RPSBLAST alignment for GI: 254780297 and conserved domain: COG0242

>gnl|CDD|30591 COG0242, Def, N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis]. Length = 168
 Score =  203 bits (519), Expect = 1e-53
 Identities = 83/167 (49%), Positives = 123/167 (73%), Gaps = 1/167 (0%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M  + +V +PDP LR+V++P+E+++ ++  LID+MLE MY+ +G+GLAA QIG+  R+ V
Sbjct: 1   MAIREIVKYPDPRLRQVAKPVEEVDDELRQLIDDMLETMYAAEGVGLAAPQIGISKRIFV 60

Query: 61  IDLQDHAHRK-NPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNA 119
           ID+++    K  P+V INP+II+ S++    +EGCLS+P  R +V+R   ITV+Y+D N 
Sbjct: 61  IDVEEDGRPKEPPLVLINPEIISKSEETLTGEEGCLSVPGVRGEVERPERITVKYLDRNG 120

Query: 120 QHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLV 166
           + Q + A+GLLA C+QHE+DHLNG+LFID LS LKRD + KK+ KL 
Sbjct: 121 KPQELEAEGLLARCIQHEIDHLNGVLFIDRLSPLKRDRLKKKLKKLK 167