RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780298|ref|YP_003064711.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] (118 letters) >gnl|CDD|32259 COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism]. Length = 106 Score = 29.6 bits (67), Expect = 0.18 Identities = 21/115 (18%), Positives = 43/115 (37%), Gaps = 13/115 (11%) Query: 1 MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI 60 M WI LL + L V+ + +K S F+ L Y +SF+ Sbjct: 2 MAWIYLLLAILLEVVGTTLLKYS-------------DGFTRLWPSILTIVGYGLSFYLLS 48 Query: 61 MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISF 115 + + + +A + T I+ + L++ E +G+ ++ G+ + Sbjct: 49 LALKTIPLGVAYAIWTGIGIVGTALVGVLLFGESLSLIKLLGLALILAGVIGLKL 103 >gnl|CDD|147463 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region. This family includes the N-terminal regions of the junctin, junctate and aspartyl beta-hydroxylase proteins. Junctate is an integral ER/SR membrane calcium binding protein, which comes from an alternatively spliced form of the same gene that generates aspartyl beta-hydroxylase and junctin. Aspartyl beta-hydroxylase catalyses the post-translational hydroxylation of aspartic acid or asparagine residues contained within epidermal growth factor (EGF) domains of proteins. Length = 232 Score = 28.7 bits (64), Expect = 0.39 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 55 SFFTYIMVVAHFSVRIAQTVV 75 SFFT+ MV+A V + VV Sbjct: 11 SFFTWFMVIALLGVWTSVAVV 31 >gnl|CDD|111954 pfam03115, Astro_capsid, Astrovirus capsid protein precursor. This product is encoded by astrovirus ORF2, one of the three astrovirus ORFs (1a, 1b, 2). The 87kD precursor protein undergoes an intracellular cleavage to form a 79kD protein. Subsequently, extracellular trypsin cleavage yields the three proteins forming the infectious virion. Length = 787 Score = 28.6 bits (64), Expect = 0.46 Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 64 AHFSVRIAQTVVTSAIIIIATCLSSLIWD----EPFYWTTAIGIMFVMIGIT 111 AHF+V+I + + T +SS+ W +P I + V+ G + Sbjct: 462 AHFTVKIGKDTQHYLTMQGFTLISSVDWYTPDFQPSEEPPPIPGLQVLGGSS 513 >gnl|CDD|38818 KOG3612, KOG3612, KOG3612, PHD Zn-finger protein [General function prediction only]. Length = 588 Score = 28.2 bits (62), Expect = 0.56 Identities = 8/30 (26%), Positives = 10/30 (33%) Query: 17 SVFIKMSIIPPEAPPHFADSTRFSDGKLFW 46 SVF+ SI P S+ W Sbjct: 296 SVFVGQSIREIRRCPLCYRSSNTLSLGDTW 325 >gnl|CDD|38780 KOG3572, KOG3572, KOG3572, Uncharacterized conserved protein, contains DEP domain [Signal transduction mechanisms]. Length = 1701 Score = 26.6 bits (58), Expect = 1.5 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 20 IKMSIIPPEAPPHFADSTRFSDGKLFWLGFF 50 I++++ P P + F KL+WLGF Sbjct: 1536 IRIALNPKVVP-ESDEREEFLLSKLYWLGFI 1565 >gnl|CDD|144477 pfam00892, EamA, EamA-like transporter family. This family includes many hypothetical membrane proteins of unknown function. Many of the proteins contain two copies of the aligned region. The family used to be known as DUF6. Length = 126 Score = 26.8 bits (60), Expect = 1.6 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Query: 44 LFWLGFFFYAISFFTYIMVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGI 103 L +LG F A+ + Y + + S A +V+TS + LS L+ E +GI Sbjct: 56 LLYLGLFGTALGYLLYFYALKYVSASNA-SVITSLSPVFTLILSVLLLGEKLTLKQLLGI 114 Query: 104 MFVMIGITLISF 115 + +++G+ LI Sbjct: 115 VLILLGVLLILL 126 >gnl|CDD|111366 pfam02460, Patched, Patched