RPSBLAST alignment of GI: 254780297 and MMDB domain: 3dld_A_

>3dld_A (A:) Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV}Length = 171
 Score =  177 bits (449), Expect = 9e-46
 Identities = 49/170 (28%), Positives = 74/170 (43%), Gaps = 7/170 (4%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSD-IMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLV 59
           M++  ++   D  L RV+  +  + S  +  L+ +M E M +  G+GLAA QI V  +L+
Sbjct: 1   MIR-DIIRMGDKRLLRVAPQVTNLGSAELHALVSDMFETMGAAHGVGLAAPQIAVDLQLM 59

Query: 60  VIDLQD-----HAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRY 114
           V   +       A         N +I   SD+     EGCLSIP  RA + R  +I  R 
Sbjct: 60  VFGFEASERYPEAPAVPLTALANAQIEPLSDEMENGWEGCLSIPGLRAVIPRYRYIRYRG 119

Query: 115 MDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
              +       A+G  A  +QHE DHL G L+   +           +S 
Sbjct: 120 FAPDGSPIEREAEGFHARVVQHEYDHLVGRLYPSRIENFDTFGFDDVLSY 169