS  I V+Y +   ++     +
Sbjct: 64  ---GPVAVINPEILEIDPETEVAEEGCLSFPEIFVEIERSKRIKVKYQNTRGEYVEEELE 120

Query: 128 GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
           G  A   QHE DHLNG+L ID +S  KR ++ KK+
Sbjct: 121 GYAARVFQHEFDHLNGVLIIDRISPAKRLLLRKKL 155


>gi|225012717|ref|ZP_03703152.1| peptide deformylase [Flavobacteria bacterium MS024-2A]
 gi|225003250|gb|EEG41225.1| peptide deformylase [Flavobacteria bacterium MS024-2A]
          Length = 195

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 97/173 (56%), Gaps = 12/173 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-- 62
           P+V +  P+L++ +  I +   ++  LI+NM E MY+++G+GLAA QIG+  RL VID  
Sbjct: 4   PIVAYGAPVLKKEAAEISEEYPNLDQLIENMWETMYASNGVGLAAPQIGLSIRLFVIDTA 63

Query: 63  ----------LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
                     L+    +    VFINP +I        + EGCLSIPD R DV R   I +
Sbjct: 64  PFSEDDELDELEAETLKSFKKVFINPVVIEEDGSLWEFNEGCLSIPDVREDVSRHERIKI 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            Y D   + Q +   GL A  +QHE DH+ G+LF DHL+ LKR ++  +++ +
Sbjct: 124 HYFDQQFKEQELVLTGLAARVVQHEYDHIEGVLFTDHLTPLKRRLLKNRLNSI 176


>gi|86142250|ref|ZP_01060760.1| peptide deformylase [Leeuwenhoekiella blandensis MED217]
 gi|85831002|gb|EAQ49459.1| peptide deformylase [Leeuwenhoekiella blandensis MED217]
          Length = 196

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 95/175 (54%), Gaps = 12/175 (6%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-- 62
           P+V + DP+LR+ +  I +   ++  L+ NM E MY   G+GLAA QIG   RL V+D  
Sbjct: 4   PIVAYGDPVLRKKAVEIPQDYPELKELVANMFETMYGASGVGLAAPQIGKAIRLFVVDAT 63

Query: 63  -------LQDHAH---RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITV 112
                  L D      R     FINP+I+  + D   + EGCLSIP    DV R   I +
Sbjct: 64  PFADDEDLSDEEQERLRTFKKAFINPQILEETGDEWAFSEGCLSIPGINEDVFRCPIIKI 123

Query: 113 RYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           +Y D +    +   DGLLA  +QHE DH+ GILF D LS LK+ +I  K++ + +
Sbjct: 124 KYQDEDFNEHVEEFDGLLARVIQHEYDHIEGILFTDKLSSLKKRIIKSKLAGISK 178


>gi|322421200|ref|YP_004200423.1| peptide deformylase [Geobacter sp. M18]
 gi|320127587|gb|ADW15147.1| peptide deformylase [Geobacter sp. M18]
          Length = 171

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 108/167 (64%), Gaps = 2/167 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           MV+K ++ +PDP L++ S P+  I      L+ +M E MY   G+GLAA QIGV  R++V
Sbjct: 1   MVRK-ILTYPDPELKKRSLPVTVITDKTRELVRDMAETMYDAPGVGLAAPQIGVHQRIIV 59

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID+     +   +V INP+II  ++  +  +EGCLS+P + A+V+R A + V+ ++ + +
Sbjct: 60  IDVSCKDEKPELIVAINPEII-HAEGEAYEEEGCLSVPKFSANVRRHAKVVVKSLNLDGE 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
             +I AD LLA   QHE+DHL+G+LFIDHLS LK+ +  K+  + ++
Sbjct: 119 EVVIRADDLLAIAFQHEIDHLDGVLFIDHLSPLKKGIFRKRYQRALE 165


>gi|149194678|ref|ZP_01871773.1| peptide deformylase [Caminibacter mediatlanticus TB-2]
 gi|149135101|gb|EDM23582.1| peptide deformylase [Caminibacter mediatlanticus TB-2]
          Length = 173

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 100/153 (65%), Gaps = 4/153 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +P+ IL+++S+P+E+ +S++  L+D+M E M + +GIGLAA+Q+GV  R ++IDL D
Sbjct: 6   IVTYPNKILKQISKPVERFDSELHKLLDDMYETMIAKNGIGLAAIQVGVPIRALLIDLGD 65

Query: 66  HAHRKNP---MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
              +++    +  INP+ + +      Y EGCLS+PDY  +V+R   + V++ D   +  
Sbjct: 66  EEGKQSKDTLIEVINPEFLEWDGSLK-YNEGCLSVPDYFDEVERYKKVKVKFFDRFGKEH 124

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKR 155
           I+ A+ LL+   QHE DHL+G +FI+ L  +KR
Sbjct: 125 IVDAEDLLSVAFQHETDHLDGHVFIERLDYIKR 157


