BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780298|ref|YP_003064711.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] (118 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780298|ref|YP_003064711.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 118 Score = 233 bits (594), Expect = 7e-64, Method: Compositional matrix adjust. Identities = 118/118 (100%), Positives = 118/118 (100%) Query: 1 MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI 60 MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI Sbjct: 1 MKWIALLANVALGVLSSVFIKMSIIPPEAPPHFADSTRFSDGKLFWLGFFFYAISFFTYI 60 Query: 61 MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI 118 MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI Sbjct: 61 MVVAHFSVRIAQTVVTSAIIIIATCLSSLIWDEPFYWTTAIGIMFVMIGITLISFHTI 118 >gi|254780742|ref|YP_003065155.1| hypothetical protein CLIBASIA_03145 [Candidatus Liberibacter asiaticus str. psy62] Length = 419 Score = 23.9 bits (50), Expect = 0.82, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Query: 45 FWLGFFFYAISFFTYIMVVAHFS---VRIAQTVVTSAIIIIATCL 86 FW+GF + I+ FT + + S +R A+ + + + I+ L Sbjct: 257 FWMGFSDHYINVFTVLKNIGLLSEQPIRTAENIEIAPLKIVKAVL 301 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.143 0.459 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,867 Number of Sequences: 1233 Number of extensions: 2390 Number of successful extensions: 16 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 10 length of query: 118 length of database: 328,796 effective HSP length: 64 effective length of query: 54 effective length of database: 249,884 effective search space: 13493736 effective search space used: 13493736 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 33 (17.3 bits)