PSIBLAST alignment of GI: 254780297 and protein with PDB id: 2w3t

>gi|281306913|pdb|2W3T|A Chain A, Chloro Complex Of The Ni-Form Of E.Coli Deformylase Length = 188
>gi|281306914|pdb|2W3U|A Chain A, Formate Complex Of The Ni-Form Of E.Coli Deformylase Length = 188
 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 108/168 (64%), Gaps = 3/168 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
               ++  PD  LR+V++P+E++N++I  ++D+M E MY+ +GIGLAA Q+ +  R++VI
Sbjct: 1   SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVI 60

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ ++       + +    +      +  +EGCLSIP+ RA V R+  + +R +D + + 
Sbjct: 61  DVSENRD---ERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKP 117

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLR 169
             + ADGLLA C+QHE+DHL G LF+D+LS LK+  I +K+ KL +L+
Sbjct: 118 FELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLK 165