BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780302|ref|YP_003064715.1| putative glycerol-3-phosphate acyltransferase PlsY [Candidatus Liberibacter asiaticus str. psy62] (205 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780302|ref|YP_003064715.1| putative glycerol-3-phosphate acyltransferase PlsY [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 402 bits (1032), Expect = e-114, Method: Compositional matrix adjust. Identities = 205/205 (100%), Positives = 205/205 (100%) Query: 1 MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSN 60 MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSN Sbjct: 1 MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSN 60 Query: 61 KKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYI 120 KKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYI Sbjct: 61 KKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYI 120 Query: 121 GVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMT 180 GVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMT Sbjct: 121 GVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMT 180 Query: 181 ITVYWKHIENIKRLILGSEKKIFKK 205 ITVYWKHIENIKRLILGSEKKIFKK Sbjct: 181 ITVYWKHIENIKRLILGSEKKIFKK 205 >gi|254781047|ref|YP_003065460.1| AFG1-family ATPase [Candidatus Liberibacter asiaticus str. psy62] Length = 404 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 79 IIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIAL 126 I+++ ++HKIG++ + +FP L+ KG I + L + Sbjct: 322 IMLIDVFYEHKIGLIISSEENIEDLFPYKLR-KGAFEIQRTVSRLYEM 368 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 23.1 bits (48), Expect = 3.2, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 18/32 (56%) Query: 172 IPIIFTFMTITVYWKHIENIKRLILGSEKKIF 203 IP++ + +TI KH N KR I +E K F Sbjct: 453 IPMMQSRLTIRDNVKHYANRKRSIHDAENKSF 484 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.142 0.417 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 126,455 Number of Sequences: 1233 Number of extensions: 4713 Number of successful extensions: 25 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 8 length of query: 205 length of database: 328,796 effective HSP length: 70 effective length of query: 135 effective length of database: 242,486 effective search space: 32735610 effective search space used: 32735610 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 36 (18.5 bits)