RPSBLAST alignment of GI: 254780297 and MMDB domain: 3cpm_A_1-172

>3cpm_A (A:1-172) Peptide deformylase, chloroplast; alpha beta, hydrolase, iron, metal-binding, plastid, protein biosynthesis, transit peptide; 2.40A {Arabidopsis thaliana}Length = 172
 Score =  174 bits (443), Expect = 5e-45
 Identities = 58/158 (36%), Positives = 85/158 (53%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
                +V +PDPILR  ++ I+  + ++ NL+D M +VMY TDGIGL+A Q+G+  +L+V
Sbjct: 14  ETPLKIVEYPDPILRAKNKRIDIFDENLKNLVDAMFDVMYKTDGIGLSAPQVGLNVQLMV 73

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            +          +V +NPKI  +SD    + EGCLS P   A+V R   + +   D   +
Sbjct: 74  FNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDARDITGE 133

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMI 158
              I    L A   QHE DHL G+LF D ++    D I
Sbjct: 134 RFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQVLDSI 171