>gi|269123156|ref|YP_003305733.1| peptide deformylase [Streptobacillus moniliformis DSM 12112]
 gi|268314482|gb|ACZ00856.1| peptide deformylase [Streptobacillus moniliformis DSM 12112]
          Length = 169

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 98/163 (60%), Gaps = 5/163 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M+K  + ++  PILR+ S  + + N ++ N +D M++ M   +GIGLAA Q+G+  R  V
Sbjct: 1   MIKLNIYVYEAPILRKKSEEVVEFNDELRNTLDEMVKTMRLANGIGLAANQVGIGKRFFV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +++ D   +      +NP+I++F ++   +QEGCLSIP    +V R   I VRY D N  
Sbjct: 61  LEIDDEITK-----VVNPEILSFGEEMVEFQEGCLSIPGIFKNVLRPESIVVRYQDENGN 115

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMS 163
                 +GL +   QHELDH++GILFID +S + R++I KK+ 
Sbjct: 116 FVERELNGLKSRAFQHELDHIDGILFIDKISPMSRNLIRKKLE 158


>gi|210134993|ref|YP_002301432.1| peptide deformylase [Helicobacter pylori P12]
 gi|238058211|sp|B6JM24|DEF_HELP2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|210132961|gb|ACJ07952.1| polypeptide deformylase [Helicobacter pylori P12]
          Length = 174

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKWIETKGSM-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|254457336|ref|ZP_05070764.1| peptide deformylase [Campylobacterales bacterium GD 1]
 gi|207086128|gb|EDZ63412.1| peptide deformylase [Campylobacterales bacterium GD 1]
          Length = 174

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 103/163 (63%), Gaps = 4/163 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +PD IL+++S  +EK + ++ +L+D M  +M  T+GIGLAA+Q+    +++++++ +
Sbjct: 5   IVEYPDKILKQISEKVEKFDKELHDLLDAMYPIMVKTNGIGLAAIQVARPKQVLILNIPE 64

Query: 66  HAHRK---NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
               +   N +  +NP II   D   VYQEGCLS+P +  D+ R   ITV Y D +A  +
Sbjct: 65  EDGEQPIENLIEMVNP-IIVKKDGEIVYQEGCLSVPSFYEDIIRFENITVNYQDRDANTK 123

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
            + A+GLL+  +QHE+DHL GILFID LS  +R    K+  ++
Sbjct: 124 TLEANGLLSVAIQHEIDHLKGILFIDKLSYARRKKFEKEYKRM 166


>gi|209515834|ref|ZP_03264696.1| peptide deformylase [Burkholderia sp. H160]
 gi|209503682|gb|EEA03676.1| peptide deformylase [Burkholderia sp. H160]
          Length = 167

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 99/159 (62%), Gaps = 2/159 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           +PD  L +V++P+ ++N  I  L+ +M E MY+  G+GLAA Q+ V  R++VID+ +   
Sbjct: 9   YPDKRLHKVAKPVTEVNDRIRRLVADMAETMYAAPGVGLAATQVDVHERVIVIDVSET-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               +  INP+I+  SD+    +EGCLS+P    +V+R+  + VR ++   +   +  +G
Sbjct: 67  HDELLALINPEIVWSSDERKFSEEGCLSVPGIYDNVERAEKVRVRALNEKGETFELDCEG 126

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           LLA C+QHE+DHL G +F+++LS LK+  I  KM KL  
Sbjct: 127 LLAVCVQHEMDHLMGRVFVEYLSPLKQTRIKSKMKKLAH 165


>gi|270692640|ref|ZP_06222945.1| peptide deformylase [Haemophilus influenzae HK1212]
 gi|270316024|gb|EFA28060.1| peptide deformylase [Haemophilus influenzae HK1212]
          Length = 132

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 89/130 (68%), Gaps = 3/130 (2%)

Query: 35  MLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGC 94
           M + MY   GIGLAA Q+ +L R++ ID++    ++N  V INP+I+  S+  +  +EGC
Sbjct: 1   MFDTMYQEKGIGLAAPQVDILQRIITIDVE--GDKQNQFVLINPEILA-SEGETGIEEGC 57

Query: 95  LSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLK 154
           LSIP +RA V R   +TVR +D + +   + ADGLLA C+QHE+DHLNGILF+D+LS LK
Sbjct: 58  LSIPGFRALVPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLSPLK 117

Query: 155 RDMITKKMSK 164
           R  I +K+ K
Sbjct: 118 RQRIKEKLLK 127


>gi|126733795|ref|ZP_01749542.1| formylmethionine deformylase [Roseobacter sp. CCS2]
 gi|126716661|gb|EBA13525.1| formylmethionine deformylase [Roseobacter sp. CCS2]
          Length = 166

