HHSEARCH alignment of GI: 254780303 and SCOP domain: d1kfta_

Alignment
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=92.86  E-value=0.021  Score=32.43  Aligned_cols=33  Identities=15%  Similarity=0.251  Sum_probs=27.9

Q ss_pred             HHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHH
Q ss_conf             986589689999999997499999999709999
Q gi|254780303|r   24 LIRSDNISPATCRDMINYFGSAEQALEMIPELA   56 (77)
Q Consensus        24 L~Rt~~VGp~Tf~~Ll~~fGsA~aAL~aLP~la   56 (77)
                      |-.-|+|||.+...|+++|||-++...|-++=.
T Consensus         4 L~~I~gVG~~~a~~L~~~F~s~~~i~~As~eeL   36 (56)
T d1kfta_           4 LETIEGVGPKRRQMLLKYMGGLQGLRNASVEEI   36 (56)
T ss_dssp             GGGCTTCSSSHHHHHHHHHSCHHHHHHCCHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             535898009999999999399999998649999


SCOP domain information

class: All alpha proteins
fold: SAM domain-like
superfamily: RuvA domain 2-like
family: Excinuclease UvrC C-terminal domain
domain: Excinuclease UvrC C-terminal domain
species: Escherichia coli [TaxId: 562]