RPSBLAST alignment of GI: 254780297 and protein with PDBid: 1n5n

>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Length = 180
 Score =  188 bits (480), Expect = 4e-49
 Identities = 73/165 (44%), Positives = 105/165 (63%), Gaps = 2/165 (1%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
           M    ++ FPDP LR +++P+E ++  +  LID+M E MY   GIGLAA Q+ V  R+VV
Sbjct: 13  MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVV 72

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
           +DL +   +  P VFINP+    +++   YQEGCLS+P +  +V R   + ++ +D +  
Sbjct: 73  MDLSED--KSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGN 130

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKL 165
                A+GLLA C+QHE DHLNG LF+D+LS LKRD I KK+ K 
Sbjct: 131 PFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQ 175