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 97/165 (58%), Gaps = 2/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  +P V++P P LR  + P+  I  ++  + D M+  M +  G+GLAA Q+GV   L V
Sbjct: 1   MTHRPFVMWPHPALRTAATPVAVITDEVRAIWDEMIVAMDTMPGVGLAAPQLGVEMALAV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           ID  +   R   +   NP I+  S +  V++EG  ++P   A V R   +TVR+++ + Q
Sbjct: 61  IDASEE--RGQAIRMANPTILHSSVEPRVHEEGSPNLPGVWAKVTRPRAVTVRFLNADGQ 118

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                  GL AT +QH++DHL+G +F DHL+R+KRDM+ KK +KL
Sbjct: 119 WDRQDFVGLWATSVQHQIDHLSGKMFFDHLTRVKRDMLIKKSAKL 163


>gi|42527153|ref|NP_972251.1| polypeptide deformylase [Treponema denticola ATCC 35405]
 gi|41817577|gb|AAS12162.1| polypeptide deformylase [Treponema denticola ATCC 35405]
 gi|325474196|gb|EGC77384.1| polypeptide deformylase [Treponema denticola F0402]
          Length = 169

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 93/145 (64%), Gaps = 5/145 (3%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           +  LR VS+P+EKI+ +I +LID M   +   +GIGLAA Q+G   RL ++ + +  +  
Sbjct: 8   EETLREVSKPVEKIDENIKSLIDEMFVTVKKENGIGLAAPQVGENIRLFIVFINEQKY-- 65

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
              VFINP+II  S +  + +EGCLSIP    +V R + + V++++ + + + I A GLL
Sbjct: 66  ---VFINPEIIETSQEMCLMEEGCLSIPKVYDEVMRPSAVKVQFLNIDGKIKTIEASGLL 122

Query: 131 ATCLQHELDHLNGILFIDHLSRLKR 155
           A  +QHE DHLNGILFID LS  K+
Sbjct: 123 ARVIQHENDHLNGILFIDRLSEEKK 147


>gi|119510121|ref|ZP_01629260.1| peptide deformylase [Nodularia spumigena CCY9414]
 gi|119465182|gb|EAW46080.1| peptide deformylase [Nodularia spumigena CCY9414]
          Length = 187

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 88/141 (62%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++ +I  L   ML+ MYS+DGIGLAA Q+G+  +L+VID +      
Sbjct: 24  DRVLRQDAKRIAKVDDEIRQLAREMLQTMYSSDGIGLAAPQVGIHKQLIVIDCEPDNPDH 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP I   S +  V QEGCLSIP    DVKR   + + Y D   + + + A  LL
Sbjct: 84  PPLVLINPTIKQMSKEVCVAQEGCLSIPKVYLDVKRPEAVEIAYKDEYGRPKTLKATDLL 143

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A C+QHE+DHL G++F+D + 
Sbjct: 144 ARCIQHEMDHLKGVVFVDRVE 164


>gi|113955292|ref|YP_731667.1| peptide deformylase [Synechococcus sp. CC9311]
 gi|122945537|sp|Q0I7A5|DEF_SYNS3 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|113882643|gb|ABI47601.1| peptide deformylase [Synechococcus sp. CC9311]
          Length = 202

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 92/156 (58%), Gaps = 7/156 (4%)

Query: 3   KKPLVIFP-------DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVL 55
           K+PL   P       D  LR  +R I K++  + +L  +ML  MY+  GIGLAA Q+GV 
Sbjct: 23  KEPLETAPLDIHTLGDDALRGDARRIGKVDERVRDLARDMLRSMYTASGIGLAAPQVGVH 82

Query: 56  YRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
            +L+VIDL        P+V INP+I T S     Y+EGCLSIP    DV R   I + + 
Sbjct: 83  QQLLVIDLDFETPSTPPLVLINPEITTCSASVDTYEEGCLSIPGVYLDVVRPTAIQLSFR 142

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLS 151
           D   + + + ADGL+A C+QHE+DHL G+LF+D ++
Sbjct: 143 DEMGRPRTMKADGLMARCIQHEMDHLRGVLFVDRVT 178


>gi|307637482|gb|ADN79932.1| Peptide deformylase [Helicobacter pylori 908]
 gi|325996072|gb|ADZ51477.1| Peptide deformylase [Helicobacter pylori 2018]
 gi|325997668|gb|ADZ49876.1| Peptide deformylase [Helicobacter pylori 2017]
          Length = 174

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKWIETKGSM-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|302392197|ref|YP_003828017.1| peptide deformylase [Acetohalobium arabaticum DSM 5501]
 gi|302204274|gb|ADL12952.1| peptide deformylase [Acetohalobium arabaticum DSM 5501]
          Length = 145

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 90/141 (63%), Gaps = 6/141 (4%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           DP+LR  ++P++++      LI NM + MY   G+GLAA QIG+  R++V+D+ +     
Sbjct: 11  DPVLRTEAKPVDEVTEKTEGLIKNMQDTMYDASGVGLAAPQIGISKRVIVVDVGE----- 65

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+  INP+I+  S    + +EGCLSIP+   +V+R+A + V  +D + +   I A+GLL
Sbjct: 66  GPLALINPEIVESSGS-EIDEEGCLSIPNENGNVERAARVVVDALDSDGREVEIEAEGLL 124

