RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780303|ref|YP_003064716.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (77 letters) >3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Length = 382 Score = 69.6 bits (170), Expect = 2e-13 Identities = 30/67 (44%), Positives = 44/67 (65%) Query: 1 MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA 60 + + + +G LT+ Q+I W+RLIR++N+ P T R +IN+FGSA ALE +PELA+RG Sbjct: 5 VGERSSDQGTTVLTEAQRIDWMRLIRAENVGPRTFRSLINHFGSARAALERLPELARRGG 64 Query: 61 VYAGKRA 67 R Sbjct: 65 AARAGRI 71 >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 Score = 24.9 bits (54), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 44 SAEQALEMIPELAQRGAV 61 + EQALE+ LA+ GAV Sbjct: 794 TGEQALEICDALARSGAV 811 >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Length = 296 Score = 24.8 bits (53), Expect = 5.0 Identities = 8/36 (22%), Positives = 11/36 (30%), Gaps = 4/36 (11%) Query: 6 PLKGGVSLTD----DQKISWLRLIRSDNISPATCRD 37 L G + D + RL RS +S Sbjct: 25 ELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAG 60 >3ih1_A Methylisocitrate lyase; alpha-beta structure, TIM-barrel, center for structural genomics of infectious diseases, csgid; 2.00A {Bacillus anthracis str} PDB: 3kz2_A Length = 305 Score = 24.5 bits (53), Expect = 5.3 Identities = 4/35 (11%), Positives = 7/35 (20%) Query: 27 SDNISPATCRDMINYFGSAEQALEMIPELAQRGAV 61 D+ FG E+ + Sbjct: 85 VRATDLPVLVDIDTGFGGVLNVARTAVEMVEAKVA 119 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 24.2 bits (51), Expect = 8.2 Identities = 8/33 (24%), Positives = 15/33 (45%), Gaps = 15/33 (45%) Query: 1 MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPA 33 +KK+ + S L+L +D+ +PA Sbjct: 22 LKKL-------------QAS-LKLY-ADDSAPA 39 >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Score = 23.9 bits (51), Expect = 8.3 Identities = 11/43 (25%), Positives = 17/43 (39%), Gaps = 13/43 (30%) Query: 15 DDQKISWLRL-------------IRSDNISPATCRDMINYFGS 44 DD +IS L +R++ S +CR M+N Sbjct: 546 DDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDR 588 >2ia0_A Putative HTH-type transcriptional regulator PF0864; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Length = 171 Score = 24.0 bits (51), Expect = 8.5 Identities = 5/30 (16%), Positives = 9/30 (30%) Query: 13 LTDDQKISWLRLIRSDNISPATCRDMINYF 42 L D +++ L +T I Sbjct: 26 LKKDARLTISELSEQLKKPESTIHFRIKKL 55 >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Length = 78 Score = 24.0 bits (52), Expect = 9.2 Identities = 5/30 (16%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Query: 29 NISPATCRDMINYFGSAEQALE-MIPELAQ 57 + P + ++ Y G + + E+A+ Sbjct: 31 GVGPKRRQMLLKYMGGLQGLRNASVEEIAK 60 >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Length = 141 Score = 23.9 bits (51), Expect = 9.2 Identities = 5/43 (11%), Positives = 12/43 (27%) Query: 13 LTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPEL 55 L D + + + + IS R + ++ Sbjct: 13 LEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKI 55 >3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Score = 23.8 bits (51), Expect = 9.5 Identities = 8/49 (16%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Query: 7 LKGGVSLTDDQKISWLR-LIRSDNISPATCRDMINYFGSAEQALEMIPE 54 +K S +DD+ ++ ++ I Y A+ L + + Sbjct: 259 VKHLTSTSDDEVYQYIVSQVKQYGIE-PAELLSRKYGDKAKYHLSQLQD 306 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.317 0.130 0.371 Gapped Lambda K H 0.267 0.0576 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 633,432 Number of extensions: 23880 Number of successful extensions: 109 Number of sequences better than 10.0: 1 Number of HSP's gapped: 109 Number of HSP's successfully gapped: 20 Length of query: 77 Length of database: 5,693,230 Length adjustment: 46 Effective length of query: 31 Effective length of database: 4,578,006 Effective search space: 141918186 Effective search space used: 141918186 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.4 bits)