RPSBLAST alignment of GI: 254780297 and MMDB domain: 1lme_A_

>1lme_A (A:) PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima}Length = 176
 Score =  169 bits (430), Expect = 1e-43
 Identities = 57/165 (34%), Positives = 95/165 (57%), Gaps = 5/165 (3%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
                + +F DP+LR+ ++P+ K + ++   I+ M+E MY  DG+GLAA Q+G+  R  V
Sbjct: 11  HHMYRIRVFGDPVLRKRAKPVTKFDENLKKTIERMIETMYHYDGVGLAAPQVGISQRFFV 70

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +D+ +      P+  INP+I+    +  V +EG LS P+   +++RS  I V+Y +   +
Sbjct: 71  MDVGN-----GPVAVINPEILEIDPETEVAEEGXLSFPEIFVEIERSKRIKVKYQNTRGE 125

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
           +     +G  A   QHE DHLNG+L ID +S  KR ++ KK+  +
Sbjct: 126 YVEEELEGYAARVFQHEFDHLNGVLIIDRISPAKRLLLRKKLMDI 170