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           A  LQHE+DHL GILF+D + 
Sbjct: 125 ARVLQHEIDHLEGILFVDKVE 145


>gi|300868003|ref|ZP_07112642.1| peptide deformylase [Oscillatoria sp. PCC 6506]
 gi|300334024|emb|CBN57820.1| peptide deformylase [Oscillatoria sp. PCC 6506]
          Length = 186

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 92/151 (60%), Gaps = 2/151 (1%)

Query: 3   KKPLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           K PL I    D  LR+ ++ +  ++++I  L+  ML+ MYS +GIGLAA Q+ V  +++V
Sbjct: 14  KPPLTIHTLGDRALRQPAKRVASVDAEIRQLVREMLQTMYSAEGIGLAAPQVAVQKQVIV 73

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D +       P+V INP I  +S +  V+QEGCLSIP    +VKR   I V Y D   +
Sbjct: 74  VDCEPDNAANPPLVLINPSIKKYSGEVCVFQEGCLSIPGVYLEVKRPEAIEVFYRDEYGR 133

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLS 151
            Q + A  LL+  +QHE+DHLNG+LF+D + 
Sbjct: 134 PQTLKATELLSRAIQHEMDHLNGVLFVDRVE 164


>gi|85700147|gb|ABC74523.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDAKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETGGSM-MYREGCLSVPGFYEEVERFEKVKIEYQNSFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|157412419|ref|YP_001483285.1| peptide deformylase [Prochlorococcus marinus str. MIT 9215]
 gi|157386994|gb|ABV49699.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           MIT 9215]
          Length = 201

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 96/159 (60%), Gaps = 5/159 (3%)

Query: 5   PLVIFP--DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I+      LR  ++ I K++ D   L   ML+ MYS  GIGLAA Q+G+   L+VID
Sbjct: 30  PLEIYKLGSKTLRTTAKRISKVDIDTRKLAKEMLQSMYSAKGIGLAAPQVGISKELLVID 89

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           +        P++ INP+I  +    + Y+EGCLSIP    +V R + I +++ D   + +
Sbjct: 90  INFEDSAAEPLILINPEITAYGSTLNSYEEGCLSIPGVYLNVIRPSTIKLKFRDEMGRPR 149

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSR---LKRDMI 158
            + ADGLLA C+QHE+DHL G+LF+D ++    LK+++I
Sbjct: 150 KMNADGLLARCIQHEVDHLKGVLFVDRVTSKEDLKKELI 188


>gi|85700133|gb|ABC74516.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDTKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKWIETGGSI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSVLKRKKFEKELKEL 167


>gi|15611796|ref|NP_223447.1| peptide deformylase [Helicobacter pylori J99]
 gi|8134402|sp|Q9ZL51|DEF_HELPJ RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|4155293|gb|AAD06310.1| POLYPEPTIDE DEFORMYLASE [Helicobacter pylori J99]
          Length = 174

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKWIETKGSI-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|170078943|ref|YP_001735581.1| peptide deformylase [Synechococcus sp. PCC 7002]
 gi|238689048|sp|B1XJP0|DEF_SYNP2 RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|169886612|gb|ACB00326.1| peptide deformylase [Synechococcus sp. PCC 7002]
          Length = 187

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (60%)

Query: 11  DPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRK 70
           D +LR+ ++ I K++ +I  L   ML+ MYS+ GIGLAA Q+GV  RL+VID        
Sbjct: 24  DKVLRQKAKRIAKVDDEIRTLAKEMLQTMYSSQGIGLAAPQVGVNKRLIVIDTDPENPAN 83

Query: 71  NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLL 130
            P+V INP+I  F      ++EGCLSIP    DV R   I V Y D   + + I A GLL
Sbjct: 84  APLVLINPEIKKFGQQLCPFEEGCLSIPGVHLDVIRPDEIEVSYRDEQGKPKRIKASGLL 143

Query: 131 ATCLQHELDHLNGILFIDHLS 151
           +  +QHE+DHL+G++F+D + 
Sbjct: 144 SRVIQHEIDHLDGVMFVDRVE 164


>gi|312884517|ref|ZP_07744221.1| peptide deformylase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367829|gb|EFP95377.1| peptide deformylase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 171

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 101/161 (62%), Gaps = 5/161 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYST-DGIGLAAVQIGVLYRLVVIDL 63
           P++  PDP L+  +  +   +  + + ID+ML+ +YST +GIGLAA Q+G    +VVIDL
Sbjct: 5   PILTTPDPRLKYEAEQVTDFDK-VQSFIDDMLDTLYSTANGIGLAATQVGRKEAVVVIDL 63

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            +   R  P++ +NPK++    +  + QEGCLS+PDY ADV+R   + V+  D       
Sbjct: 64  SEA--RDQPLILVNPKVVC-GKNREMGQEGCLSVPDYYADVERFTSVVVQAQDRLGNAIK 120