family. The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals. Length = 801 Score = 25.0 bits (55), Expect = 4.4 Identities = 21/91 (23%), Positives = 35/91 (38%), Gaps = 20/91 (21%) Query: 42 GKLFWLGFFFYAISFFT------------YIMVVA------HFSV--RIAQTVVTSAIII 81 G LFW GF F +I T ++MV A SV R+ +T+ + I Sbjct: 269 GLLFWFGFPFNSIVCVTPFLVLAIGVDDMFLMVHAWQRTTKTLSVKKRMGETLSEAGPSI 328 Query: 82 IATCLSSLIWDEPFYWTTAIGIMFVMIGITL 112 T L++++ +T I + + Sbjct: 329 TITSLTNVLSFGIGTYTPTPAIQLFCLYTAV 359 >gnl|CDD|143398 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19. Gamma-glutamyl phosphate reductase (GPR), a L-proline biosynthetic pathway (PBP) enzyme that catalyzes the NADPH dependent reduction of L-gamma-glutamyl 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The glutamate route of the PBP involves two enzymatic steps catalyzed by gamma-glutamyl kinase (GK, EC 2.7.2.11) and GPR (EC 1.2.1.41). These enzymes are fused into the bifunctional enzyme, ProA or delta(1)-pyrroline-5-carboxylate synthetase (P5CS) in plants and animals, whereas they are separate enzymes in bacteria and yeast. In humans, the P5CS (ALDH18A1), an inner mitochondrial membrane enzyme, is essential to the de novo synthesis of the amino acids proline and arginine. Tomato (Lycopersicon esculentum) has both the prokaryotic-like polycistronic operons encoding GK and GPR (PRO1, ALDH19) and the full-length, bifunctional P5CS (PRO2, ALDH18B1). Length = 406 Score = 25.1 bits (56), Expect = 4.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Query: 36 STRFSDGKLFWLG 48 STRF+DG F LG Sbjct: 363 STRFTDGGEFGLG 375 >gnl|CDD|36795 KOG1582, KOG1582, KOG1582, UDP-galactose transporter related protein [Carbohydrate transport and metabolism]. Length = 367 Score = 24.9 bits (54), Expect = 5.2 Identities = 17/72 (23%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Query: 43 KLFWLGFFFYAISFFTYIMVVAHFSVRIAQT--VVTSAIIIIATCLSSLIWDEPFYWTTA 100 + + F F + + V+A + A VT+A + LS L++ +PF Sbjct: 258 RTYGYAFLFSLAGYLGIVFVLALIKLFGALIAATVTTARKAVTILLSFLLFSKPFTEQYV 317 Query: 101 IGIMFVMIGITL 112 + V++GI L Sbjct: 318 WSGLLVVLGIYL 329 >gnl|CDD|36271 KOG1053, KOG1053, KOG1053, Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism, Amino acid transport and metabolism, Signal transduction mechanisms]. Length = 1258 Score = 24.2 bits (52), Expect = 8.7 Identities = 10/52 (19%), Positives = 23/52 (44%) Query: 63 VAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLIS 114 V FSV +T ++ + +S + EPF + + + + + + I+ Sbjct: 530 VVDFSVPFVETGISVMVARSNGTVSPSAFLEPFSPSVWVMMFVMCLIVAAIT 581 >gnl|CDD|143916 pfam00148, Oxidored_nitro, Nitrogenase component 1 type Oxidoreductase. Length = 398 Score = 24.1 bits (53), Expect = 9.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 78 AIIIIATCLSSLI 90 AI + TC+S LI Sbjct: 77 AIFVYTTCVSELI 89 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.334 0.143 0.459 Gapped Lambda K H 0.267 0.0653 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,552,175 Number of extensions: 77785 Number of successful extensions: 605 Number of sequences better than 10.0: 1 Number of HSP's gapped: 594 Number of HSP's successfully gapped: 134 Length of query: 118 Length of database: 6,263,737 Length adjustment: 81 Effective length of query: 37 Effective length of database: 4,513,408 Effective search space: 166996096 Effective search space used: 166996096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 51 (23.6 bits)