RPSBLAST alignment for GI: 254780297 and conserved domain: KOG3137

>gnl|CDD|38347 KOG3137, KOG3137, KOG3137, Peptide deformylase [Translation, ribosomal structure and biogenesis]. Length = 267
 Score =  119 bits (299), Expect = 4e-28
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 17/162 (10%)

Query: 6   LVIFPDPILRRVSRPIEKI---NSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVVID 62
           +V + DP+LR  ++ +++    + ++ NL+D M +VM  TDG+GL+A Q+GV  +L+V++
Sbjct: 81  IVEYGDPVLRAKAKRVDRAQIGDENLQNLVDAMFDVMRKTDGVGLSAPQVGVPVQLMVLE 140

Query: 63  LQDHAHRKNP--------------MVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSA 108
                 R+ P              +V +NPK+  +SD    + EGCLS+P + A+V R  
Sbjct: 141 PAGALCRECPEPGRAERQMEPFKLIVLVNPKLKKYSDKLVPFDEGCLSVPGFYAEVVRPQ 200

Query: 109 FITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHL 150
            + +   D   +   I A G  A   QHE DHL G+LF D +
Sbjct: 201 SVKIDGRDITGERFSISASGWPARIFQHEYDHLEGVLFFDKM 242