Query: 124 IYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           + +D  LA  +QHE+DHL+G LFID+LS LKR M  KK+ K
Sbjct: 121 VESDDFLAIVMQHEIDHLSGRLFIDYLSPLKRQMALKKVKK 161


>gi|317014203|gb|ADU81639.1| peptide deformylase [Helicobacter pylori Gambia94/24]
          Length = 174

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKWIETKGSI-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|193215216|ref|YP_001996415.1| peptide deformylase [Chloroherpeton thalassium ATCC 35110]
 gi|193088693|gb|ACF13968.1| peptide deformylase [Chloroherpeton thalassium ATCC 35110]
          Length = 202

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 99/154 (64%), Gaps = 5/154 (3%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID-- 62
           P+    +P+L +V++P++ +++++   I++M E MY+ DGIGLAA Q+G   RL+V+D  
Sbjct: 23  PVYTLGEPVLNKVAKPLKGVDAEMKQFIEDMFETMYNADGIGLAAPQVGKSLRLLVVDVS 82

Query: 63  -LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
            ++D+   K P+V INP+I+  +   S  +EGCLS+P    +V R   IT++Y D +   
Sbjct: 83  VMEDYQDEK-PLVVINPQILE-TKGLSTMEEGCLSVPGVHEEVTRPKQITLKYRDADFVE 140

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKR 155
           ++   DG++A  LQHE++HL G LFID+L    R
Sbjct: 141 RVEIYDGMMARVLQHEIEHLQGNLFIDNLDAKTR 174


>gi|49089809|gb|AAT51863.1| peptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDAKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETGGSM-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|15645412|ref|NP_207586.1| peptide deformylase [Helicobacter pylori 26695]
 gi|3023623|sp|P56419|DEF_HELPY RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|2313922|gb|AAD07841.1| polypeptide deformylase (def) [Helicobacter pylori 26695]
          Length = 174

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETGGSM-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|87301353|ref|ZP_01084194.1| peptide deformylase [Synechococcus sp. WH 5701]
 gi|87284321|gb|EAQ76274.1| peptide deformylase [Synechococcus sp. WH 5701]
          Length = 201

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 89/149 (59%), Gaps = 2/149 (1%)

Query: 5   PLVI--FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           PL I    D +LR+ ++ I K++  +  L  NML  MYS  GIGLAA Q+GV  +++VID
Sbjct: 30  PLTIHRLGDQVLRQSAKRISKVDESVRELARNMLRSMYSAHGIGLAAPQVGVHKQVLVID 89

Query: 63  LQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
           L        PMV +NP+I   S   + Y+EGCLSIP     V R +   V Y D   + +
Sbjct: 90  LDPENPATPPMVLVNPEINATSAALNTYEEGCLSIPGVYLSVVRPSEAEVSYRDEQGRPR 149

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLS 151
            I ADGLLA C+ HE+DHL G+LF+D +S
Sbjct: 150 RIKADGLLARCILHEMDHLKGVLFVDLVS 178


>gi|282858813|ref|ZP_06267958.1| peptide deformylase [Prevotella bivia JCVIHMP010]
 gi|282588382|gb|EFB93542.1| peptide deformylase [Prevotella bivia JCVIHMP010]
          Length = 186

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 98/174 (56%), Gaps = 16/174 (9%)

Query: 5   PLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL- 63
           P+  +  P+LR+V++ I     D+  LI NM E   ++DG+GLAA QIG   R+VVIDL 
Sbjct: 4   PIYTYGQPVLRKVAQDIPTDYPDLQELIQNMFETCSASDGVGLAAPQIGKSIRVVVIDLD 63

Query: 64  ---------QDHAHRKNPMVFINPKIITFSD-DFSVYQEGCLSIPDYRADVKRSAFITVR 113
                    +D+ H      FIN  I+ F D +  + +EGCLS+P     V+R+  + + 
Sbjct: 64  VMSDAFPEYKDYKH-----AFINGHILEFDDTETEIMEEGCLSLPGLHEKVERAKRVHIE 118

Query: 114 YMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           ++D N QH   + DG LA  +QHE DHL G +F D +S  ++ MI  KM  ++Q
Sbjct: 119 WLDENLQHHDEWVDGFLARVIQHEFDHLEGKVFTDRVSPFRKQMIKNKMKAMLQ 172


>gi|258593266|emb|CBE69605.1| Peptide deformylase (PDF) (Polypeptide deformylase) [NC10 bacterium
           'Dutch sediment']
          Length = 169

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 90/151 (59%), Gaps = 1/151 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M K  ++++P P++R+ S  +  IN ++   ID+M+E MY+  G+GLAA Q+G L R++V
Sbjct: 1   MAKLSILLYPSPVIRKKSVSVTSINGELQRFIDDMVETMYAAPGMGLAAPQVGALKRVIV 60

