HHsearch alignment for GI: 254780303 and conserved domain: cd00008

>cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes. They digest dsDNA and ssDNA, releasing mono-,di- and tri-nucleotides, as well as oligonucleotides, and have also been reported to possess RNase H activity. Also called 5' nuclease family, involved in structure-specific cleavage of flaps formed by Pol I activity (similar to mammalian flap endonuclease I, FEN-1). A single nucleic acid strand may be threaded through the 5' nuclease enzyme before cleavage occurs. The domain binds two divalent metal ions which are necessary for activity.
Probab=93.38  E-value=0.091  Score=31.39  Aligned_cols=45  Identities=27%  Similarity=0.386  Sum_probs=34.3

Q ss_pred             CCHHHHHHHHHHHH--C------CCCCHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             89999999999986--5------896899999999974999999997099999
Q gi|254780303|r   13 LTDDQKISWLRLIR--S------DNISPATCRDMINYFGSAEQALEMIPELAQ   57 (77)
Q Consensus        13 ls~~erlawLRL~R--t------~~VGp~Tf~~Ll~~fGsA~aAL~aLP~la~   57 (77)
T Consensus       166 v~p~q~~d~~aL~GD~sDnIpGV~GiG~KtA~kLl~~~gsle~i~~~~~~~~~  218 (240)
T cd00008         166 VTPAQIIDYKALMGDSSDNIPGVPGIGEKTAAKLLKEYGSLEGILENLDKIKG  218 (240)
T ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHCCH
T ss_conf             89999987699728764688999985789999999980999999982985278