PSIBLAST alignment of GI: 254780297 and protein with PDB id: 1q1y

>gi|51247225|pdb|1Q1Y|A Chain A, Crystal Structures Of Peptide Deformylase From Staphylococcus Aureus Complexed With Actinonin Length = 191
 Score = 87.1 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 64/168 (38%), Gaps = 17/168 (10%)

Query: 2   VKKPLVIFPDPILRRVSRPIE-KINSDIMNLIDNMLEVMYSTDGI------------GLA 48
             K ++    P LR+ +  +E  +  +    +  M E + ++               GLA
Sbjct: 3   TMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLA 62

Query: 49  AVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVY----QEGCLSIPDYRADV 104
           A QI +  R++ + + D    K+    +    I        Y    +       +    V
Sbjct: 63  APQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGXLSVDDNVAGLV 122

Query: 105 KRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSR 152
            R   IT++  D       +   G  A   QHE+DHLNG++F DH+ +
Sbjct: 123 HRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDK 170