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D  D      PM  INP ++       V +EGCL IPD    V R   + V+  D N +
Sbjct: 61  LDPSDDRTSHRPMALINPVLVAGEGQI-VDEEGCLCIPDLNEPVSRFKQVVVKAYDRNEK 119

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLS 151
             I+    LLA  LQHE+DHL+GILFID LS
Sbjct: 120 EIILEGADLLARILQHEIDHLDGILFIDRLS 150


>gi|254445347|ref|ZP_05058823.1| peptide deformylase [Verrucomicrobiae bacterium DG1235]
 gi|198259655|gb|EDY83963.1| peptide deformylase [Verrucomicrobiae bacterium DG1235]
          Length = 191

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 99/178 (55%), Gaps = 17/178 (9%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQ- 64
           +V + + +L    +P+ K ++++  L +NM++ MY  +GIGLAA Q+G+     V+DL  
Sbjct: 5   IVQYGEKVLHETGKPVTKFDAELAELFENMVDTMYEAEGIGLAAQQVGLPLMFCVVDLNG 64

Query: 65  ---------DHAHRK----NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFIT 111
                    D A        PM   NPK+         Y+EGCLS P+ R DV+R+ +I 
Sbjct: 65  CDPDFDYTLDGAKPPFDLFMPMAIANPKVELIKSKELAYEEGCLSFPEIRGDVERTDWIR 124

Query: 112 VRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             + D      +I A+GLL  C+QHE+DHLNGILFID   R+K+ ++ K   ++ QL+
Sbjct: 125 CEFQDLQGNPHVIEANGLLGRCIQHEVDHLNGILFID---RMKKRVLKKIQPQVNQLK 179


>gi|118137648|pdb|2EW5|A Chain A, Structure Of Helicobacter Pylori Peptide Deformylase In
           Complex With Inhibitor
 gi|118137649|pdb|2EW6|A Chain A, Structure Of Helicobacter Pylori Peptide Deformylase In
           Complex With Inhibitor
 gi|118137650|pdb|2EW7|A Chain A, Crystal Structure Of Helicobacter Pylori Peptide
           Deformylase
          Length = 181

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 8   YPSKILRTISKEVVSFDAKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 67

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 68  VQHKEDCLEIINPKFIETGGSM-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 126

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 127 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 166


>gi|222056880|ref|YP_002539242.1| peptide deformylase [Geobacter sp. FRC-32]
 gi|221566169|gb|ACM22141.1| peptide deformylase [Geobacter sp. FRC-32]
          Length = 168

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 107/169 (63%), Gaps = 6/169 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDG-IGLAAVQIGVLYRLV 59
           M  + ++++P P+L+++  P+  I+ +I  L+ ++L+ M++  G +G+AA QIGV  R+ 
Sbjct: 1   MPGQKILLYPHPVLKKLCHPVGAIDGEIKGLLQDLLDCMHAGPGSVGVAAPQIGVTLRVC 60

Query: 60  VIDLQDHAHRKNP----MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYM 115
           V+D+ +  + K+     +  INP +IT     ++ +EGC+S+PDY  DV+R+  ITVR+ 
Sbjct: 61  VVDVSNSRNGKDNNHGLLQLINP-VITERSGAAIMREGCMSVPDYTGDVERATEITVRFT 119

Query: 116 DCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           D N   + + A G  A  +QHE+DHL+G+LF+D ++ LK  +  +K  K
Sbjct: 120 DGNGIEREVKASGFEAVAIQHEMDHLDGMLFLDRIASLKTGLFRRKNYK 168


>gi|261839392|gb|ACX99157.1| peptide deformylase [Helicobacter pylori 52]
          Length = 175

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ I   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEIVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKFIETKGTI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|188527363|ref|YP_001910050.1| peptide deformylase [Helicobacter pylori Shi470]
 gi|238691921|sp|B2UT38|DEF_HELPS RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|188143603|gb|ACD48020.1| peptide deformylase [Helicobacter pylori Shi470]
          Length = 175

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ I   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEIVSFDSKLHQQLDDMRETMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETKGTI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|300854442|ref|YP_003779426.1| N-formylmethionyl-tRNA deformylase [Clostridium ljungdahlii DSM
           13528]
 gi|300434557|gb|ADK14324.1| N-formylmethionyl-tRNA deformylase [Clostridium ljungdahlii DSM
           13528]
          Length = 152

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 98/152 (64%), Gaps = 8/152 (5%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           + D ILR+ SR +E+IN  I  L+D+M E +Y  DG+GLAA Q+GVL R++VID+ +   
Sbjct: 9   YGDSILRKKSRKVEEINERIHVLLDDMEETLYEEDGVGLAAPQVGVLKRVIVIDVGE--- 65

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
               +  +NP+I T+S+  +V  EGCLSIP    +V+R   + V+ ++   +  +I  + 
Sbjct: 66  --GILKLVNPEI-TYSEGKAVDIEGCLSIPGSEGEVERPKKVKVKALNEKGEEIVIEGED 122

