PSIBLAST alignment of GI: 254780297 and protein with PDB id: 3fwx

>gi|225698067|pdb|3FWX|A Chain A, The Crystal Structure Of The Peptide Deformylase From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 169
>gi|225698068|pdb|3FWX|B Chain B, The Crystal Structure Of The Peptide Deformylase From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 169
 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 74/169 (43%), Positives = 109/169 (64%), Gaps = 3/169 (1%)

Query: 2   VKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVI 61
               ++ FPD  LR V++P+E++  +I  ++D+ LE  Y+ +GIGLAA Q+ +  R+VVI
Sbjct: 2   SVLQVLTFPDDRLRTVAKPVEQVTPEIQQIVDDXLETXYAEEGIGLAATQVDIHQRIVVI 61

Query: 62  DLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQH 121
           D+ +   R  P V INP+II    +    +EGCLS+P  RA V R+A +TV+ +D N Q 
Sbjct: 62  DISE--TRDQPXVLINPEIIEKRGE-DGIEEGCLSVPGARALVPRAAEVTVKALDRNGQE 118

Query: 122 QIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170
               AD LLA C+QHELDHL G LF+D+LS LKR+ I +K+ K+ +  +
Sbjct: 119 YQFDADDLLAICVQHELDHLAGKLFVDYLSPLKRNRIKEKLEKIKRFNE 167