HHsearch alignment for GI: 254780303 and conserved domain: PRK08786

>PRK08786 consensus.
Probab=91.62  E-value=0.28  Score=28.63  Aligned_cols=45  Identities=16%  Similarity=0.286  Sum_probs=36.9

Q ss_pred             CCHHHHHHHHHHHH--------CCCCCHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             89999999999986--------5896899999999974999999997099999
Q gi|254780303|r   13 LTDDQKISWLRLIR--------SDNISPATCRDMINYFGSAEQALEMIPELAQ   57 (77)
Q Consensus        13 ls~~erlawLRL~R--------t~~VGp~Tf~~Ll~~fGsA~aAL~aLP~la~   57 (77)
T Consensus       166 V~P~qviD~lAL~GDsSDNIPGVpGIG~KTA~kLL~eyGsLE~I~~n~d~Ikg  218 (927)
T PRK08786        166 VRPDQIVDLLALMGDTVDNVPGVEKCGPKTAAKWLAEYDSLDGVIANADKIKG  218 (927)
T ss_pred             CCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             69899999999808764678999985689999999975769999999875546