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITK 160
           LLA  L HE+DHLNGILFID +  +K+  +TK
Sbjct: 123 LLARALCHEIDHLNGILFIDKI--IKKGEVTK 152


>gi|85700129|gb|ABC74514.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDTKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKWIETGGSI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|224373737|ref|YP_002608109.1| peptide deformylase [Nautilia profundicola AmH]
 gi|254767597|sp|B9L6X1|DEF_NAUPA RecName: Full=Peptide deformylase; Short=PDF; AltName:
           Full=Polypeptide deformylase
 gi|223589661|gb|ACM93397.1| peptide deformylase [Nautilia profundicola AmH]
          Length = 174

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 101/160 (63%), Gaps = 4/160 (2%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V +P+ +L+++S+P+E+ + D+  L+D+M E M   +G+GLAA+Q+ V  R ++ID+ D
Sbjct: 6   IVTYPNKVLKQISKPVERFDKDLHKLLDDMYETMIKNNGVGLAAIQVAVPIRALLIDIGD 65

Query: 66  HAHRKNP---MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQ 122
              +++    +  INP+ +T+ D      EGCLS+PDY  +V+R   + V++ D   +  
Sbjct: 66  EEGKQSKDTLIEVINPEFLTW-DGTQKDTEGCLSVPDYFDEVERYKNVKVKFFDRFGKEH 124

Query: 123 IIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKM 162
           ++ A+GLL+   QHE DHL+G LF++ L  +KR    K+ 
Sbjct: 125 VMEAEGLLSVAFQHETDHLDGHLFVERLDYIKRKKFEKEW 164


>gi|255262069|ref|ZP_05341411.1| peptide deformylase [Thalassiobium sp. R2A62]
 gi|255104404|gb|EET47078.1| peptide deformylase [Thalassiobium sp. R2A62]
          Length = 164

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 98/164 (59%), Gaps = 6/164 (3%)

Query: 4   KPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDL 63
           +  V++PD  LR  +  + +I  DI  + D M+E M +  G+GLAAVQIGV  RL V+D 
Sbjct: 3   RSYVMWPDKRLRTAASDVAEITDDIRAIWDEMIEAMDAMPGVGLAAVQIGVPLRLAVVDA 62

Query: 64  QDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQI 123
            D   R   +   NP+I+  S +   +QE   ++P   A V R   +TV++MD N   ++
Sbjct: 63  SD--ARGQAIRMANPEILFASAEMRTHQEASPNLPGVSAIVGRPRAVTVQFMDANG--EL 118

Query: 124 IYAD--GLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +  D  GL AT +QH++DHL G ++ DH+SR KRDM+ KK +KL
Sbjct: 119 VQRDLVGLWATSVQHQIDHLAGRMYFDHVSRTKRDMLIKKSAKL 162


>gi|4098215|gb|AAD09580.1| N-formylmethionylaminoacyl-tRNA deformylase [Helicobacter pylori]
          Length = 174

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDTKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKWIETGGSI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|317178847|dbj|BAJ56635.1| peptide deformylase [Helicobacter pylori F30]
          Length = 175

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMRETMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKFIETKGTI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|332673404|gb|AEE70221.1| peptide deformylase [Helicobacter pylori 83]
          Length = 174

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDAKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPKEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKFIETGGSI-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEMDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|317009197|gb|ADU79777.1| peptide deformylase [Helicobacter pylori India7]
          Length = 174

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 103/160 (64%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDAKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPKEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK+I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKLIEAGGSM-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|85700127|gb|ABC74513.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   ++ +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDTKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLIINLPQEDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKWIGTGGSI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|255746035|ref|ZP_05419982.1| peptide deformylase [Vibrio cholera CIRS 101]
 gi|262162126|ref|ZP_06031141.1| peptide deformylase [Vibrio cholerae INDRE 91/1]
 gi|255735789|gb|EET91187.1| peptide deformylase [Vibrio cholera CIRS 101]
 gi|262028201|gb|EEY46859.1| peptide deformylase [Vibrio cholerae INDRE 91/1]
 gi|327485372|gb|AEA79778.1| Peptide deformylase [Vibrio cholerae LMA3894-4]
          Length = 145

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 96/145 (66%), Gaps = 4/145 (2%)

Query: 26  SDIMNLIDNMLEVMYSTD-GIGLAAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFS 84
           + +  LID++L+ +Y+TD GIGLAA Q+G    +VVIDL D+  R  P+V INPK+++ S
Sbjct: 2   ASVQTLIDDLLDTLYATDNGIGLAAPQVGREEAIVVIDLSDN--RDQPLVLINPKVVSGS 59

Query: 85  DDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGI 144
           +   + QEGCLS+PDY ADV+R   + V  +D   +   I     LA  +QHE+DHL+G 
Sbjct: 60  NK-EMGQEGCLSVPDYYADVERYTSVVVEALDREGKPLRIETSDFLAIVMQHEIDHLSGN 118

