RPSBLAST alignment of GI: 254780297 and protein with PDBid: 3cpm

>3cpm_A Peptide deformylase, chloroplast; alpha beta, hydrolase, iron, metal-binding, plastid, protein biosynthesis, transit peptide; 2.40A {Arabidopsis thaliana} Length = 193
 Score =  140 bits (354), Expect = 1e-34
 Identities = 59/167 (35%), Positives = 90/167 (53%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60
                +V +PDPILR  ++ I+  + ++ NL+D M +VMY TDGIGL+A Q+G+  +L+V
Sbjct: 14  ETPLKIVEYPDPILRAKNKRIDIFDENLKNLVDAMFDVMYKTDGIGLSAPQVGLNVQLMV 73

Query: 61  IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120
            +          +V +NPKI  +SD    + EGCLS P   A+V R   + +   D   +
Sbjct: 74  FNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGCLSFPGIYAEVVRPQSVKIDARDITGE 133

Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQ 167
              I    L A   QHE DHL G+LF D ++    D I +++  L +
Sbjct: 134 RFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQVLDSIREELEALEK 180