RPSBLAST alignment of GI: 254780297 and SCOP domain: d1lqya_

Alignment
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 184
 Score =  115 bits (288), Expect = 2e-27
 Identities = 50/181 (27%), Positives = 80/181 (44%), Gaps = 16/181 (8%)

Query: 1   MVKKPLVIFPDPILRRVSRPIEKINSD-IMNLIDNMLEVMYSTD------------GIGL 47
           +  K ++    P LR+V+ P+    S+    ++ ++L+ +  +             GIGL
Sbjct: 2   ITMKDIIKEGHPTLRKVAEPVPLPPSEEDKRILQSLLDYVKMSQDPELAAKYGLRPGIGL 61

Query: 48  AAVQIGVLYRLVVIDLQDHAHRKNPMVFINPKIITFSDDFSVY--QEGCLSIP-DYRADV 104
           AA QI V  R++ + + D           NPKI++ S         EGCLS+  D    V
Sbjct: 62  AAPQINVSKRMIAVHVTDENGTLYSYALFNPKIVSHSVQQCYLTTGEGCLSVDRDVPGYV 121

Query: 105 KRSAFITVRYMDCNAQHQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSK 164
            R A ITV     + +   +   GL A   QHE+DHLNGI+F D ++      +      
Sbjct: 122 LRYARITVTGTTLDGEEVTLRLKGLPAIVFQHEIDHLNGIMFYDRINPADPFQVPDGAIP 181

Query: 165 L 165
           +
Sbjct: 182 I 182

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Bacillus stearothermophilus [TaxId: 1422]