Query: 145 LFIDHLSRLKRDMITKKMSKLVQLR 169
           LFID+LS LK+ M  KK+ K V+ R
Sbjct: 119 LFIDYLSPLKQQMAMKKVKKHVKNR 143


>gi|239617141|ref|YP_002940463.1| peptide deformylase [Kosmotoga olearia TBF 19.5.1]
 gi|239505972|gb|ACR79459.1| peptide deformylase [Kosmotoga olearia TBF 19.5.1]
          Length = 164

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 98/163 (60%), Gaps = 7/163 (4%)

Query: 6   LVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65
           +V   +P+LR  S  I+K + ++   +  +  +MY  DG+GLAA Q+ VL R+ V D   
Sbjct: 3   IVYIGNPVLREKSEAIKKFDDNLKTFVKELTSIMYKEDGVGLAAPQVAVLKRMFVFD--- 59

Query: 66  HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ-HQII 124
                 P V INP+I+  S +  + +EGCLSIP   ADV+R  ++ +RY D +   H+ +
Sbjct: 60  --DGSGPKVIINPEILEKSKELVIMEEGCLSIPGVYADVERPEWVKMRYQDVDGNVHEEL 117

Query: 125 YADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
           + +G     +QHE DHLNGILFID+LS  K+ MI  K+ ++++
Sbjct: 118 F-EGYAGRIVQHEYDHLNGILFIDYLSPAKKMMIRPKLREIMK 159


>gi|85700135|gb|ABC74517.1| polypeptide deformylase [Helicobacter pylori]
          Length = 174

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +I+ 
Sbjct: 69  VQHKEDCLEIINPKFIETKGTI-MYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAVQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|308182949|ref|YP_003927076.1| peptide deformylase [Helicobacter pylori PeCan4]
 gi|308065134|gb|ADO07026.1| peptide deformylase [Helicobacter pylori PeCan4]
          Length = 175

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMRESMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETKGTI-IYKEGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|254779233|ref|YP_003057338.1| peptide deformylase [Helicobacter pylori B38]
 gi|254001144|emb|CAX29102.1| Peptide deformylase (PDF) (Polypeptide deformylase) [Helicobacter
           pylori B38]
          Length = 174

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 102/160 (63%), Gaps = 4/160 (2%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDH-- 66
           +P  ILR +S+ +   +S +   +D+M E M +++GIGLAA+Q+G+  R+++I+L     
Sbjct: 9   YPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPREDG 68

Query: 67  -AHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIY 125
             H+++ +  INPK I       +Y+EGCLS+P +  +V+R   + + Y +  A+ +++ 
Sbjct: 69  VQHKEDCLEIINPKFIETGGSM-MYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKVLE 127

Query: 126 ADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           A  LLA  +QHE+DHLNG+LF+D LS LKR    K++ +L
Sbjct: 128 ASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKEL 167


>gi|256823831|ref|YP_003147794.1| peptide deformylase [Kangiella koreensis DSM 16069]
 gi|256797370|gb|ACV28026.1| peptide deformylase [Kangiella koreensis DSM 16069]
          Length = 175

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 93/156 (59%), Gaps = 3/156 (1%)

Query: 9   FPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAH 68
           FPDP LR  ++P+     ++   ID+M E MY+  GIGLAA Q+ +  +  VID+ D   
Sbjct: 9   FPDPRLRTKAKPVTDFGDELQQQIDSMFETMYAAPGIGLAATQVNIHKQFFVIDVSDD-- 66

Query: 69  RKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQHQIIYADG 128
           +  P+VFINP+I+         +EGCLS P   A V+R+  I V+ +D + +   +    
Sbjct: 67  KSEPLVFINPQIVE-KRGVEEMEEGCLSFPGVYAKVQRANEIVVKALDRHGKPFEMDTGE 125

Query: 129 LLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
           LLA C+QHE DH+ G LF+D+LS LKR+ I K + K
Sbjct: 126 LLAVCIQHENDHIEGKLFVDYLSPLKRNRIRKMLEK 161


>gi|33863868|ref|NP_895428.1| peptide deformylase [Prochlorococcus marinus str. MIT 9313]
 gi|124022020|ref|YP_001016327.1| peptide deformylase [Prochlorococcus marinus str. MIT 9303]
 gi|39930996|sp|Q7V5F9|DEF2_PROMM RecName: Full=Peptide deformylase 2; Short=PDF 2; AltName:
           Full=Polypeptide deformylase 2
 gi|33635451|emb|CAE21776.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           MIT 9313]
 gi|123962306|gb|ABM77062.1| putative formylmethionine deformylase [Prochlorococcus marinus str.
           MIT 9303]
          Length = 201

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 91/139 (65%)

Query: 13  ILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVIDLQDHAHRKNP 72
           +LR+ +R I K++  + +L+ +ML  MY+  GIGLAA Q+G+  +L+V+DL        P
Sbjct: 40  VLRQSTRRIGKVDESVRDLVRDMLRSMYAAKGIGLAAPQVGIHKQLLVLDLDLETPTTPP 99

Query: 73  MVFINP